NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078556

Metagenome / Metatranscriptome Family F078556

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078556
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 42 residues
Representative Sequence WTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA
Number of Associated Samples 100
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.14 %
% of genes from short scaffolds (< 2000 bps) 81.90 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.897 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(48.276 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.621 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.33%    β-sheet: 0.00%    Coil/Unstructured: 65.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF01544CorA 49.14
PF13378MR_MLE_C 27.59
PF02746MR_MLE_N 18.10
PF00271Helicase_C 1.72
PF00270DEAD 0.86
PF01475FUR 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 49.14
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 36.21
COG0735Fe2+ or Zn2+ uptake regulation protein Fur/ZurInorganic ion transport and metabolism [P] 0.86


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.90 %
UnclassifiedrootN/A18.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002557|JGI25381J37097_1079456All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300002912|JGI25386J43895_10003333All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca4207Open in IMG/M
3300002914|JGI25617J43924_10080317All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300005172|Ga0066683_10167452All Organisms → cellular organisms → Bacteria1353Open in IMG/M
3300005174|Ga0066680_10490815All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300005176|Ga0066679_10153024All Organisms → cellular organisms → Bacteria1445Open in IMG/M
3300005180|Ga0066685_10053412All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2600Open in IMG/M
3300005436|Ga0070713_101738965All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300005444|Ga0070694_101770814All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300005559|Ga0066700_11047306All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300005568|Ga0066703_10224083All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300005569|Ga0066705_10111502All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1639Open in IMG/M
3300005598|Ga0066706_10406114All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1084Open in IMG/M
3300005937|Ga0081455_10763082All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300006046|Ga0066652_100891556All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300006755|Ga0079222_10493320All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300006755|Ga0079222_10770943All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300006755|Ga0079222_11663792All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006791|Ga0066653_10005661All Organisms → cellular organisms → Bacteria4050Open in IMG/M
3300006797|Ga0066659_10019452All Organisms → cellular organisms → Bacteria3852Open in IMG/M
3300006797|Ga0066659_10830780All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300006804|Ga0079221_11731114All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300006806|Ga0079220_10296812All Organisms → cellular organisms → Bacteria996Open in IMG/M
3300006853|Ga0075420_101114044All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300006904|Ga0075424_102717905All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300006954|Ga0079219_10473584All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300007255|Ga0099791_10053907All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1804Open in IMG/M
3300007258|Ga0099793_10486230All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes613Open in IMG/M
3300009012|Ga0066710_100799073All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas1446Open in IMG/M
3300009038|Ga0099829_10538606All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes970Open in IMG/M
3300009147|Ga0114129_13376067All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes514Open in IMG/M
3300009162|Ga0075423_12134392All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes608Open in IMG/M
3300010301|Ga0134070_10011632All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2780Open in IMG/M
3300010303|Ga0134082_10039381All Organisms → cellular organisms → Bacteria1798Open in IMG/M
3300010304|Ga0134088_10171464All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1035Open in IMG/M
3300010320|Ga0134109_10015559All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2268Open in IMG/M
3300010323|Ga0134086_10474350Not Available514Open in IMG/M
3300010325|Ga0134064_10098691All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes959Open in IMG/M
3300010329|Ga0134111_10244495All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes735Open in IMG/M
3300010329|Ga0134111_10416132All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes578Open in IMG/M
3300010329|Ga0134111_10578432Not Available501Open in IMG/M
3300010336|Ga0134071_10456652All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes656Open in IMG/M
3300010364|Ga0134066_10406668All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium521Open in IMG/M
3300010373|Ga0134128_10609995All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1214Open in IMG/M
3300010401|Ga0134121_11407407Not Available708Open in IMG/M
3300011269|Ga0137392_11226393Not Available609Open in IMG/M
3300011271|Ga0137393_10220262All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas1605Open in IMG/M
3300012096|Ga0137389_10013145All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae5597Open in IMG/M
3300012198|Ga0137364_10010509All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae5269Open in IMG/M
3300012200|Ga0137382_10400171All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes967Open in IMG/M
3300012200|Ga0137382_10917233All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes631Open in IMG/M
3300012202|Ga0137363_11467604All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium573Open in IMG/M
3300012206|Ga0137380_11656294All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes524Open in IMG/M
3300012207|Ga0137381_11257028All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium633Open in IMG/M
3300012208|Ga0137376_10016186All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis5567Open in IMG/M
3300012208|Ga0137376_10242158All Organisms → cellular organisms → Bacteria1564Open in IMG/M
3300012211|Ga0137377_10962015Not Available785Open in IMG/M
3300012224|Ga0134028_1054214All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes841Open in IMG/M
3300012350|Ga0137372_10227656All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1477Open in IMG/M
3300012353|Ga0137367_10111255All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2015Open in IMG/M
3300012353|Ga0137367_10131131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1836Open in IMG/M
3300012356|Ga0137371_10437309All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1013Open in IMG/M
3300012360|Ga0137375_10124344All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2571Open in IMG/M
3300012361|Ga0137360_10089076All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2334Open in IMG/M
3300012683|Ga0137398_10884080All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae623Open in IMG/M
3300012925|Ga0137419_10196505All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae1491Open in IMG/M
3300012925|Ga0137419_11831285Not Available520Open in IMG/M
3300012929|Ga0137404_10754326All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes882Open in IMG/M
3300012930|Ga0137407_11064686All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes766Open in IMG/M
3300012972|Ga0134077_10037061All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1758Open in IMG/M
3300012976|Ga0134076_10231149All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes784Open in IMG/M
3300012977|Ga0134087_10004139All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4585Open in IMG/M
3300014150|Ga0134081_10099977Not Available913Open in IMG/M
3300014157|Ga0134078_10091816Not Available1122Open in IMG/M
3300015358|Ga0134089_10096871Not Available1128Open in IMG/M
3300015359|Ga0134085_10186977All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes889Open in IMG/M
3300017656|Ga0134112_10025341All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2064Open in IMG/M
3300017657|Ga0134074_1063492All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1252Open in IMG/M
3300017657|Ga0134074_1231096All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes662Open in IMG/M
3300017657|Ga0134074_1249246All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes639Open in IMG/M
3300017659|Ga0134083_10113362Not Available1077Open in IMG/M
3300017997|Ga0184610_1131482All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes812Open in IMG/M
3300017997|Ga0184610_1284481All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes546Open in IMG/M
3300018000|Ga0184604_10383347All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300018031|Ga0184634_10188681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes936Open in IMG/M
3300018074|Ga0184640_10010779All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3276Open in IMG/M
3300018431|Ga0066655_10314916Not Available1021Open in IMG/M
3300018468|Ga0066662_12334889Not Available562Open in IMG/M
3300018482|Ga0066669_10381646Not Available1185Open in IMG/M
3300021073|Ga0210378_10342638All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes558Open in IMG/M
3300021080|Ga0210382_10019833All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2415Open in IMG/M
3300021086|Ga0179596_10343659Not Available748Open in IMG/M
3300024187|Ga0247672_1098552Not Available512Open in IMG/M
3300025922|Ga0207646_10696843All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes908Open in IMG/M
3300025922|Ga0207646_11093030Not Available702Open in IMG/M
3300026297|Ga0209237_1042167All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2377Open in IMG/M
3300026307|Ga0209469_1003779All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae6725Open in IMG/M
3300026307|Ga0209469_1141041All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes539Open in IMG/M
3300026310|Ga0209239_1345091Not Available520Open in IMG/M
3300026327|Ga0209266_1293510All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes512Open in IMG/M
3300026328|Ga0209802_1284361All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes551Open in IMG/M
3300026334|Ga0209377_1072275All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1481Open in IMG/M
3300026334|Ga0209377_1275937All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium555Open in IMG/M
3300026343|Ga0209159_1032197All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2784Open in IMG/M
3300026529|Ga0209806_1271879All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes569Open in IMG/M
3300026530|Ga0209807_1013653All Organisms → cellular organisms → Bacteria3992Open in IMG/M
3300026538|Ga0209056_10366521All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes929Open in IMG/M
3300026540|Ga0209376_1308545All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium617Open in IMG/M
3300027725|Ga0209178_1266663Not Available623Open in IMG/M
3300027725|Ga0209178_1418017Not Available512Open in IMG/M
3300027846|Ga0209180_10066131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae2019Open in IMG/M
3300028536|Ga0137415_10877863All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes707Open in IMG/M
3300028799|Ga0307284_10239507Not Available720Open in IMG/M
3300032012|Ga0310902_10623277All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes719Open in IMG/M
3300032180|Ga0307471_102942046All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes604Open in IMG/M
3300032897|Ga0335071_10821276Not Available878Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil20.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil19.83%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil7.76%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil6.90%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.45%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.72%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.86%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.86%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cmEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300002914Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cmEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026307Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25381J37097_107945613300002557Grasslands SoilLEPDDIATWTRACRERVAPAPVVGLLEGGYRLDLLAAGVGAHVRALA*
JGI25386J43895_1000333313300002912Grasslands SoilEPADVAHWTEAFRARVAPAPVVGVLEGGYRLDLLAXGARAHVRALA*
JGI25617J43924_1008031723300002914Grasslands SoilDVTQWTTALRERVAPAPVVALLEGGYRLDLLASGARATVEALA*
Ga0066683_1016745213300005172SoilGPEDMAAWATAFRERVAPAPVVAVLEGGYRLDLLAAGVSATVRALA*
Ga0066680_1049081513300005174SoilPDDLAQWTRAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0066679_1015302433300005176SoilASWTGAFRERVAPAPVVGLLEGGYRLDLLAAGARAHVEALA*
Ga0066685_1005341243300005180SoilPDDITHWMEVLRARMGKRPVVGVLEGGYRLDLLAAGVVALVRALS*
Ga0070713_10173896523300005436Corn, Switchgrass And Miscanthus RhizospherePEDMAVWTAAFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA*
Ga0070694_10177081413300005444Corn, Switchgrass And Miscanthus RhizosphereDDIVQWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAFVRALS*
Ga0066700_1104730623300005559SoilLQPEDMARWTAAFRERVAPAPVVGVLEGGYALELLAAGVAAHVRALA*
Ga0066703_1022408313300005568SoilAHCAVELRRRAGRAPVVAVLEGGYRLDLLAAGAVAVARALA*
Ga0066705_1011150213300005569SoilEPEDLAHCATELRRRAGRAPVVAVLEGGYRLDLLAAGAVALARALA*
Ga0066706_1040611413300005598SoilAHCATELRRRAGRAPVVAVLEGGYRLDLLAAGAVALARALA*
Ga0081455_1076308223300005937Tabebuia Heterophylla RhizosphereQWTEALRQRMGSRPVVGVLEGGYRLDLLAAGVVAHVRALS*
Ga0066652_10089155613300006046SoilWTGAFRERVAPAPVVGLLEGGYRLDLLAAGARAHVEALA*
Ga0079222_1049332023300006755Agricultural SoilRALRERVAPAPVVALLEGGYRLDLLAAGAVATVRALA*
Ga0079222_1077094323300006755Agricultural SoilAAFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA*
Ga0079222_1166379213300006755Agricultural SoilGFTLTPDDMVRWTSALRERVAPAPIVSVLEGGYRLDLLAAGVRAHVRALAS*
Ga0066653_1000566143300006791SoilEPADMARWTALLRERVAPAPVVCVLEGGYRLDLLAAGARAHVRALA*
Ga0066659_1001945243300006797SoilFRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0066659_1083078013300006797SoilPDDMGTWTRALRGRVAPSPVVGLLEGGYRLDLLAAGVRAHVQALA*
Ga0079221_1173111423300006804Agricultural SoilTLEPEDMAVWTAAFRERVAPTPVVGVLEGGYRLDLLAAGVRAHVRALAA*
Ga0079220_1029681223300006806Agricultural SoilDDIVHWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAHVRALS*
Ga0075420_10111404423300006853Populus RhizosphereLRERVAPAPVVGVLEGGYRIDLLAAGARAHVRALA*
Ga0075424_10271790523300006904Populus RhizosphereAWTATFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA*
Ga0079219_1047358423300006954Agricultural SoilFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAV*
Ga0099791_1005390733300007255Vadose Zone SoilAQWTSAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0099793_1048623013300007258Vadose Zone SoilPDDLAQWTSAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0066710_10079907313300009012Grasslands SoilLTPEDVAHWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA
Ga0099829_1053860613300009038Vadose Zone SoilWTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0114129_1337606723300009147Populus RhizosphereEPEDVTHWTSVLRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0075423_1213439223300009162Populus RhizosphereDIVQWTEALRERMGNRPVVGVLEGGYRLDLLAAGVVAFVRALS*
Ga0134070_1001163243300010301Grasslands SoilLGEFTLEPDDIVQWTEALRERMGTRPVVGVLEGGYRLDLLAAGVLAFVRALS*
Ga0134082_1003938133300010303Grasslands SoilFRERVAPAPVVGVLEGGYRLDLLAAGARAHMRALA*
Ga0134088_1017146413300010304Grasslands SoilALRERMGTRPVVGVLEGGYRPDRLAAGVVAFVRALS*
Ga0134109_1001555913300010320Grasslands SoilALRARMGTRPVVGVLEGGYRLDLLAAGVVAHVRALS*
Ga0134086_1047435023300010323Grasslands SoilDMAHWTTAFRERVAPAPVIGVLEGGYALEGLARGVAAHVRALA*
Ga0134064_1009869123300010325Grasslands SoilHWTEALRARMGKRPVVGVLEGGYRLDLLAAGVVALVRALS*
Ga0134111_1024449523300010329Grasslands SoilAALRARMRGRPVIGVLEGGYRLDLLAAAVRAHVPALA*
Ga0134111_1041613213300010329Grasslands SoilHWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA*
Ga0134111_1057843223300010329Grasslands SoilQWTARLRERVAPAPVVGVLEGGYRLDLIAAGACAHVRALA*
Ga0134071_1045665223300010336Grasslands SoilTSAFRTRVAPAPVVGLLEGGYRLDLLAAGARAHVRALA*
Ga0134066_1040666813300010364Grasslands SoilLEPDDIVHWTESLRERMGSKPVVGVLEGGYRLDLLAAGVVAHVGALS*
Ga0134128_1060999523300010373Terrestrial SoilWTHALRERMKTRPVVAVLEGGYRLDLLAAGVVALARALS*
Ga0134121_1140740713300010401Terrestrial SoilERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA*
Ga0137392_1122639323300011269Vadose Zone SoilQWTTALRERVAPAPVVALLEGGYRLDLLASGARATVEALA*
Ga0137393_1022026213300011271Vadose Zone SoilEALRQRMGTRPIVGVLEGGYRLDLLAAGVVAFVRALS*
Ga0137389_1001314563300012096Vadose Zone SoilTLEPADVVDWTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0137364_1001050913300012198Vadose Zone SoilEDLAHCATELRRRAAPAPVVAVLEGGYRLDRLAAGAAAVVRALA*
Ga0137382_1040017123300012200Vadose Zone SoilWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA*
Ga0137382_1091723323300012200Vadose Zone SoilELRRRAAPAPVIAVLEGGYRLDRLAAGAAAVVRALA*
Ga0137363_1146760423300012202Vadose Zone SoilLEPDDIVHWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVALVRALS*
Ga0137380_1165629413300012206Vadose Zone SoilPEDMAHWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHARALA*
Ga0137381_1125702823300012207Vadose Zone SoilLRERMGTRPVVGVLEGGYRLDLLAAGVVAFVRALS*
Ga0137376_1001618613300012208Vadose Zone SoilRARVAPAPVVGLLEGGYRLDLLAAGARAHARALA*
Ga0137376_1024215833300012208Vadose Zone SoilRWTMLWRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0137377_1096201513300012211Vadose Zone SoilAWTTALRDRVAPAPVVGVLEGGYSLELLAAGARAHVRALA*
Ga0134028_105421423300012224Grasslands SoilWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA*
Ga0137372_1022765633300012350Vadose Zone SoilASWTAALRERMGTRPVVGVLEGGYRLDRLAAGVVAHVGALA*
Ga0137367_1011125533300012353Vadose Zone SoilWTTAFRERVAPAPVIGVLEGGYRLDLLAAGVQAHVRALAV*
Ga0137367_1013113133300012353Vadose Zone SoilTVALRERMGTRPVIGVLEGGYRLDLLAAGVVAHVRALS*
Ga0137371_1043730913300012356Vadose Zone SoilLEPDDIAHWTVALRERMGTRPVIGVLEGGYRLDLLAAGVVAHVRALS*
Ga0137375_1012434443300012360Vadose Zone SoilWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAFVRALS*
Ga0137360_1008907643300012361Vadose Zone SoilEWTDALRERMGPRPVVGVLEGGYRLDLLAAGVVAFVRALS*
Ga0137398_1088408033300012683Vadose Zone SoilSAFRARLAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0137419_1019650513300012925Vadose Zone SoilEPEDIAVWTTALRERMRGRPVIGVLEGGYRLEGLAAGVRAHVRALA*
Ga0137419_1183128513300012925Vadose Zone SoilCATELRRRAGPAPVVAVLEGGYRLDRLAAGAAALVRALA*
Ga0137404_1075432613300012929Vadose Zone SoilRAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0137407_1106468623300012930Vadose Zone SoilDIAHWTGALRERMQGRPVIGVLEGGYRLEGLAAGVRAHVRALA*
Ga0134077_1003706113300012972Grasslands SoilALRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0134076_1023114913300012976Grasslands SoilTPEDVARWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA*
Ga0134087_1000413943300012977Grasslands SoilRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA*
Ga0134081_1009997713300014150Grasslands SoilDLASWTGAFRERVAPAPVVGLLEGGYRLDLLAAGARAHVAALA*
Ga0134078_1009181613300014157Grasslands SoilDMARWTTLFRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA*
Ga0134089_1009687123300015358Grasslands SoilFRERVAPAPVVAVLEGGYRLDLLAAGVSATVRALA*
Ga0134085_1018697723300015359Grasslands SoilFTLTPEDVAHWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA*
Ga0134112_1002534113300017656Grasslands SoilDADDVAAWTTALRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALA
Ga0134074_106349233300017657Grasslands SoilHWTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA
Ga0134074_123109623300017657Grasslands SoilTRALRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA
Ga0134074_124924613300017657Grasslands SoilTLEPDDIVHWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAHVRALS
Ga0134083_1011336213300017659Grasslands SoilMLEPEDMAGWTAAFRECEAPAPVVGVLEGGYRLDLLGAGVRAHVRALAA
Ga0184610_113148223300017997Groundwater SedimentHWTAALRERMRGRPVVGVLEGGYRLDLLAAGASAHVRALA
Ga0184610_128448123300017997Groundwater SedimentWTTALRERMGSRPVVGVLEGGYRLDLLAAGVVAHVRALA
Ga0184604_1038334713300018000Groundwater SedimentTAFRERVAPAPVVSVLEGGYRLDLLAAGVRAHVRALA
Ga0184634_1018868123300018031Groundwater SedimentTVALRERMRGRPVVGVLEGGYRLEGLAAGAAATVRALA
Ga0184640_1001077913300018074Groundwater SedimentTLEPDDVAHWTGALRARLGSRPVVGVLEGGYRLDLLVAGVVAHVRALA
Ga0066655_1031491613300018431Grasslands SoilLWRERVAPAPVVGVLEGGYRLELLAAGVRAHVRALA
Ga0066662_1233488923300018468Grasslands SoilLRERVAPSPVVGLLEGGYRLDLLAAGVRAHVQALA
Ga0066669_1038164613300018482Grasslands SoilLRRRAAAGRVVAGLEGGYRLDRLAAGAAALVRALA
Ga0210378_1034263823300021073Groundwater SedimentLEPDDITQWTEALRERMQGRPVVGVLEGGYRLDLLAKGVSAHVRALA
Ga0210382_1001983313300021080Groundwater SedimentEDMARWTTAFRERVAPAPVVSVLEGGYRLDLLAAGVRAHVHALA
Ga0179596_1034365933300021086Vadose Zone SoilTSAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA
Ga0247672_109855223300024187SoilDIATWTGALRTRTQGRPVIALLEGGYRIDLLAEGCVALVRALA
Ga0207646_1069684323300025922Corn, Switchgrass And Miscanthus RhizosphereEPEDLAQWTSAFRARVAPAPVIGVLEGGYRLDLLAAGARAHVRALA
Ga0207646_1109303013300025922Corn, Switchgrass And Miscanthus RhizosphereLEPEDITRWTTALRERVAPAPVVAVLEGGYRLDLLAAGAVATVQALA
Ga0209237_104216733300026297Grasslands SoilVAAWTTALRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALA
Ga0209469_100377983300026307SoilRWTSALRARVAPAPVVGVLEGGYRLDLLAAGAHAHVGALA
Ga0209469_114104123300026307SoilTKELRARVAPAPAVGVLEGGYRLDLLGAGARAHVRALA
Ga0209239_134509123300026310Grasslands SoilIATWTRACRERVAPAPVVGLLEGGYRLDLLAAGVGAHVRALA
Ga0209266_129351013300026327SoilTLDPEDTAQWTRALRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA
Ga0209802_128436123300026328SoilRAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA
Ga0209377_107227533300026334SoilLGGFTLAPEDMAHWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA
Ga0209377_127593723300026334SoilEDMAFWTRALRERIGTAPVAAVLEGGYRLDLLAAGVRAVVRALA
Ga0209159_103219743300026343SoilHCATELRRRAAPAPVVAVLEGGYRLDRLAAGAAAVVRALA
Ga0209806_127187913300026529SoilAHCAVELRRRAGRAPVVAVLEGGYRLDLLAAGAVAVARALA
Ga0209807_101365343300026530SoilWTEALRARMGNRPIAAVLEGGYRLDLLAAGVVALVRALS
Ga0209056_1036652123300026538SoilALRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA
Ga0209376_130854513300026540SoilDITHWMEVLRARMGKRPVVGVLEGGYRLDLLAAGVVALVRALS
Ga0209178_126666323300027725Agricultural SoilMATWTAVFRERMAPAPVVGILEGGYRLDLLAAGVRAHVRALAA
Ga0209178_141801723300027725Agricultural SoilPEDMAVWTAAFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA
Ga0209180_1006613113300027846Vadose Zone SoilWTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA
Ga0137415_1087786313300028536Vadose Zone SoilDIAQWTAALRERMRGRPVIGVLEGGYRLDLLAAGASAHVRALA
Ga0307284_1023950713300028799SoilEPEDMAQLTTALRERVAPASVVGILEGGYNVERLAAGVQFHVRALA
Ga0310902_1062327723300032012SoilSFSHALRERMKTRPVVAVLEGGYRLDLLAAGVVALARALS
Ga0307471_10294204623300032180Hardwood Forest SoilHWTEALRERMGARPVVAVLEGGYRLDLLAAGVVALVRALS
Ga0335071_1082127623300032897SoilAFRERVAPAPVVGVLEGGYRLDLLAAGAQAHVRALA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.