Basic Information | |
---|---|
Family ID | F078673 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 55 residues |
Representative Sequence | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTIDELILNGRWK |
Number of Associated Samples | 68 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.03 % |
% of genes near scaffold ends (potentially truncated) | 18.97 % |
% of genes from short scaffolds (< 2000 bps) | 84.48 % |
Associated GOLD sequencing projects | 50 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (51.724 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (69.828 % of family members) |
Environment Ontology (ENVO) | Unclassified (93.103 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (93.966 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.54% β-sheet: 29.27% Coil/Unstructured: 62.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF06356 | DUF1064 | 5.17 |
PF13188 | PAS_8 | 2.59 |
PF02675 | AdoMet_dc | 2.59 |
PF00805 | Pentapeptide | 1.72 |
PF04266 | ASCH | 1.72 |
PF00462 | Glutaredoxin | 1.72 |
PF13597 | NRDD | 0.86 |
PF07282 | OrfB_Zn_ribbon | 0.86 |
PF02943 | FeThRed_B | 0.86 |
PF03237 | Terminase_6N | 0.86 |
PF13412 | HTH_24 | 0.86 |
PF02195 | ParBc | 0.86 |
PF13148 | DUF3987 | 0.86 |
PF09853 | DUF2080 | 0.86 |
PF13579 | Glyco_trans_4_4 | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 2.59 |
COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 1.72 |
COG2411 | Predicted RNA-binding protein, contains PUA-like ASCH domain | General function prediction only [R] | 1.72 |
COG3097 | Uncharacterized conserved protein YqfB, UPF0267 family | Function unknown [S] | 1.72 |
COG4405 | Predicted RNA-binding protein YhfF, contains PUA-like ASCH domain | General function prediction only [R] | 1.72 |
COG4802 | Ferredoxin-thioredoxin reductase, catalytic subunit | Energy production and conversion [C] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.55 % |
Unclassified | root | N/A | 3.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003667|LSCM3L_1002224 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7398 | Open in IMG/M |
3300003667|LSCM3L_1038746 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 718 | Open in IMG/M |
3300005664|Ga0073685_1168970 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 551 | Open in IMG/M |
3300006601|Ga0079100_1469327 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
3300009648|Ga0116175_1184220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 699 | Open in IMG/M |
3300009655|Ga0116190_1002459 | All Organisms → cellular organisms → Bacteria | 14717 | Open in IMG/M |
3300009655|Ga0116190_1012759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4696 | Open in IMG/M |
3300009655|Ga0116190_1060372 | Not Available | 1570 | Open in IMG/M |
3300009655|Ga0116190_1115977 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 993 | Open in IMG/M |
3300009664|Ga0116146_1112221 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300009666|Ga0116182_1058373 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
3300009666|Ga0116182_1212150 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 851 | Open in IMG/M |
3300009666|Ga0116182_1286263 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 685 | Open in IMG/M |
3300009666|Ga0116182_1349921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 594 | Open in IMG/M |
3300009666|Ga0116182_1380253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 560 | Open in IMG/M |
3300009667|Ga0116147_1330045 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 571 | Open in IMG/M |
3300009669|Ga0116148_1080115 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 1665 | Open in IMG/M |
3300009669|Ga0116148_1225255 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 801 | Open in IMG/M |
3300009669|Ga0116148_1403326 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 540 | Open in IMG/M |
3300009670|Ga0116183_1069071 | All Organisms → Viruses → Predicted Viral | 2000 | Open in IMG/M |
3300009670|Ga0116183_1165667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1066 | Open in IMG/M |
3300009670|Ga0116183_1243845 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanospirillaceae → Methanospirillum → Methanospirillum stamsii | 809 | Open in IMG/M |
3300009673|Ga0116185_1129292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 1217 | Open in IMG/M |
3300009675|Ga0116149_1079489 | All Organisms → Viruses → Predicted Viral | 1779 | Open in IMG/M |
3300009675|Ga0116149_1237269 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 814 | Open in IMG/M |
3300009675|Ga0116149_1343220 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 633 | Open in IMG/M |
3300009676|Ga0116187_1176946 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1014 | Open in IMG/M |
3300009680|Ga0123335_1104262 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
3300009682|Ga0116172_10155633 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 1222 | Open in IMG/M |
3300009682|Ga0116172_10367637 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 684 | Open in IMG/M |
3300009685|Ga0116142_10015608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica | 5366 | Open in IMG/M |
3300009685|Ga0116142_10267188 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 853 | Open in IMG/M |
3300009685|Ga0116142_10523738 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 562 | Open in IMG/M |
3300009687|Ga0116144_10382290 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 707 | Open in IMG/M |
3300009689|Ga0116186_1338099 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 634 | Open in IMG/M |
3300009690|Ga0116143_10231021 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 980 | Open in IMG/M |
3300009690|Ga0116143_10620115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 530 | Open in IMG/M |
3300009690|Ga0116143_10630714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 524 | Open in IMG/M |
3300009693|Ga0116141_10185317 | All Organisms → Viruses → Predicted Viral | 1161 | Open in IMG/M |
3300009693|Ga0116141_10462549 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 644 | Open in IMG/M |
3300009710|Ga0116192_1102172 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 986 | Open in IMG/M |
3300009714|Ga0116189_1016498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin135 | 4240 | Open in IMG/M |
3300009715|Ga0116160_1178355 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 846 | Open in IMG/M |
3300009720|Ga0116159_1093905 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
3300009767|Ga0116161_1316567 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 624 | Open in IMG/M |
3300009767|Ga0116161_1329016 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 608 | Open in IMG/M |
3300009768|Ga0116193_1066474 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 1731 | Open in IMG/M |
3300009780|Ga0116156_10084775 | All Organisms → Viruses → Predicted Viral | 1889 | Open in IMG/M |
3300010311|Ga0116254_1074176 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 987 | Open in IMG/M |
3300010344|Ga0116243_10141508 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
3300010344|Ga0116243_10674406 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 613 | Open in IMG/M |
3300010346|Ga0116239_10278415 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
3300010346|Ga0116239_10281974 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 1176 | Open in IMG/M |
3300010346|Ga0116239_10463775 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 847 | Open in IMG/M |
3300010347|Ga0116238_10414179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 871 | Open in IMG/M |
3300010351|Ga0116248_10577071 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin145 | 813 | Open in IMG/M |
3300010353|Ga0116236_10669153 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 847 | Open in IMG/M |
3300010353|Ga0116236_11282448 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 561 | Open in IMG/M |
3300010356|Ga0116237_11177175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 638 | Open in IMG/M |
3300010365|Ga0116251_10020622 | Not Available | 6301 | Open in IMG/M |
3300010365|Ga0116251_10128344 | Not Available | 1638 | Open in IMG/M |
3300010365|Ga0116251_10213830 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 1149 | Open in IMG/M |
3300010365|Ga0116251_10362149 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 808 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10145329 | All Organisms → Viruses → Predicted Viral | 1552 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10379079 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 911 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10639775 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 670 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10786781 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 593 | Open in IMG/M |
3300014204|Ga0172381_10677293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 782 | Open in IMG/M |
3300014206|Ga0172377_10122763 | All Organisms → Viruses → Predicted Viral | 2343 | Open in IMG/M |
3300020814|Ga0214088_1638952 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 779 | Open in IMG/M |
3300025597|Ga0208825_1040479 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1366 | Open in IMG/M |
3300025613|Ga0208461_1096868 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 810 | Open in IMG/M |
3300025613|Ga0208461_1131018 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 637 | Open in IMG/M |
3300025629|Ga0208824_1070382 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 1162 | Open in IMG/M |
3300025638|Ga0208198_1132464 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 688 | Open in IMG/M |
3300025682|Ga0209718_1065093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 1313 | Open in IMG/M |
3300025682|Ga0209718_1079488 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 1121 | Open in IMG/M |
3300025686|Ga0209506_1122674 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 769 | Open in IMG/M |
3300025691|Ga0208826_1035673 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 1835 | Open in IMG/M |
3300025706|Ga0209507_1060690 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
3300025708|Ga0209201_1090242 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 1132 | Open in IMG/M |
3300025708|Ga0209201_1210973 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 588 | Open in IMG/M |
3300025713|Ga0208195_1041254 | All Organisms → Viruses → Predicted Viral | 2023 | Open in IMG/M |
3300025713|Ga0208195_1093749 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 1095 | Open in IMG/M |
3300025713|Ga0208195_1166136 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300025724|Ga0208196_1192834 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 641 | Open in IMG/M |
3300025730|Ga0209606_1012987 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 5412 | Open in IMG/M |
3300025730|Ga0209606_1135406 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 873 | Open in IMG/M |
3300025737|Ga0208694_1078083 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1336 | Open in IMG/M |
3300025737|Ga0208694_1215159 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 609 | Open in IMG/M |
3300025784|Ga0209200_1122370 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 960 | Open in IMG/M |
3300025784|Ga0209200_1169063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 775 | Open in IMG/M |
3300025896|Ga0208916_10133889 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 1060 | Open in IMG/M |
(restricted) 3300028561|Ga0255343_1019175 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 4391 | Open in IMG/M |
(restricted) 3300028561|Ga0255343_1037986 | All Organisms → Viruses → Predicted Viral | 2604 | Open in IMG/M |
(restricted) 3300028561|Ga0255343_1091135 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
(restricted) 3300028561|Ga0255343_1185007 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 819 | Open in IMG/M |
(restricted) 3300028561|Ga0255343_1241700 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 672 | Open in IMG/M |
(restricted) 3300028561|Ga0255343_1276890 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 607 | Open in IMG/M |
(restricted) 3300028564|Ga0255344_1070193 | All Organisms → Viruses → Predicted Viral | 1716 | Open in IMG/M |
(restricted) 3300028567|Ga0255342_1079293 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
(restricted) 3300028568|Ga0255345_1010458 | All Organisms → cellular organisms → Bacteria | 7789 | Open in IMG/M |
(restricted) 3300028570|Ga0255341_1013945 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5956 | Open in IMG/M |
(restricted) 3300028570|Ga0255341_1207564 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300028624|Ga0302246_1000621 | Not Available | 30097 | Open in IMG/M |
3300028624|Ga0302246_1005282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 6001 | Open in IMG/M |
3300028624|Ga0302246_1047023 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300028624|Ga0302246_1093601 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin294 | 628 | Open in IMG/M |
3300028628|Ga0302249_1020774 | All Organisms → Viruses → Predicted Viral | 1960 | Open in IMG/M |
3300028628|Ga0302249_1056649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin135 | 903 | Open in IMG/M |
3300028638|Ga0302240_1117244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin135 | 548 | Open in IMG/M |
3300028640|Ga0302237_1020119 | All Organisms → Viruses → Predicted Viral | 2272 | Open in IMG/M |
3300028641|Ga0302239_1026409 | All Organisms → Viruses → Predicted Viral | 1746 | Open in IMG/M |
3300028641|Ga0302239_1071286 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 778 | Open in IMG/M |
3300028644|Ga0302238_1099169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 719 | Open in IMG/M |
3300033757|Ga0373404_0208020 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA012 | 600 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 69.83% |
Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 9.48% |
Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 9.48% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.45% |
Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 1.72% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 1.72% |
Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.86% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.86% |
Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.86% |
Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 0.86% |
Anaerobic Digester Leachate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Leachate | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003667 | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) | Environmental | Open in IMG/M |
3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
3300006601 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_H2B_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300009648 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC125_MetaG | Engineered | Open in IMG/M |
3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
3300009710 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG | Engineered | Open in IMG/M |
3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
3300009768 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG | Engineered | Open in IMG/M |
3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
3300010311 | AD_JPTRca | Engineered | Open in IMG/M |
3300010344 | AD_JPASca | Engineered | Open in IMG/M |
3300010346 | AD_USMOca | Engineered | Open in IMG/M |
3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
3300010351 | AD_USPNca | Engineered | Open in IMG/M |
3300010353 | AD_USCAca | Engineered | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010365 | AD_USDIca | Engineered | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
3300025597 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025691 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025724 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
3300028567 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14 | Engineered | Open in IMG/M |
3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
3300028624 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp | Engineered | Open in IMG/M |
3300028628 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Val | Engineered | Open in IMG/M |
3300028638 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_His | Engineered | Open in IMG/M |
3300028640 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Ala | Engineered | Open in IMG/M |
3300028641 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Glu | Engineered | Open in IMG/M |
3300028644 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Asn | Engineered | Open in IMG/M |
3300033757 | Leachate microbial community from anaerobic digester in University of Toronto, Ontario, Canada - S62W2 SP | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LSCM3L_10022241 | 3300003667 | Coalbed Water | LEHDASGAMKIDVDTQCIITRENGAQLTINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK* |
LSCM3L_10387463 | 3300003667 | Coalbed Water | MKIDVDTQCIITRENGAQLAINDVSSIAIIIEFMGQKYNIFKTIDELILNGRWK* |
Ga0073685_11689701 | 3300005664 | Aquatic | MKIDVETQCIITRENGAQLAINDVSSIAIVIEFMGQKYNIFKTINELILNGRWK* |
Ga0079100_14693272 | 3300006601 | Anaerobic Digestor Sludge | MKIDVETQCIIARENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELILNGRWK* |
Ga0116175_11842204 | 3300009648 | Anaerobic Digestor Sludge | WDLQVDTMKIDVETQCIINRENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELILNGRWK* |
Ga0116190_100245923 | 3300009655 | Anaerobic Digestor Sludge | MKIDVETQCIITRETGEQIVVDDVSSIAVVIEVMGQKYNLFKTINELILNGRWK* |
Ga0116190_10127591 | 3300009655 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGAQLTINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK* |
Ga0116190_10603722 | 3300009655 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDGLILNGRWK* |
Ga0116190_11159772 | 3300009655 | Anaerobic Digestor Sludge | MKIDVETQCIITRETGEQIVVDKVSSIAVVIEFMGQKYNIFKTIEELIQNGSWR* |
Ga0116146_11122212 | 3300009664 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGEQVFVDDVSSIAIVIEFMGQKYNAFKTINELILNGRWK* |
Ga0116182_10583733 | 3300009666 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNAFKTIDELILNGRWK* |
Ga0116182_12121503 | 3300009666 | Anaerobic Digestor Sludge | DTMKIDVETQCIIARENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDELILNGRWK* |
Ga0116182_12862633 | 3300009666 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKFHIFKTMDGLVLNGGRK* |
Ga0116182_13499213 | 3300009666 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGAQLTINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWSW* |
Ga0116182_13802532 | 3300009666 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTINELILDGRWK* |
Ga0116147_13300452 | 3300009667 | Anaerobic Digestor Sludge | CIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDGLILNGRWK* |
Ga0116148_10801154 | 3300009669 | Anaerobic Digestor Sludge | MQVDIMKIDVENKCIVTRENGEQVVVDDVSSIAVVIEFMGQKYNIFKTINELIHS* |
Ga0116148_12252552 | 3300009669 | Anaerobic Digestor Sludge | MKIDVGIQCIITRENGEQIVVDDVSSIAVVIELMGQKYNIFKTIDELVLNGGWK* |
Ga0116148_14033261 | 3300009669 | Anaerobic Digestor Sludge | DTQCIITRENGAQLAINDVSSIAIVIECMGQKYNIFRTIDELILNGRWK* |
Ga0116183_10690715 | 3300009670 | Anaerobic Digestor Sludge | MKIDVETQCIIARENGEQVVVDDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK* |
Ga0116183_11656675 | 3300009670 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTINELIL |
Ga0116183_12438452 | 3300009670 | Anaerobic Digestor Sludge | MKIDVETQCIIARENGEQVVVDDVSSIAIIIEFMGQKYNIFRTIDELILNGRWK* |
Ga0116185_11292923 | 3300009673 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK* |
Ga0116149_10794891 | 3300009675 | Anaerobic Digestor Sludge | MFPKERESGDRMKIDVDTQCIITRENGEQVVVEDVSSIAVVIEFMGQEFSIFKTINELILNGRWK* |
Ga0116149_12372693 | 3300009675 | Anaerobic Digestor Sludge | MKIDVETQCIINRENGEQVVVDDVSSIAIVIECMGQKYNYFRTIDELILNGRWK* |
Ga0116149_13432202 | 3300009675 | Anaerobic Digestor Sludge | MKIDVDTQCIIARENGEQVVVDDVSSIAIIIEFMGQKYNIFRTIDELILNGRWK* |
Ga0116187_11769463 | 3300009676 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGAQLAINDVSSIAVVIEFMGQKYNIFKTIDELILNGRWK* |
Ga0123335_11042621 | 3300009680 | Anaerobic Biogas Reactor | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFRTLDELILNGRWK* |
Ga0116172_101556334 | 3300009682 | Anaerobic Digestor Sludge | ITRENGAQLAINDVSSIVIIIEFMGQKYNIFKTIDELILNGRWK* |
Ga0116172_103676371 | 3300009682 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGAQLAINDVSSIAIIIEVMGQKYNIFKTIDELILNGRWK* |
Ga0116142_1001560810 | 3300009685 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGEQVFVDDISSIAIVIEFMGQKYNIFKTINELILNGRWK* |
Ga0116142_102671882 | 3300009685 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGEQVFVDDVSSIAIVIEFMGQKYNIFKTINELILNGRCK* |
Ga0116142_105237382 | 3300009685 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGAQLAINDVSSIAIVIEFMGQKYNIFKTINELILDGRWK* |
Ga0116144_103822902 | 3300009687 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGAQLAINDVSSIAIVIEFMGQKYNIFKTINELILDGRWK* |
Ga0116186_13380993 | 3300009689 | Anaerobic Digestor Sludge | MKIDVETQCIITRETVEQIVVDKVSSIAVVIEFMGQKYNIFKTIEELIQNGSWR* |
Ga0116143_102310214 | 3300009690 | Anaerobic Digestor Sludge | LEHDASDTMKIDVETQCIITRENGAQLAINDVSSIAIVIEFMGQKYNIFKTINELILDGRWK* |
Ga0116143_106201152 | 3300009690 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGEQVFVDDISSIAIVIEFMGQKYNIFKTINELVLNGGWK* |
Ga0116143_106307143 | 3300009690 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIIIEVMGQKYNIFKTINELILNGRLK* |
Ga0116141_101853171 | 3300009693 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGERIVVDDVSSIAVVIEFMGQKYNIFKTIDELVLTGRWK* |
Ga0116141_104625491 | 3300009693 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGEQVFVDDVSSIAIVIEFMGQKYNIFKTINELILNGRWK* |
Ga0116192_11021722 | 3300009710 | Anaerobic Digestor Sludge | MKIDVETQCIVTRATGEQIVVDDVSSIAVVIEFMGQKYNVFKTINELILNGRWK* |
Ga0116189_10164986 | 3300009714 | Anaerobic Digestor Sludge | MQVDTMKIDVETQCIITRETGEQIVVDDVSSIAVVIEVMGQKYNLFKTINELILNGRWKW |
Ga0116160_11783552 | 3300009715 | Anaerobic Digestor Sludge | MKIDVETQCIINRENGEQVVVDDVSSIAIVIEVMGQKYNIFRTIDELILNGRWK* |
Ga0116159_10939055 | 3300009720 | Anaerobic Digestor Sludge | DTMKIDVETQCIITRENGEQVVVDDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK* |
Ga0116161_13165672 | 3300009767 | Anaerobic Digestor Sludge | EHDASGAMKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDGLILNGRWK* |
Ga0116161_13290162 | 3300009767 | Anaerobic Digestor Sludge | MKIDVETQIIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTINELILDGRWK* |
Ga0116193_10664746 | 3300009768 | Anaerobic Digestor Sludge | MKIDVETHCRITRENGEQVVVDDVSSIAIVIEFMGQKYNIFKTINELILNGRWE* |
Ga0116156_100847751 | 3300009780 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGAQLAINDVSSIAIIIECMGQKYNIFKTIDELILNGRWK* |
Ga0116254_10741761 | 3300010311 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTIEELIQNGSWR* |
Ga0116243_101415085 | 3300010344 | Anaerobic Digestor Sludge | MKIDVETQIIITRDNGAQLTINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK* |
Ga0116243_106744061 | 3300010344 | Anaerobic Digestor Sludge | ASGAMKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDGLILNGRWK* |
Ga0116239_102784155 | 3300010346 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGEQVVVDDVSSIAIVIECMGQKYNIFRTIDELILNGR |
Ga0116239_102819743 | 3300010346 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQIVVDDVSSIAVVIELMGQKFHIFKTMDGLALNGRWK* |
Ga0116239_104637753 | 3300010346 | Anaerobic Digestor Sludge | MKIDVETHCRITRENGEQVVVDDVSSIAIVIEFMGQKYNIFKTINELILNGRWK* |
Ga0116238_104141791 | 3300010347 | Anaerobic Digestor Sludge | MKIDVETQCIITRETGEQIVVDDVSSIAVVIEVMGQRYNLFKTINELILNGRWK* |
Ga0116248_105770711 | 3300010351 | Anaerobic Digestor Sludge | IDVDTQCIITRENGAQLAINDVSSIVIIIEFMGQKYNIFKTIDELILNGRWK* |
Ga0116236_106691531 | 3300010353 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGEQVVVDDVSSIAVVIEFMGQKFNIFKTINELILNGRWK* |
Ga0116236_112824481 | 3300010353 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGERIVVDDVSSIAVVIEFMGQKYNLFKTINELVLNGCWK* |
Ga0116237_111771753 | 3300010356 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGEQIVVDDVSSIAVVIEFMGQKYNIFKTINELILNGRWK* |
Ga0116251_100206221 | 3300010365 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIEVMGQKYNIFKTIDELILNGRWSW* |
Ga0116251_101283446 | 3300010365 | Anaerobic Digestor Sludge | MKIDVETQCIIARENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDELILNGRWK* |
Ga0116251_102138301 | 3300010365 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQIVVDDVSSIAVVIELMGQKFHIFKTMDGLVLNGR* |
Ga0116251_103621491 | 3300010365 | Anaerobic Digestor Sludge | VETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNVFKTIDELILNGRWK* |
(restricted) Ga0172366_101453296 | 3300013128 | Sediment | MKIDVDSRCIITRENGEQIVVDDVSSIAVIIGFMGQQYNHFATISELILNGNGGWK* |
(restricted) Ga0172364_103790793 | 3300013129 | Sediment | MKIDVDSRCIITRENGEQIVVDDVSSIAVIIGFMGQQYNSFKTISELILNGNGGWK* |
(restricted) Ga0172363_106397751 | 3300013130 | Sediment | MKIDVDSRCIITRENGEQIVVDDVCSIAVIIGFMGQQYNSFKTISELILNGDGCWK* |
(restricted) Ga0172363_107867811 | 3300013130 | Sediment | DDGDTMKIDVDSRCIITRENGEQIVVDDVSSIAVIIGFMGQQYNRFETVNELILNGNGGWK* |
Ga0172381_106772933 | 3300014204 | Landfill Leachate | MKIDVETQCIITRENGEQVVVENITSIAVVIEFMDQKYNIFKTINELILNGRWK* |
Ga0172377_101227634 | 3300014206 | Landfill Leachate | MLEYQTCKVDTMKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFRTIDELILNGRWK* |
Ga0214088_16389522 | 3300020814 | Granular Sludge | MKIDVGIQCIITRENGEQVVVDDVSSIAIVIEFMGQKYNIFKTINELILNGGWK |
Ga0208825_10404792 | 3300025597 | Anaerobic Digestor Sludge | MKIDVETQCIVTRATGEQIVVDDVSSIAVVIEFMGQKYNVFKTINELILNGRWK |
Ga0208461_10968681 | 3300025613 | Anaerobic Digestor Sludge | ETGVPAMKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDGLILNGRWK |
Ga0208461_11310182 | 3300025613 | Anaerobic Digestor Sludge | MKIDVETQCIITRETGEQIVVDKVSSIAVVIEFMGQKYNIFKTIEELIQNGSWR |
Ga0208824_10703824 | 3300025629 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTMDGLILNGRWK |
Ga0208198_11324641 | 3300025638 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTIEELIQNGSWR |
Ga0209718_10650935 | 3300025682 | Anaerobic Digestor Sludge | MKIDVETQCIINRENGEQVVVDDVSSIAIVIEVMGQKYNIFRTIDELILNGRWK |
Ga0209718_10794881 | 3300025682 | Anaerobic Digestor Sludge | IIITRDNGAQLTINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK |
Ga0209506_11226743 | 3300025686 | Anaerobic Digestor Sludge | ITRETGEQIVVDKVSSIAVVIEFMGQKYNIFKTMDGLILNGRWK |
Ga0208826_10356734 | 3300025691 | Anaerobic Digestor Sludge | MKIDVETHCRITRENGEQVVVDDVSSIAIVIEFMGQKYNIFKTINELILNGRWE |
Ga0209507_10606903 | 3300025706 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGAQLAINDVSSIAIVIEFMGQKYNIFKTINELILDGRWK |
Ga0209201_10902422 | 3300025708 | Anaerobic Digestor Sludge | MQVDIMKIDVENKCIVTRENGEQVVVDDVSSIAVVIEFMGQKYNIFKTINELIHS |
Ga0209201_12109733 | 3300025708 | Anaerobic Digestor Sludge | GGKGMKIDVETHCIITRENGEQVFVDDVSSIAIVIEFMGQKYNAFKTINELILNGRWK |
Ga0208195_10412542 | 3300025713 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNAFKTIDELILNGRWK |
Ga0208195_10937491 | 3300025713 | Anaerobic Digestor Sludge | MKIDVDTQCIIARENGEQVVVDDVSSIAIIIECMGQKYNIFKTIDELILNGRWK |
Ga0208195_11661361 | 3300025713 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTINELILDGRWK |
Ga0208196_11928342 | 3300025724 | Anaerobic Digestor Sludge | MKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTIDELILNGRWK |
Ga0209606_10129872 | 3300025730 | Anaerobic Digestor Sludge | MFPKERESGDRMKIDVDTQCIITRENGEQVVVEDVSSIAVVIEFMGQEFSIFKTINELILNGRWK |
Ga0209606_11354063 | 3300025730 | Anaerobic Digestor Sludge | MKIDVETQCIINRENGEQVVVDDVSSIAIVIECMGQKYNYFRTIDELILNGRWK |
Ga0208694_10780834 | 3300025737 | Anaerobic Digestor Sludge | MKIDVDTQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTINELILDGRWK |
Ga0208694_12151592 | 3300025737 | Anaerobic Digestor Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKFHIFKTMDGLVLNGGRK |
Ga0209200_11223703 | 3300025784 | Anaerobic Digestor Sludge | MKIDVDTQCIITRENGEQVFVDDISSIAIVIEFMGQKYNIFKTINELILNGRWK |
Ga0209200_11690631 | 3300025784 | Anaerobic Digestor Sludge | MKIDVETHCIITRENGAQLAINDVSSIAIVIEFMGQKYNIFKTINELILDGRWK |
Ga0208916_101338895 | 3300025896 | Aqueous | CIITRENGEQVVVDDVSSIAIVIEVMGQKYNIFRTIDELILNGRWK |
(restricted) Ga0255343_10191758 | 3300028561 | Wastewater | MKIDVDTQCIITRDNGEQVVVDDVSSIAIVIEVMGQKYNIFKTINELILDGRWK |
(restricted) Ga0255343_10379868 | 3300028561 | Wastewater | MKIDVDTQCIITRENGEQVVVDDVSSIAIIIEVMGQKYNIFRTIDELILNGRWK |
(restricted) Ga0255343_10911352 | 3300028561 | Wastewater | MKIDVDTQCIITRENGEQVVVDDVSSIAIVIEVMGQKYNIFRTIDELIQNGRWK |
(restricted) Ga0255343_11850072 | 3300028561 | Wastewater | MKIDVETQCIITRENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELILNGRWK |
(restricted) Ga0255343_12417001 | 3300028561 | Wastewater | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFRTIDELILNGRWK |
(restricted) Ga0255343_12768901 | 3300028561 | Wastewater | MKIDVDTQCIITRENGAQLAINDVSSIAIVIECMGQKYNFFKTIDELIQNGRWK |
(restricted) Ga0255344_10701936 | 3300028564 | Wastewater | MKIDVDTQCIITRDNGEQVVVDDVSSIAIVIEVMGQKYNIFRTINELILDGRWK |
(restricted) Ga0255342_10792933 | 3300028567 | Wastewater | MQVDIMKIDVETQCIITRDNGEQVVVDDVSSIAIVIEVMGQKYNIFKTVDELILNGRWK |
(restricted) Ga0255345_10104586 | 3300028568 | Wastewater | MQVDIMKIDVENKCIVTRENGEQVVVDDVSSIAIVIEVMGQKYNIFRTIDELILNGRWK |
(restricted) Ga0255341_101394514 | 3300028570 | Wastewater | MKIDVDTQCIITRENGEQVVVDDVSSIAIVIEVMGQKYNIFRTIDELILNGRWK |
(restricted) Ga0255341_12075642 | 3300028570 | Wastewater | MKIDVETQCIITRENGEQVVVDDVSSIAIVIELMGQKYNIFKTIDELILNGRWK |
Ga0302246_100062148 | 3300028624 | Activated Sludge | MKIDVDTQCIIARENGEQVVVDDVSSIAIIIEFMGQKYNIFRTIDELILNGRWK |
Ga0302246_10052824 | 3300028624 | Activated Sludge | MKIDVETQCIINRENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELILNGRWK |
Ga0302246_10470232 | 3300028624 | Activated Sludge | MKIDVDTQCIITRENGAQLAINDVSSIAIVIECMGQKYNYFRTIDELIQNGRWK |
Ga0302246_10936012 | 3300028624 | Activated Sludge | LEHDASDTMKIDVETQCIITRDNGAQLAINDVSSIAIVIEVMGQKYNIFKTINELILDGRWK |
Ga0302249_10207748 | 3300028628 | Activated Sludge | VDTMKIDVETQCIINRENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELILNGRWK |
Ga0302249_10566491 | 3300028628 | Activated Sludge | MKIDVDTQCIITRENGAQLAINDVSSIAIIIEFMGQKYNIFRTIDELILNGRWK |
Ga0302240_11172441 | 3300028638 | Activated Sludge | MKIDVDTQCIITRENGAQLAINDVSSIAIIIEFMGQKYNIFRTIDELILNGR |
Ga0302237_10201197 | 3300028640 | Activated Sludge | LEHDASGAMKIDVDTQCIITRENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELIQNGRWK |
Ga0302239_10264091 | 3300028641 | Activated Sludge | QCIIARENGEQVVVDDVSSIAIIIECMGQKYNIFRTIDELIQNGRWK |
Ga0302239_10712863 | 3300028641 | Activated Sludge | MKIDVETQCIITRENGEQVVVDDVSSIAIVIECMGQKYNYFRTIDELILNGRWK |
Ga0302238_10991694 | 3300028644 | Activated Sludge | MKIDVDTQCIITRENGAQLAINDVSSIAIIIEFMGQKYNIFRTIDELILNG |
Ga0373404_0208020_43_207 | 3300033757 | Anaerobic Digester Leachate | MKIDVGIQCIITRENGEQIVVDEVSSIAVVIEFMGQKFHIFKTMDGLVLNGGWK |
⦗Top⦘ |