NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078662

Metagenome / Metatranscriptome Family F078662

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078662
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 80 residues
Representative Sequence MASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPARMTFARFSR
Number of Associated Samples 72
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.35 %
% of genes near scaffold ends (potentially truncated) 44.83 %
% of genes from short scaffolds (< 2000 bps) 74.14 %
Associated GOLD sequencing projects 57
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.793 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(44.828 % of family members)
Environment Ontology (ENVO) Unclassified
(60.345 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(89.655 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.71%    β-sheet: 16.67%    Coil/Unstructured: 47.62%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF05136Phage_portal_2 36.21
PF05876GpA_ATPase 31.03
PF01343Peptidase_S49 6.03
PF11651P22_CoatProtein 4.31

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG5511Phage capsid proteinMobilome: prophages, transposons [X] 36.21
COG5525Phage terminase, large subunit GpAMobilome: prophages, transposons [X] 31.03
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 12.07


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.83 %
UnclassifiedrootN/A5.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10001102All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED16716661Open in IMG/M
3300000116|DelMOSpr2010_c10051497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671800Open in IMG/M
3300000117|DelMOWin2010_c10008232All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia6091Open in IMG/M
3300000117|DelMOWin2010_c10030685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672625Open in IMG/M
3300000117|DelMOWin2010_c10073935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671360Open in IMG/M
3300001934|GOS2267_103132All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671845Open in IMG/M
3300003476|NAP2_1022862All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1221Open in IMG/M
3300003477|nap3_10084916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167741Open in IMG/M
3300003498|JGI26239J51126_1096853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167510Open in IMG/M
3300004097|Ga0055584_102213769All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167560Open in IMG/M
3300005512|Ga0074648_1001168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED16728976Open in IMG/M
3300005838|Ga0008649_10257830All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167662Open in IMG/M
3300005946|Ga0066378_10005048All Organisms → cellular organisms → Bacteria4416Open in IMG/M
3300006026|Ga0075478_10003503All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5629Open in IMG/M
3300006637|Ga0075461_10004835All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4451Open in IMG/M
3300006637|Ga0075461_10028427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671842Open in IMG/M
3300006637|Ga0075461_10088205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167981Open in IMG/M
3300006637|Ga0075461_10133007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167768Open in IMG/M
3300006637|Ga0075461_10195722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167607Open in IMG/M
3300006793|Ga0098055_1157660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167872Open in IMG/M
3300006802|Ga0070749_10092705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671793Open in IMG/M
3300006802|Ga0070749_10112744All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671601Open in IMG/M
3300006802|Ga0070749_10215295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671096Open in IMG/M
3300006802|Ga0070749_10334125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167844Open in IMG/M
3300006802|Ga0070749_10529075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167640Open in IMG/M
3300006802|Ga0070749_10637066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167573Open in IMG/M
3300006810|Ga0070754_10076282All Organisms → Viruses → Predicted Viral1701Open in IMG/M
3300006810|Ga0070754_10139031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671170Open in IMG/M
3300006810|Ga0070754_10239909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167831Open in IMG/M
3300006867|Ga0075476_10086694All Organisms → Viruses → Predicted Viral1216Open in IMG/M
3300006867|Ga0075476_10165176All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167820Open in IMG/M
3300006869|Ga0075477_10233689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167744Open in IMG/M
3300006870|Ga0075479_10253249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167697Open in IMG/M
3300006919|Ga0070746_10247968All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167832Open in IMG/M
3300007234|Ga0075460_10021089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672554Open in IMG/M
3300007234|Ga0075460_10310802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167516Open in IMG/M
3300007538|Ga0099851_1002983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1677152Open in IMG/M
3300007540|Ga0099847_1210813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167565Open in IMG/M
3300008012|Ga0075480_10167905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671180Open in IMG/M
3300009124|Ga0118687_10003186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1675785Open in IMG/M
3300009124|Ga0118687_10023783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672007Open in IMG/M
3300009124|Ga0118687_10042100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671516Open in IMG/M
3300009124|Ga0118687_10170089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167785Open in IMG/M
3300009124|Ga0118687_10303907Not Available601Open in IMG/M
3300009435|Ga0115546_1321607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167527Open in IMG/M
3300011306|Ga0138371_1053363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671333Open in IMG/M
3300011311|Ga0138370_1095052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671310Open in IMG/M
3300012528|Ga0129352_10655395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167532Open in IMG/M
3300017818|Ga0181565_10059683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672742Open in IMG/M
3300017818|Ga0181565_10308268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671061Open in IMG/M
3300017818|Ga0181565_10519086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167772Open in IMG/M
3300017949|Ga0181584_10029654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673948Open in IMG/M
3300017951|Ga0181577_10089048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672146Open in IMG/M
3300017951|Ga0181577_10149139All Organisms → Viruses → Predicted Viral1592Open in IMG/M
3300017951|Ga0181577_10705319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167614Open in IMG/M
3300017958|Ga0181582_10335834All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167980Open in IMG/M
3300018039|Ga0181579_10446724All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167690Open in IMG/M
3300018049|Ga0181572_10785091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167568Open in IMG/M
3300018416|Ga0181553_10281066All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167932Open in IMG/M
3300018421|Ga0181592_10018700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5640Open in IMG/M
3300018421|Ga0181592_10953661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167555Open in IMG/M
3300018424|Ga0181591_10058820All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673211Open in IMG/M
3300018424|Ga0181591_10215942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671501Open in IMG/M
3300018424|Ga0181591_10468760All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167924Open in IMG/M
3300019271|Ga0182065_1209228All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167577Open in IMG/M
3300019272|Ga0182059_1240539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167558Open in IMG/M
3300019281|Ga0182077_1005113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167580Open in IMG/M
3300019756|Ga0194023_1068248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167714Open in IMG/M
3300020055|Ga0181575_10466952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167683Open in IMG/M
3300020428|Ga0211521_10021992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673641Open in IMG/M
3300021957|Ga0222717_10237939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671063Open in IMG/M
3300021957|Ga0222717_10498823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167656Open in IMG/M
3300021958|Ga0222718_10023934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1674184Open in IMG/M
3300021958|Ga0222718_10060540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672358Open in IMG/M
3300021958|Ga0222718_10479751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167605Open in IMG/M
3300021961|Ga0222714_10036160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1673596Open in IMG/M
3300021961|Ga0222714_10292437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167896Open in IMG/M
3300022071|Ga0212028_1048466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167792Open in IMG/M
3300022159|Ga0196893_1028213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167526Open in IMG/M
3300022187|Ga0196899_1000966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED16714540Open in IMG/M
3300022925|Ga0255773_10203220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167893Open in IMG/M
3300022934|Ga0255781_10063526All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Geminisphaera2132Open in IMG/M
3300023110|Ga0255743_10157472All Organisms → Viruses → Predicted Viral1287Open in IMG/M
3300023119|Ga0255762_10359931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167732Open in IMG/M
3300025108|Ga0208793_1084513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167910Open in IMG/M
3300025610|Ga0208149_1061788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167948Open in IMG/M
3300025630|Ga0208004_1023875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671865Open in IMG/M
3300025630|Ga0208004_1053291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671081Open in IMG/M
3300025630|Ga0208004_1075778Not Available843Open in IMG/M
3300025646|Ga0208161_1000562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED16720910Open in IMG/M
3300025665|Ga0209360_1007005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1675259Open in IMG/M
3300025671|Ga0208898_1027582All Organisms → Viruses → Predicted Viral2372Open in IMG/M
3300025759|Ga0208899_1038447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1672162Open in IMG/M
3300025759|Ga0208899_1181844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167686Open in IMG/M
3300025769|Ga0208767_1116347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671035Open in IMG/M
3300025769|Ga0208767_1134571All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167926Open in IMG/M
3300025818|Ga0208542_1167808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167586Open in IMG/M
3300025818|Ga0208542_1200751All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167515Open in IMG/M
3300025828|Ga0208547_1061024All Organisms → Viruses → Predicted Viral1265Open in IMG/M
3300025828|Ga0208547_1184588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167572Open in IMG/M
3300025840|Ga0208917_1019908All Organisms → Viruses → Predicted Viral2872Open in IMG/M
3300025853|Ga0208645_1091995All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671281Open in IMG/M
3300025889|Ga0208644_1016961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1674715Open in IMG/M
3300025889|Ga0208644_1080301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671672Open in IMG/M
3300025889|Ga0208644_1165187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167999Open in IMG/M
3300025889|Ga0208644_1367770All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167541Open in IMG/M
3300026093|Ga0208624_1020607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671973Open in IMG/M
3300026093|Ga0208624_1027707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671583Open in IMG/M
3300026187|Ga0209929_1074170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167920Open in IMG/M
3300028106|Ga0247596_1158980Not Available516Open in IMG/M
3300028282|Ga0256413_1361779Not Available507Open in IMG/M
3300031851|Ga0315320_10016826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia5846Open in IMG/M
3300031851|Ga0315320_10253852All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED1671272Open in IMG/M
3300034374|Ga0348335_154334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED167623Open in IMG/M
3300034374|Ga0348335_191929Not Available506Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous44.83%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh20.69%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.03%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water6.03%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.31%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment4.31%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.45%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.72%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.72%
EstuarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine1.72%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.86%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.86%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.86%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.86%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001934Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858EnvironmentalOpen in IMG/M
3300003476Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 2EnvironmentalOpen in IMG/M
3300003477Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3EnvironmentalOpen in IMG/M
3300003498Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005946Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_AEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006869Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006870Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009124Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsfEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300011306Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_B metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011311Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 DCM_A metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018039Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019271Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101411XT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019756Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023110Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaGEnvironmentalOpen in IMG/M
3300023119Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaGEnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025610Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025665Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026093Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026187Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_10001102213300000116MarineMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR*
DelMOSpr2010_1005149723300000116MarineMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR*
DelMOWin2010_1000823263300000117MarineMASDITAFLKLQSDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR*
DelMOWin2010_1003068533300000117MarineMADLRPFLRLQTDAYLNTLKARVGDSVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPTRMTFARFAR*
DelMOWin2010_1007393513300000117MarineKLQSDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR*
GOS2267_10313243300001934MarineMASDITAFLNLQSDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPT
NAP2_102286223300003476EstuarineMGDLRSFLRLQSNSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR*
nap3_1008491623300003477EstuarineMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGNKPSRMTFARFTR*
JGI26239J51126_109685323300003498MarineYMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGIVTGTKPSRMTFARFTR*
Ga0055584_10221376923300004097Pelagic MarineMADLRPFLRLQTDAYLNTLKARVGESVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPNRMTFARFA
Ga0074648_1001168413300005512Saline Water And SedimentMASDITAFLNLQSDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR*
Ga0008649_1025783013300005838MarineVKHFAEPYYMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGIVTGTKPSRMTFARFTR*
Ga0066378_1000504823300005946MarineMASDISGFLRLQSNSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR*
Ga0075478_1000350323300006026AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGSKPARMTFARFSR*
Ga0075461_1000483563300006637AqueousMASDITAFLKLQNDAYLLTLKGRVADAILAGSVTTSFSNASQSGSQELVMPTDELAAQLTAVLIEKGLANGATKPTRMTFARFAR*
Ga0075461_1002842723300006637AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR*
Ga0075461_1008820523300006637AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPARMTFARFSR*
Ga0075461_1013300723300006637AqueousMGDLRSFLRLQTNAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR*
Ga0075461_1019572223300006637AqueousMASDITAFLNLQTDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR*
Ga0098055_115766023300006793MarineMADLRPFLRLQTDAYLNTLKSRVGDSVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPNRMTFARFAR*
Ga0070749_1009270513300006802AqueousRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR*
Ga0070749_1011274423300006802AqueousSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR*
Ga0070749_1021529523300006802AqueousDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR*
Ga0070749_1033412523300006802AqueousMASDITAFLNLQTDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGA
Ga0070749_1052907523300006802AqueousASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR*
Ga0070749_1063706623300006802AqueousMASDITAFLNLQDDGYLLTLKARVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR*
Ga0070754_1007628213300006810AqueousGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR*
Ga0070754_1013903123300006810AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR*
Ga0070754_1023990923300006810AqueousMASDIIGFLRLQSDSWLTTLQQRVADAILSGYVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR*
Ga0075476_1008669423300006867AqueousYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR*
Ga0075476_1016517613300006867AqueousMASDITAFLNLQTDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLVNGATKPTRMTFARFAR*
Ga0075477_1023368913300006869AqueousMASDITAFLNLQSDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLA
Ga0075479_1025324913300006870AqueousLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR*
Ga0070746_1024796823300006919AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPARMTFARFSR*
Ga0075460_1002108923300007234AqueousLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR*
Ga0075460_1031080223300007234AqueousMASDITAFLNLQTDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATK
Ga0099851_100298333300007538AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFTR*
Ga0099847_121081323300007540AqueousMASDITAFLKLQSDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLINKSLVTGTKPARMTFARFAR*
Ga0075480_1016790523300008012AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRALVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR*
Ga0118687_1000318633300009124SedimentMAILMMADIRPFLRLQTDAWLQTLQARVSDAVLQGAVTTSFSNSGQSGSKELVLPTAELASQLTDVLIEKELVTGTASARMTFARFAR*
Ga0118687_1002378323300009124SedimentLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR*
Ga0118687_1004210023300009124SedimentMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPVRMTFARFSR*
Ga0118687_1017008923300009124SedimentQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGTKPSRMTFARFTR*
Ga0118687_1030390713300009124SedimentLRPFLRLQTDAYLNTLKARVGDSVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPNRMTFARFAR*
Ga0115546_132160723300009435Pelagic MarineMGDLRPFLRLQRDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGTKPSRMTFARFTR*
Ga0138371_105336313300011306MarineSKMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVTGTKPVRMTFARFSR*
Ga0138370_109505213300011311MarineSGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVTGTKPVRMTFARFSR*
Ga0129352_1065539513300012528AqueousGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR*
Ga0181565_1005968333300017818Salt MarshMGDLRSFLRLQSNSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0181565_1030826823300017818Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR
Ga0181565_1051908623300017818Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR
Ga0181584_1002965423300017949Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR
Ga0181577_1008904823300017951Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVTGTKPARMTFARFSR
Ga0181577_1014913923300017951Salt MarshMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTYARFSR
Ga0181577_1070531913300017951Salt MarshMGDLRSFLRLQSNSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFAR
Ga0181582_1033583413300017958Salt MarshSGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR
Ga0181579_1044672423300018039Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPARMTFARFSR
Ga0181572_1078509123300018049Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARM
Ga0181553_1028106623300018416Salt MarshMASDITAFLKLQSDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARF
Ga0181592_1001870083300018421Salt MarshKLQEDAYLLTLKERVADAILAGSVTTSFSNASQSGSQELVMPTDELAAQLTAVLIEKGLANGATKPTRMTFARFAR
Ga0181592_1095366123300018421Salt MarshMGDLRSFLRLQSDSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0181591_1005882023300018424Salt MarshMASDITAFLKLQEDAYLLTLKERVADAILAGSVTTSFSNASQSGSQELVMPTDELAAQLTAVLIEKGLANGATKPTRMTFARFAR
Ga0181591_1021594223300018424Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR
Ga0181591_1046876013300018424Salt MarshSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR
Ga0182065_120922833300019271Salt MarshLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR
Ga0182059_124053913300019272Salt MarshSGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPTRMTFARFSR
Ga0182077_100511323300019281Salt MarshFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR
Ga0194023_106824813300019756FreshwaterSGFLRLQSDSWLTTLQQRVADSILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPARMTFARFSR
Ga0181575_1046695213300020055Salt MarshMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTK
Ga0211521_1002199233300020428MarineMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGSKPSRMTFVRFTR
Ga0222717_1023793923300021957Estuarine WaterMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVTGTKPSRMTFARFTR
Ga0222717_1049882323300021957Estuarine WaterMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPTRMTFARFSR
Ga0222718_1002393423300021958Estuarine WaterMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGLVSGTKPSRMTFARFTR
Ga0222718_1006054023300021958Estuarine WaterMADLRPFLRLQTDAYLNTLKARVGDSVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPNRMTFARFAR
Ga0222718_1047975123300021958Estuarine WaterMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPTRMTFAR
Ga0222714_1003616033300021961Estuarine WaterMGDLRSFLRLQTNAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0222714_1029243723300021961Estuarine WaterMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPVRMTFARFSR
Ga0212028_104846623300022071AqueousMASDITAFLNLQSDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR
Ga0196893_102821313300022159AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRP
Ga0196899_1000966193300022187AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGSKPARMTFARFSR
Ga0255773_1020322023300022925Salt MarshMASDITAFLKLQSDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR
Ga0255781_1006352613300022934Salt MarshQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVTGTKPARMTFARFSR
Ga0255743_1015747223300023110Salt MarshSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0255762_1035993113300023119Salt MarshLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR
Ga0208793_108451323300025108MarineMADLRPFLRLQTDAYLNTLKSRVGDSVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPNRMTFARFAR
Ga0208149_106178813300025610AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGSKPARMTFAR
Ga0208004_102387523300025630AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR
Ga0208004_105329123300025630AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0208004_107577813300025630AqueousMASDITAFLKLQNDAYLLTLKGRVADAILAGSVTTSFSNASQSGSQELVMPTDELAAQLTAVLIEKGLANGATKPTRMTFARFAR
Ga0208161_100056273300025646AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFTR
Ga0209360_100700523300025665MarineMGDLRPFLRLQSDTWLNTLKQRVADAVLSGAVTTSFTNASQSGSREQVLPTAELSAQLTDVLFEKGIVTGTKPSRMTFARFTR
Ga0208898_102758233300025671AqueousDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR
Ga0208899_103844723300025759AqueousMADLRPFLRLQTDAYLNTLKARVGDSVLQGAVTTSFSNSGQSGTKELVLPTAELSAQLTDVLHEKGLVTGTKPTRMTFARFAR
Ga0208899_118184423300025759AqueousMASDITAFLNLQDDGYLLTLKARVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR
Ga0208767_111634723300025769AqueousMGDLRSFLRLQSNSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPVRMTFARFSR
Ga0208767_113457123300025769AqueousQSNSWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0208542_116780813300025818AqueousMASDITAFLNLQSDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATK
Ga0208542_120075123300025818AqueousMASDITAFLNLQTDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLVNGATK
Ga0208547_106102413300025828AqueousYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR
Ga0208547_118458823300025828AqueousMGDLRSFLRLQTDAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGSKPA
Ga0208917_101990843300025840AqueousLRSFLRLQTNAWLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0208645_109199513300025853AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFS
Ga0208644_101696133300025889AqueousMASDISGFLRLQSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPARMTFARFSR
Ga0208644_108030123300025889AqueousSDSWLTTLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPVRMTFARFSR
Ga0208644_116518713300025889AqueousDSWLTPLQQRVADAILSGSVTVSFSNASQSGTRELVMPTDELAAQLTPILIEKGLVTGTKPTRMTFARFSR
Ga0208644_136282423300025889AqueousLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0208644_136777013300025889AqueousMASDITAFLNLQSDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFAR
Ga0208624_102060723300026093MarineMASDISGFLRLQSNSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVSGTKPARMTFARFSR
Ga0208624_102770723300026093MarineMASDISGFLRLQSDSWLTTLQQRVADAILSGSVSVSFSNASQSGTRELVMPTDELAAQLTPILIEKGIVTGTKPVRMTFARFSR
Ga0209929_107417023300026187Pond WaterMASDITAFLNLQTDGYLLTLKERVADAILAGSVTVSFSNASQSGSMQLVMPTDELAAQLTTVLIAKGLANGATKPTRMTFARFAR
Ga0247596_115898013300028106SeawaterKLQSDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR
Ga0256413_136177913300028282SeawaterDAWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR
Ga0315320_1001682693300031851SeawaterWLLTLKDRVADAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR
Ga0315320_1025385223300031851SeawaterMASDITAFLKLQSDAWLLTLKDRVSDAILAGSVTVSFSNASQSGSQELVLPTDELASQLTTVLIDKSLVTGTKPARMTFARFAR
Ga0348335_154334_3_2093300034374AqueousLLTLKERVADAVLSGAVTTSFSNASQSGTRELVLPTEELASQLTDVLHEKGLATGTKPARMTFARFSR
Ga0348335_191929_278_5053300034374AqueousLQNDAYLLTLKGRVADAILAGSVTTSFSNASQSGSQELVMPTDELAAQLTAVLIEKGLANGATKPTRMTFARFAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.