Basic Information | |
---|---|
Family ID | F078917 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 43 residues |
Representative Sequence | VGKDPTARQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 28.57 % |
% of genes near scaffold ends (potentially truncated) | 4.31 % |
% of genes from short scaffolds (< 2000 bps) | 5.17 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (93.966 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.345 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.241 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.39% β-sheet: 11.11% Coil/Unstructured: 62.50% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF02943 | FeThRed_B | 68.97 |
PF01042 | Ribonuc_L-PSP | 7.76 |
PF01958 | Asp_DH_C | 3.45 |
PF00206 | Lyase_1 | 1.72 |
PF09674 | DUF2400 | 1.72 |
PF06938 | DUF1285 | 0.86 |
PF02668 | TauD | 0.86 |
PF03070 | TENA_THI-4 | 0.86 |
PF00378 | ECH_1 | 0.86 |
PF12867 | DinB_2 | 0.86 |
PF01569 | PAP2 | 0.86 |
PF01547 | SBP_bac_1 | 0.86 |
PF13181 | TPR_8 | 0.86 |
PF14518 | Haem_oxygenas_2 | 0.86 |
PF02515 | CoA_transf_3 | 0.86 |
PF04909 | Amidohydro_2 | 0.86 |
PF03473 | MOSC | 0.86 |
PF01593 | Amino_oxidase | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG4802 | Ferredoxin-thioredoxin reductase, catalytic subunit | Energy production and conversion [C] | 68.97 |
COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 7.76 |
COG1712 | L-aspartate dehydrogenase, NAD(P)-dependent | Amino acid transport and metabolism [E] | 3.45 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.86 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.86 |
COG3816 | Uncharacterized conserved protein, DUF1285 family | Function unknown [S] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 93.97 % |
All Organisms | root | All Organisms | 6.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300025912|Ga0207707_10227592 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1623 | Open in IMG/M |
3300027526|Ga0209968_1010963 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300027671|Ga0209588_1067360 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1157 | Open in IMG/M |
3300027886|Ga0209486_10139384 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1326 | Open in IMG/M |
3300027907|Ga0207428_10164322 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1684 | Open in IMG/M |
3300031548|Ga0307408_100004122 | All Organisms → cellular organisms → Bacteria | 9902 | Open in IMG/M |
3300032126|Ga0307415_101261700 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.62% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.17% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 5.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.31% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.45% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.59% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.72% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.72% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.72% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.72% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.86% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.86% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.86% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.86% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.86% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.86% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.86% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.86% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.86% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.86% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.86% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
3300006604 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010857 | Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012405 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019228 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12053J15887_104614431 | 3300001661 | Forest Soil | NVGRDPGAREELMALGLTSLPVLLIGDKRLTGFNPTQIDAALSAST* |
JGI25382J43887_103012741 | 3300002908 | Grasslands Soil | VGKDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG* |
soilL1_100203332 | 3300003267 | Sugarcane Root And Bulk Soil | VGRDPGAREELMEIGLTSLPVILIGEHKLAGFNPKKIDEALADGADHG* |
Ga0063356_1007050253 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGRDAGAREELMEIGLTSLPVILIGEHKLAGFNPKKIDEALAGSADHG* |
Ga0062595_1025520742 | 3300004479 | Soil | GKDPTARQELMELGLTSLPVILIGDKRLTGFNPTAIDAALAG* |
Ga0066677_104872062 | 3300005171 | Soil | VGRDPEAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQS* |
Ga0066388_1052383921 | 3300005332 | Tropical Forest Soil | VGRDPEARQELIALGLLSLPVLLIGEQKLTGFNPNAIDSALAART* |
Ga0070703_105489131 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | TEKNVGRDPEARQELMALGLLSLPVLLIGDKKLTGFNPKAIDAALAES* |
Ga0070705_1003273071 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | PKAREELMALGLLSLPVIIIGDKRLTGFNPKAIDAALGAP* |
Ga0070698_1000659354 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VGRDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG* |
Ga0070695_1018139611 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | RNVGRDPGAREELMEIGLTSLPVILIGEHKLAGFNPKKIDEALATLHD* |
Ga0070696_1001323243 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | DPEARQELMALGLLSLPVLLIGDKKLTGFNPKAIDAALSEG* |
Ga0066695_102219431 | 3300005553 | Soil | GKDPVARQELMAIGLTSLPVLLIGEKKLTGFNPNQIDEAINALNG* |
Ga0066695_102464842 | 3300005553 | Soil | VGRDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQS* |
Ga0066693_101616583 | 3300005566 | Soil | GKDPVARQELMDIGLTSLPVLLIGEKKLTGFNPNQIDEAINALNG* |
Ga0066905_1000362633 | 3300005713 | Tropical Forest Soil | VGRDPEARQELIALGLLSLPVLLIGEQKLTGFNPTAIDAALAALT* |
Ga0066905_1000493824 | 3300005713 | Tropical Forest Soil | VGRDPEARQELIALGLLSLPVLLIGEQKLTGFNPNAIDAALAALT* |
Ga0066905_1018804201 | 3300005713 | Tropical Forest Soil | VGKDPTARQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG* |
Ga0068866_102739271 | 3300005718 | Miscanthus Rhizosphere | PTARQELMELGLMSLPVILIGDKRLTGFNPNAIDAALAE* |
Ga0066903_1052427952 | 3300005764 | Tropical Forest Soil | RQELMEIGITSLPVIIIGETRLAGFNPSKIDEALAQVQP* |
Ga0075427_100269181 | 3300006194 | Populus Rhizosphere | DPKAREELMALGLLSLPVIIIGDKRLTGFNPKAIDAALSAS* |
Ga0074060_102972602 | 3300006604 | Soil | ARQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG* |
Ga0079222_126349961 | 3300006755 | Agricultural Soil | VGKDPTARQELMELGLTSLPVILIGDKRLTGFNPTAIDAALAG* |
Ga0066658_100629463 | 3300006794 | Soil | GKDPKGREELMALGLLSLPVIIIGDKRLTGCNPNAIDGALNAS* |
Ga0075428_1021613251 | 3300006844 | Populus Rhizosphere | VGRDPGAREELMEIGLTSLPVILIGEHKLAGFNPKKIDEALAESST* |
Ga0075421_1015823731 | 3300006845 | Populus Rhizosphere | REELMALGLLSLPVILIGDKRLTGFNPKAIDAALSAS* |
Ga0075421_1022776611 | 3300006845 | Populus Rhizosphere | NIGKDPGAREELMATGLMSLPVLIIGDKKITGFNPKMIDATIAEQSGG* |
Ga0075433_108253323 | 3300006852 | Populus Rhizosphere | TEKNVGRDPEARQELMALGLLSLPVLIIGDKKLTGFNPKAIDAALADT* |
Ga0075420_1000955214 | 3300006853 | Populus Rhizosphere | KDPAARQELATMGLMSLPVLLIGDKRLTGFNPAQIDAALAEAGS* |
Ga0079217_111598121 | 3300006876 | Agricultural Soil | NVGRDPQARQELMDLGLLSLPVLLIGDKKLTGFNPAQIDAALAAAGGGSST* |
Ga0079215_100964902 | 3300006894 | Agricultural Soil | VGKDPTARQELMELGLMSLPVILIGDKRLTGFNPNAIDAALAAE* |
Ga0105251_105411871 | 3300009011 | Switchgrass Rhizosphere | ARKELMAIGIMSLPVIIIGETRLAGFNPAKIDEALAKAEG* |
Ga0066710_1014410231 | 3300009012 | Grasslands Soil | PFTERNVGRDPGAREELMALGLTSLPVLLIGDKRLTGFNPAQIDAALSAS |
Ga0099829_112949912 | 3300009038 | Vadose Zone Soil | KDPTARQELMDLGLTSLPVILIGDKRLTGFNPTAIDAALAGN* |
Ga0114129_103766454 | 3300009147 | Populus Rhizosphere | VGKDPKAREELMALGLLSLPVIIIGDKRLTGFNPKAIDAALSAS* |
Ga0105243_105340211 | 3300009148 | Miscanthus Rhizosphere | VGKDPRAGQELMELGLTSLHVILIGDKRLTGFNPTAIDAALAG* |
Ga0105100_108005841 | 3300009166 | Freshwater Sediment | RKELMAIGIMSLPVIIIGETRLAGFNPAKIDEALAKAQG* |
Ga0105242_112910051 | 3300009176 | Miscanthus Rhizosphere | ERNVGKDPTARQELMELGLMSLPVILIGDKRLTGFNPNAIDAALAG* |
Ga0114945_106090921 | 3300009444 | Thermal Springs | VGRDPDARKELISLGVTSLPVLLIGDSRLHGFNPAQIDAALAALAE* |
Ga0126374_102315472 | 3300009792 | Tropical Forest Soil | MEIGLLSLPVIIIGETRLTGFNPTKIDEALAQVKG* |
Ga0105064_10742242 | 3300009821 | Groundwater Sand | VGRDPEARQELISLGLLSLPVLLIGDQKLTGFNPNAIDAALAALT* |
Ga0127494_10895251 | 3300010107 | Grasslands Soil | RNVGKDPKAREALMALGLLSLPVIIIGDKRLTGFNPTQIDAALNAS* |
Ga0126376_103228913 | 3300010359 | Tropical Forest Soil | VGRDPKAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQIQG* |
Ga0126372_132376051 | 3300010360 | Tropical Forest Soil | ARQELMTLGLLSLPVLLIGDKKLTGFNPKAIDAALAEG* |
Ga0126377_113422131 | 3300010362 | Tropical Forest Soil | PKAREELMALGLLSLPVIIIGDKRLTGFNPKAIDAALSAS* |
Ga0126377_123191082 | 3300010362 | Tropical Forest Soil | EARQELMEIGITSLPVIIIGETRLAGFNPMKIDEALAREQG* |
Ga0134123_126939501 | 3300010403 | Terrestrial Soil | ARQELMELGLTSLPVILIGDKRLTGFNPTAIDAALAG* |
Ga0126354_11674191 | 3300010857 | Boreal Forest Soil | REELIGLGLTSLPVLIIDGQKLAGFNPNAIDAALSR* |
Ga0105246_114151163 | 3300011119 | Miscanthus Rhizosphere | MAIGIMSLPVIIIGETRLAGFNPAKIDEALAKAET* |
Ga0137365_109053603 | 3300012201 | Vadose Zone Soil | DPEARQELMELGLLSLPVLLIGEQKLTGFNPTKIDEALKTLDA* |
Ga0137362_109214483 | 3300012205 | Vadose Zone Soil | REELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQVQG* |
Ga0134028_10619891 | 3300012224 | Grasslands Soil | VGKDPTARQELMELGLTSLPVILIGDKRLTGFNPAQIDAALSAST* |
Ga0137361_111718721 | 3300012362 | Vadose Zone Soil | ERNVGRDPGAREELMALGLTSLPVLLIGDKRLTGFNPAQIDAALSAS* |
Ga0134058_10706862 | 3300012379 | Grasslands Soil | FTERNVGRDPKAREELMALGLTSLPVLLIGDKRLTGFNPAQIDAALSAS* |
Ga0134051_12569412 | 3300012398 | Grasslands Soil | ERNVGRDPKAREELMALGVTSLPVLLIGDKRLTGFNPAQIDAALGAS* |
Ga0134041_12154612 | 3300012405 | Grasslands Soil | REELMALGLLSLPVIIIGDKRLTGFNPNAIDAALNAS* |
Ga0137358_103457672 | 3300012582 | Vadose Zone Soil | MAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQS* |
Ga0137404_102953273 | 3300012929 | Vadose Zone Soil | VGRDPTAREELMALGLTSLPVLLIGDKRLTGFNPAQIDAALSAS* |
Ga0137410_102669983 | 3300012944 | Vadose Zone Soil | EELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG* |
Ga0126375_100019141 | 3300012948 | Tropical Forest Soil | NVGKDPKAREELMALGLLSLPVIIIGDKRLTGFNPKAIDAALGAA* |
Ga0180063_11214872 | 3300014885 | Soil | VGRDPEARQELISLGLLSLPVLLIGEQKLTGFNPNAIDAALAALT* |
Ga0180085_10494384 | 3300015259 | Soil | PGAREELMEIGLTSLPVILIGEHKLAGFNPKKIDEALASL* |
Ga0180085_11563821 | 3300015259 | Soil | RDPEARQELISVGLLSLPVLLIGEQKLTGFNPNAIDAALAALT* |
Ga0132256_1013427321 | 3300015372 | Arabidopsis Rhizosphere | TARQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG* |
Ga0134069_11631802 | 3300017654 | Grasslands Soil | VGRDPQAREELMAIGMTSLPVIIISETRLAGFNPAKIDEALAQAQS |
Ga0163161_103359033 | 3300017792 | Switchgrass Rhizosphere | PKARGELMALGLLSLPVIIIGDKRLTGFNPKAIDAALGAP |
Ga0187775_101898122 | 3300017939 | Tropical Peatland | VGKDPQARQELMEIGLLSLPVILIGDLRLTGFNPKKIDEALAQVEG |
Ga0184619_102766033 | 3300018061 | Groundwater Sediment | RQELMELGLTSLPVILIGDKRLTGFNPNAIDAALAAE |
Ga0066667_102847172 | 3300018433 | Grasslands Soil | VGRDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQVQS |
Ga0066669_109545433 | 3300018482 | Grasslands Soil | VGKDPVARQELMEIGLTSLPVLLIGEKKLTGFNPNQIDEAINALNG |
Ga0180119_12574463 | 3300019228 | Groundwater Sediment | VGRDPEARQELISLGLLSLPVLLIGEQKLTGFNPNAIDAALAALT |
Ga0137408_10285702 | 3300019789 | Vadose Zone Soil | VGRDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG |
Ga0180118_13839051 | 3300020063 | Groundwater Sediment | VGRDPEARQELISLGLLSLPVLLIGEQKLTGFNPKAIDAALAAQT |
Ga0210139_11239882 | 3300025558 | Natural And Restored Wetlands | DPQARQELMEIGITSLPVIIIGETRLAGFNPMKIDEALAAQG |
Ga0207707_102275921 | 3300025912 | Corn Rhizosphere | VGKDPTARQELMELGLMSLPVILIGDKRLTGFNPNAIDAALAE |
Ga0207709_105471293 | 3300025935 | Miscanthus Rhizosphere | KDPTARQELMELGLTSLPVILIGDKRLTGFNPTAIDAALAG |
Ga0208419_10429191 | 3300026032 | Natural And Restored Wetlands | NVGRDPGAREELMAIGLTSLPVILIGDHKLAGFNPKKIDEALAAQGS |
Ga0209235_11211563 | 3300026296 | Grasslands Soil | ELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQS |
Ga0209761_11237172 | 3300026313 | Grasslands Soil | VGRDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQS |
Ga0209686_11935821 | 3300026315 | Soil | AREELMALGLLSLPVIIIGDKRLTGFNPNAIDAALNAS |
Ga0209472_12268361 | 3300026323 | Soil | VGKDPGARQELMEIGLTSLPVLLIGEKKLTGFNPNQIDEAINALNG |
Ga0209803_11684061 | 3300026332 | Soil | VGKDPKAREELMALGLLSLPVIIIGDKRLTGFNPNAIDAALKAS |
Ga0209158_12207592 | 3300026333 | Soil | VGKDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG |
Ga0209804_13007052 | 3300026335 | Soil | ELMALGLLSLPVIIIGDKRLTGFNPNAIDAALNAS |
Ga0209690_12025821 | 3300026524 | Soil | ELMALGLLSLPVIIIGDKRLTGFNPNAIDAALKAS |
Ga0209806_11385362 | 3300026529 | Soil | VGKDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQS |
Ga0256867_101382513 | 3300026535 | Soil | ERNVGKDPTARQELMELGLMSLPVILIGDKRLTGFNPNAIDAALAE |
Ga0209846_10655902 | 3300027277 | Groundwater Sand | VGRDPEARQELISLGLLSLPVLLIGGQKLTGFNPNAIDAALAALT |
Ga0209843_10787812 | 3300027511 | Groundwater Sand | VGRDPEARQELISLGLLSLPVLLIGDQKLTGFNPNAIDAALA |
Ga0209968_10109633 | 3300027526 | Arabidopsis Thaliana Rhizosphere | VGRDPGAREELMEIGLTSLPVILIGEHKLAGFNPKKIDEALAEGADHG |
Ga0209588_10673604 | 3300027671 | Vadose Zone Soil | GAREELMELGLTSLPVILIGELRLSGFNPKKIDEALAGS |
Ga0209180_100139893 | 3300027846 | Vadose Zone Soil | MAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG |
Ga0209283_105780271 | 3300027875 | Vadose Zone Soil | ELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQG |
Ga0209486_101393841 | 3300027886 | Agricultural Soil | PTARQELMELGLMSLPVILIGDKRLTGFNPKAIDAALAGE |
Ga0207428_101643225 | 3300027907 | Populus Rhizosphere | NVGKDPTARQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG |
Ga0209382_115903882 | 3300027909 | Populus Rhizosphere | KDPTARQELMELGLMSLPVILIGDKRLTGFNPNAIDAALAE |
Ga0209885_10323592 | 3300027950 | Groundwater Sand | PKAREELMALGLTSLPVLLIGDKRLTGFNPAQIDAALSAS |
Ga0209889_10003191 | 3300027952 | Groundwater Sand | ERNVGRDPKAREELMALGLTALPVLLIGDKRLTGFNPAQIDAALSAS |
Ga0209889_10364671 | 3300027952 | Groundwater Sand | VGRDPKAREELMALGLTSLPVLLIGDKRLTGFNPAQIDAALSAS |
(restricted) Ga0233417_104180432 | 3300028043 | Sediment | VGRDPEARQELIALGLLSLPVLLIGEQKLTGFNPNAIDAALAALG |
Ga0209526_102383352 | 3300028047 | Forest Soil | VGRDPQAREELMAIGMTSLPVIIIGETRLAGFNPAKIDEALAQAQ |
Ga0137415_101372712 | 3300028536 | Vadose Zone Soil | MAIGMTSLPVIIIGETRLAGFNPAKIDEALAQVQG |
Ga0307504_103630312 | 3300028792 | Soil | PKAREELMALGLLSLPVIIIGDKRLTGFNPKAIDAALGAS |
(restricted) Ga0255312_10436423 | 3300031248 | Sandy Soil | EARQELMALGLLSLPVLLIGDKKLTGFNPKAIDAALAGG |
Ga0310887_100839835 | 3300031547 | Soil | ERNVGKDPTARQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG |
Ga0307408_1000041228 | 3300031548 | Rhizosphere | VGKDPTARQELMELGLMSLPVILIGDKRLTGFNPKAIDAALAGE |
Ga0307469_100326204 | 3300031720 | Hardwood Forest Soil | VGKDPTARQELMELGLTSLPVILIGDKRLTGFNPTAIDAALAG |
Ga0307468_1000442281 | 3300031740 | Hardwood Forest Soil | RQELMELGLLSLPVILIGDKRLTGFNPKAIDAALAEG |
Ga0318504_105626741 | 3300032063 | Soil | ARQELMEIGITSLPVIIIGETRLAGFNPAKIDEALAQVKS |
Ga0307415_1012617003 | 3300032126 | Rhizosphere | AGAREELMAIGLTSLPVILIGEHKLAGFNPKKIDEALAGVSDG |
Ga0307470_106131161 | 3300032174 | Hardwood Forest Soil | VGRDPEARQELIALGLLSLPVLLIGEQKLTGFNPKAIDTALAALA |
Ga0307472_1001782212 | 3300032205 | Hardwood Forest Soil | VGRDPEARQELMALGLLSLPVLLIGDKRLTGFNPKAIDAALAEG |
Ga0307472_1011818532 | 3300032205 | Hardwood Forest Soil | VGKDPQARQELMEIGITSLPVIIIGETRLAGFNPMKIDEALAAQG |
Ga0307472_1024190332 | 3300032205 | Hardwood Forest Soil | EARQELMALGLLSLPVLLIGDKKLTGFNPKAIDAALAEG |
Ga0326726_107609881 | 3300033433 | Peat Soil | GKDPQARQELMEIGILSLPVIIIGETRLAGFNPMKIDEALAKMQS |
Ga0326726_111573922 | 3300033433 | Peat Soil | MEIGILSLPVIIIGETRLAGFNPMKIDEALAKMQP |
⦗Top⦘ |