Basic Information | |
---|---|
Family ID | F078556 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 116 |
Average Sequence Length | 42 residues |
Representative Sequence | WTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 116 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.14 % |
% of genes from short scaffolds (< 2000 bps) | 81.90 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (81.897 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.276 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.621 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 116 Family Scaffolds |
---|---|---|
PF01544 | CorA | 49.14 |
PF13378 | MR_MLE_C | 27.59 |
PF02746 | MR_MLE_N | 18.10 |
PF00271 | Helicase_C | 1.72 |
PF00270 | DEAD | 0.86 |
PF01475 | FUR | 0.86 |
COG ID | Name | Functional Category | % Frequency in 116 Family Scaffolds |
---|---|---|---|
COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 49.14 |
COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 36.21 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.86 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.90 % |
Unclassified | root | N/A | 18.10 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1079456 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300002912|JGI25386J43895_10003333 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 4207 | Open in IMG/M |
3300002914|JGI25617J43924_10080317 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
3300005172|Ga0066683_10167452 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
3300005174|Ga0066680_10490815 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300005176|Ga0066679_10153024 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300005180|Ga0066685_10053412 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2600 | Open in IMG/M |
3300005436|Ga0070713_101738965 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300005444|Ga0070694_101770814 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300005559|Ga0066700_11047306 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300005568|Ga0066703_10224083 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
3300005569|Ga0066705_10111502 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1639 | Open in IMG/M |
3300005598|Ga0066706_10406114 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1084 | Open in IMG/M |
3300005937|Ga0081455_10763082 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300006046|Ga0066652_100891556 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
3300006755|Ga0079222_10493320 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300006755|Ga0079222_10770943 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
3300006755|Ga0079222_11663792 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300006791|Ga0066653_10005661 | All Organisms → cellular organisms → Bacteria | 4050 | Open in IMG/M |
3300006797|Ga0066659_10019452 | All Organisms → cellular organisms → Bacteria | 3852 | Open in IMG/M |
3300006797|Ga0066659_10830780 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300006804|Ga0079221_11731114 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006806|Ga0079220_10296812 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
3300006853|Ga0075420_101114044 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
3300006904|Ga0075424_102717905 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300006954|Ga0079219_10473584 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300007255|Ga0099791_10053907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1804 | Open in IMG/M |
3300007258|Ga0099793_10486230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 613 | Open in IMG/M |
3300009012|Ga0066710_100799073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 1446 | Open in IMG/M |
3300009038|Ga0099829_10538606 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 970 | Open in IMG/M |
3300009147|Ga0114129_13376067 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
3300009162|Ga0075423_12134392 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 608 | Open in IMG/M |
3300010301|Ga0134070_10011632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2780 | Open in IMG/M |
3300010303|Ga0134082_10039381 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
3300010304|Ga0134088_10171464 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1035 | Open in IMG/M |
3300010320|Ga0134109_10015559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2268 | Open in IMG/M |
3300010323|Ga0134086_10474350 | Not Available | 514 | Open in IMG/M |
3300010325|Ga0134064_10098691 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 959 | Open in IMG/M |
3300010329|Ga0134111_10244495 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 735 | Open in IMG/M |
3300010329|Ga0134111_10416132 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 578 | Open in IMG/M |
3300010329|Ga0134111_10578432 | Not Available | 501 | Open in IMG/M |
3300010336|Ga0134071_10456652 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 656 | Open in IMG/M |
3300010364|Ga0134066_10406668 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 521 | Open in IMG/M |
3300010373|Ga0134128_10609995 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1214 | Open in IMG/M |
3300010401|Ga0134121_11407407 | Not Available | 708 | Open in IMG/M |
3300011269|Ga0137392_11226393 | Not Available | 609 | Open in IMG/M |
3300011271|Ga0137393_10220262 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 1605 | Open in IMG/M |
3300012096|Ga0137389_10013145 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5597 | Open in IMG/M |
3300012198|Ga0137364_10010509 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5269 | Open in IMG/M |
3300012200|Ga0137382_10400171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 967 | Open in IMG/M |
3300012200|Ga0137382_10917233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 631 | Open in IMG/M |
3300012202|Ga0137363_11467604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
3300012206|Ga0137380_11656294 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 524 | Open in IMG/M |
3300012207|Ga0137381_11257028 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
3300012208|Ga0137376_10016186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5567 | Open in IMG/M |
3300012208|Ga0137376_10242158 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
3300012211|Ga0137377_10962015 | Not Available | 785 | Open in IMG/M |
3300012224|Ga0134028_1054214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 841 | Open in IMG/M |
3300012350|Ga0137372_10227656 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1477 | Open in IMG/M |
3300012353|Ga0137367_10111255 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2015 | Open in IMG/M |
3300012353|Ga0137367_10131131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1836 | Open in IMG/M |
3300012356|Ga0137371_10437309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1013 | Open in IMG/M |
3300012360|Ga0137375_10124344 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2571 | Open in IMG/M |
3300012361|Ga0137360_10089076 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2334 | Open in IMG/M |
3300012683|Ga0137398_10884080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 623 | Open in IMG/M |
3300012925|Ga0137419_10196505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 1491 | Open in IMG/M |
3300012925|Ga0137419_11831285 | Not Available | 520 | Open in IMG/M |
3300012929|Ga0137404_10754326 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 882 | Open in IMG/M |
3300012930|Ga0137407_11064686 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 766 | Open in IMG/M |
3300012972|Ga0134077_10037061 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1758 | Open in IMG/M |
3300012976|Ga0134076_10231149 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 784 | Open in IMG/M |
3300012977|Ga0134087_10004139 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4585 | Open in IMG/M |
3300014150|Ga0134081_10099977 | Not Available | 913 | Open in IMG/M |
3300014157|Ga0134078_10091816 | Not Available | 1122 | Open in IMG/M |
3300015358|Ga0134089_10096871 | Not Available | 1128 | Open in IMG/M |
3300015359|Ga0134085_10186977 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 889 | Open in IMG/M |
3300017656|Ga0134112_10025341 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2064 | Open in IMG/M |
3300017657|Ga0134074_1063492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1252 | Open in IMG/M |
3300017657|Ga0134074_1231096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 662 | Open in IMG/M |
3300017657|Ga0134074_1249246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 639 | Open in IMG/M |
3300017659|Ga0134083_10113362 | Not Available | 1077 | Open in IMG/M |
3300017997|Ga0184610_1131482 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 812 | Open in IMG/M |
3300017997|Ga0184610_1284481 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 546 | Open in IMG/M |
3300018000|Ga0184604_10383347 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300018031|Ga0184634_10188681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 936 | Open in IMG/M |
3300018074|Ga0184640_10010779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3276 | Open in IMG/M |
3300018431|Ga0066655_10314916 | Not Available | 1021 | Open in IMG/M |
3300018468|Ga0066662_12334889 | Not Available | 562 | Open in IMG/M |
3300018482|Ga0066669_10381646 | Not Available | 1185 | Open in IMG/M |
3300021073|Ga0210378_10342638 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 558 | Open in IMG/M |
3300021080|Ga0210382_10019833 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2415 | Open in IMG/M |
3300021086|Ga0179596_10343659 | Not Available | 748 | Open in IMG/M |
3300024187|Ga0247672_1098552 | Not Available | 512 | Open in IMG/M |
3300025922|Ga0207646_10696843 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 908 | Open in IMG/M |
3300025922|Ga0207646_11093030 | Not Available | 702 | Open in IMG/M |
3300026297|Ga0209237_1042167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2377 | Open in IMG/M |
3300026307|Ga0209469_1003779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6725 | Open in IMG/M |
3300026307|Ga0209469_1141041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 539 | Open in IMG/M |
3300026310|Ga0209239_1345091 | Not Available | 520 | Open in IMG/M |
3300026327|Ga0209266_1293510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 512 | Open in IMG/M |
3300026328|Ga0209802_1284361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 551 | Open in IMG/M |
3300026334|Ga0209377_1072275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1481 | Open in IMG/M |
3300026334|Ga0209377_1275937 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
3300026343|Ga0209159_1032197 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2784 | Open in IMG/M |
3300026529|Ga0209806_1271879 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 569 | Open in IMG/M |
3300026530|Ga0209807_1013653 | All Organisms → cellular organisms → Bacteria | 3992 | Open in IMG/M |
3300026538|Ga0209056_10366521 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 929 | Open in IMG/M |
3300026540|Ga0209376_1308545 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
3300027725|Ga0209178_1266663 | Not Available | 623 | Open in IMG/M |
3300027725|Ga0209178_1418017 | Not Available | 512 | Open in IMG/M |
3300027846|Ga0209180_10066131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 2019 | Open in IMG/M |
3300028536|Ga0137415_10877863 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 707 | Open in IMG/M |
3300028799|Ga0307284_10239507 | Not Available | 720 | Open in IMG/M |
3300032012|Ga0310902_10623277 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 719 | Open in IMG/M |
3300032180|Ga0307471_102942046 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 604 | Open in IMG/M |
3300032897|Ga0335071_10821276 | Not Available | 878 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 20.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.76% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.90% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.45% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.72% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.86% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.86% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.86% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.86% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300024187 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10794561 | 3300002557 | Grasslands Soil | LEPDDIATWTRACRERVAPAPVVGLLEGGYRLDLLAAGVGAHVRALA* |
JGI25386J43895_100033331 | 3300002912 | Grasslands Soil | EPADVAHWTEAFRARVAPAPVVGVLEGGYRLDLLAXGARAHVRALA* |
JGI25617J43924_100803172 | 3300002914 | Grasslands Soil | DVTQWTTALRERVAPAPVVALLEGGYRLDLLASGARATVEALA* |
Ga0066683_101674521 | 3300005172 | Soil | GPEDMAAWATAFRERVAPAPVVAVLEGGYRLDLLAAGVSATVRALA* |
Ga0066680_104908151 | 3300005174 | Soil | PDDLAQWTRAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0066679_101530243 | 3300005176 | Soil | ASWTGAFRERVAPAPVVGLLEGGYRLDLLAAGARAHVEALA* |
Ga0066685_100534124 | 3300005180 | Soil | PDDITHWMEVLRARMGKRPVVGVLEGGYRLDLLAAGVVALVRALS* |
Ga0070713_1017389652 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PEDMAVWTAAFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA* |
Ga0070694_1017708141 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DDIVQWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAFVRALS* |
Ga0066700_110473062 | 3300005559 | Soil | LQPEDMARWTAAFRERVAPAPVVGVLEGGYALELLAAGVAAHVRALA* |
Ga0066703_102240831 | 3300005568 | Soil | AHCAVELRRRAGRAPVVAVLEGGYRLDLLAAGAVAVARALA* |
Ga0066705_101115021 | 3300005569 | Soil | EPEDLAHCATELRRRAGRAPVVAVLEGGYRLDLLAAGAVALARALA* |
Ga0066706_104061141 | 3300005598 | Soil | AHCATELRRRAGRAPVVAVLEGGYRLDLLAAGAVALARALA* |
Ga0081455_107630822 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QWTEALRQRMGSRPVVGVLEGGYRLDLLAAGVVAHVRALS* |
Ga0066652_1008915561 | 3300006046 | Soil | WTGAFRERVAPAPVVGLLEGGYRLDLLAAGARAHVEALA* |
Ga0079222_104933202 | 3300006755 | Agricultural Soil | RALRERVAPAPVVALLEGGYRLDLLAAGAVATVRALA* |
Ga0079222_107709432 | 3300006755 | Agricultural Soil | AAFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA* |
Ga0079222_116637921 | 3300006755 | Agricultural Soil | GFTLTPDDMVRWTSALRERVAPAPIVSVLEGGYRLDLLAAGVRAHVRALAS* |
Ga0066653_100056614 | 3300006791 | Soil | EPADMARWTALLRERVAPAPVVCVLEGGYRLDLLAAGARAHVRALA* |
Ga0066659_100194524 | 3300006797 | Soil | FRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0066659_108307801 | 3300006797 | Soil | PDDMGTWTRALRGRVAPSPVVGLLEGGYRLDLLAAGVRAHVQALA* |
Ga0079221_117311142 | 3300006804 | Agricultural Soil | TLEPEDMAVWTAAFRERVAPTPVVGVLEGGYRLDLLAAGVRAHVRALAA* |
Ga0079220_102968122 | 3300006806 | Agricultural Soil | DDIVHWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAHVRALS* |
Ga0075420_1011140442 | 3300006853 | Populus Rhizosphere | LRERVAPAPVVGVLEGGYRIDLLAAGARAHVRALA* |
Ga0075424_1027179052 | 3300006904 | Populus Rhizosphere | AWTATFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA* |
Ga0079219_104735842 | 3300006954 | Agricultural Soil | FRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAV* |
Ga0099791_100539073 | 3300007255 | Vadose Zone Soil | AQWTSAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0099793_104862301 | 3300007258 | Vadose Zone Soil | PDDLAQWTSAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0066710_1007990731 | 3300009012 | Grasslands Soil | LTPEDVAHWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA |
Ga0099829_105386061 | 3300009038 | Vadose Zone Soil | WTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0114129_133760672 | 3300009147 | Populus Rhizosphere | EPEDVTHWTSVLRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0075423_121343922 | 3300009162 | Populus Rhizosphere | DIVQWTEALRERMGNRPVVGVLEGGYRLDLLAAGVVAFVRALS* |
Ga0134070_100116324 | 3300010301 | Grasslands Soil | LGEFTLEPDDIVQWTEALRERMGTRPVVGVLEGGYRLDLLAAGVLAFVRALS* |
Ga0134082_100393813 | 3300010303 | Grasslands Soil | FRERVAPAPVVGVLEGGYRLDLLAAGARAHMRALA* |
Ga0134088_101714641 | 3300010304 | Grasslands Soil | ALRERMGTRPVVGVLEGGYRPDRLAAGVVAFVRALS* |
Ga0134109_100155591 | 3300010320 | Grasslands Soil | ALRARMGTRPVVGVLEGGYRLDLLAAGVVAHVRALS* |
Ga0134086_104743502 | 3300010323 | Grasslands Soil | DMAHWTTAFRERVAPAPVIGVLEGGYALEGLARGVAAHVRALA* |
Ga0134064_100986912 | 3300010325 | Grasslands Soil | HWTEALRARMGKRPVVGVLEGGYRLDLLAAGVVALVRALS* |
Ga0134111_102444952 | 3300010329 | Grasslands Soil | AALRARMRGRPVIGVLEGGYRLDLLAAAVRAHVPALA* |
Ga0134111_104161321 | 3300010329 | Grasslands Soil | HWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA* |
Ga0134111_105784322 | 3300010329 | Grasslands Soil | QWTARLRERVAPAPVVGVLEGGYRLDLIAAGACAHVRALA* |
Ga0134071_104566522 | 3300010336 | Grasslands Soil | TSAFRTRVAPAPVVGLLEGGYRLDLLAAGARAHVRALA* |
Ga0134066_104066681 | 3300010364 | Grasslands Soil | LEPDDIVHWTESLRERMGSKPVVGVLEGGYRLDLLAAGVVAHVGALS* |
Ga0134128_106099952 | 3300010373 | Terrestrial Soil | WTHALRERMKTRPVVAVLEGGYRLDLLAAGVVALARALS* |
Ga0134121_114074071 | 3300010401 | Terrestrial Soil | ERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA* |
Ga0137392_112263932 | 3300011269 | Vadose Zone Soil | QWTTALRERVAPAPVVALLEGGYRLDLLASGARATVEALA* |
Ga0137393_102202621 | 3300011271 | Vadose Zone Soil | EALRQRMGTRPIVGVLEGGYRLDLLAAGVVAFVRALS* |
Ga0137389_100131456 | 3300012096 | Vadose Zone Soil | TLEPADVVDWTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0137364_100105091 | 3300012198 | Vadose Zone Soil | EDLAHCATELRRRAAPAPVVAVLEGGYRLDRLAAGAAAVVRALA* |
Ga0137382_104001712 | 3300012200 | Vadose Zone Soil | WTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA* |
Ga0137382_109172332 | 3300012200 | Vadose Zone Soil | ELRRRAAPAPVIAVLEGGYRLDRLAAGAAAVVRALA* |
Ga0137363_114676042 | 3300012202 | Vadose Zone Soil | LEPDDIVHWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVALVRALS* |
Ga0137380_116562941 | 3300012206 | Vadose Zone Soil | PEDMAHWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHARALA* |
Ga0137381_112570282 | 3300012207 | Vadose Zone Soil | LRERMGTRPVVGVLEGGYRLDLLAAGVVAFVRALS* |
Ga0137376_100161861 | 3300012208 | Vadose Zone Soil | RARVAPAPVVGLLEGGYRLDLLAAGARAHARALA* |
Ga0137376_102421583 | 3300012208 | Vadose Zone Soil | RWTMLWRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0137377_109620151 | 3300012211 | Vadose Zone Soil | AWTTALRDRVAPAPVVGVLEGGYSLELLAAGARAHVRALA* |
Ga0134028_10542142 | 3300012224 | Grasslands Soil | WTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA* |
Ga0137372_102276563 | 3300012350 | Vadose Zone Soil | ASWTAALRERMGTRPVVGVLEGGYRLDRLAAGVVAHVGALA* |
Ga0137367_101112553 | 3300012353 | Vadose Zone Soil | WTTAFRERVAPAPVIGVLEGGYRLDLLAAGVQAHVRALAV* |
Ga0137367_101311313 | 3300012353 | Vadose Zone Soil | TVALRERMGTRPVIGVLEGGYRLDLLAAGVVAHVRALS* |
Ga0137371_104373091 | 3300012356 | Vadose Zone Soil | LEPDDIAHWTVALRERMGTRPVIGVLEGGYRLDLLAAGVVAHVRALS* |
Ga0137375_101243444 | 3300012360 | Vadose Zone Soil | WTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAFVRALS* |
Ga0137360_100890764 | 3300012361 | Vadose Zone Soil | EWTDALRERMGPRPVVGVLEGGYRLDLLAAGVVAFVRALS* |
Ga0137398_108840803 | 3300012683 | Vadose Zone Soil | SAFRARLAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0137419_101965051 | 3300012925 | Vadose Zone Soil | EPEDIAVWTTALRERMRGRPVIGVLEGGYRLEGLAAGVRAHVRALA* |
Ga0137419_118312851 | 3300012925 | Vadose Zone Soil | CATELRRRAGPAPVVAVLEGGYRLDRLAAGAAALVRALA* |
Ga0137404_107543261 | 3300012929 | Vadose Zone Soil | RAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0137407_110646862 | 3300012930 | Vadose Zone Soil | DIAHWTGALRERMQGRPVIGVLEGGYRLEGLAAGVRAHVRALA* |
Ga0134077_100370611 | 3300012972 | Grasslands Soil | ALRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0134076_102311491 | 3300012976 | Grasslands Soil | TPEDVARWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA* |
Ga0134087_100041394 | 3300012977 | Grasslands Soil | RARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA* |
Ga0134081_100999771 | 3300014150 | Grasslands Soil | DLASWTGAFRERVAPAPVVGLLEGGYRLDLLAAGARAHVAALA* |
Ga0134078_100918161 | 3300014157 | Grasslands Soil | DMARWTTLFRERVAPAPVVGVLEGGYRLDLLAAGARAHVRALA* |
Ga0134089_100968712 | 3300015358 | Grasslands Soil | FRERVAPAPVVAVLEGGYRLDLLAAGVSATVRALA* |
Ga0134085_101869772 | 3300015359 | Grasslands Soil | FTLTPEDVAHWTSALRARVAPAPVVGVLEGGYRLDLLAAGARAHVGALA* |
Ga0134112_100253411 | 3300017656 | Grasslands Soil | DADDVAAWTTALRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALA |
Ga0134074_10634923 | 3300017657 | Grasslands Soil | HWTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA |
Ga0134074_12310962 | 3300017657 | Grasslands Soil | TRALRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA |
Ga0134074_12492461 | 3300017657 | Grasslands Soil | TLEPDDIVHWTEALRERMGTRPVVGVLEGGYRLDLLAAGVVAHVRALS |
Ga0134083_101133621 | 3300017659 | Grasslands Soil | MLEPEDMAGWTAAFRECEAPAPVVGVLEGGYRLDLLGAGVRAHVRALAA |
Ga0184610_11314822 | 3300017997 | Groundwater Sediment | HWTAALRERMRGRPVVGVLEGGYRLDLLAAGASAHVRALA |
Ga0184610_12844812 | 3300017997 | Groundwater Sediment | WTTALRERMGSRPVVGVLEGGYRLDLLAAGVVAHVRALA |
Ga0184604_103833471 | 3300018000 | Groundwater Sediment | TAFRERVAPAPVVSVLEGGYRLDLLAAGVRAHVRALA |
Ga0184634_101886812 | 3300018031 | Groundwater Sediment | TVALRERMRGRPVVGVLEGGYRLEGLAAGAAATVRALA |
Ga0184640_100107791 | 3300018074 | Groundwater Sediment | TLEPDDVAHWTGALRARLGSRPVVGVLEGGYRLDLLVAGVVAHVRALA |
Ga0066655_103149161 | 3300018431 | Grasslands Soil | LWRERVAPAPVVGVLEGGYRLELLAAGVRAHVRALA |
Ga0066662_123348892 | 3300018468 | Grasslands Soil | LRERVAPSPVVGLLEGGYRLDLLAAGVRAHVQALA |
Ga0066669_103816461 | 3300018482 | Grasslands Soil | LRRRAAAGRVVAGLEGGYRLDRLAAGAAALVRALA |
Ga0210378_103426382 | 3300021073 | Groundwater Sediment | LEPDDITQWTEALRERMQGRPVVGVLEGGYRLDLLAKGVSAHVRALA |
Ga0210382_100198331 | 3300021080 | Groundwater Sediment | EDMARWTTAFRERVAPAPVVSVLEGGYRLDLLAAGVRAHVHALA |
Ga0179596_103436593 | 3300021086 | Vadose Zone Soil | TSAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA |
Ga0247672_10985522 | 3300024187 | Soil | DIATWTGALRTRTQGRPVIALLEGGYRIDLLAEGCVALVRALA |
Ga0207646_106968432 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EPEDLAQWTSAFRARVAPAPVIGVLEGGYRLDLLAAGARAHVRALA |
Ga0207646_110930301 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LEPEDITRWTTALRERVAPAPVVAVLEGGYRLDLLAAGAVATVQALA |
Ga0209237_10421673 | 3300026297 | Grasslands Soil | VAAWTTALRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALA |
Ga0209469_10037798 | 3300026307 | Soil | RWTSALRARVAPAPVVGVLEGGYRLDLLAAGAHAHVGALA |
Ga0209469_11410412 | 3300026307 | Soil | TKELRARVAPAPAVGVLEGGYRLDLLGAGARAHVRALA |
Ga0209239_13450912 | 3300026310 | Grasslands Soil | IATWTRACRERVAPAPVVGLLEGGYRLDLLAAGVGAHVRALA |
Ga0209266_12935101 | 3300026327 | Soil | TLDPEDTAQWTRALRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA |
Ga0209802_12843612 | 3300026328 | Soil | RAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA |
Ga0209377_10722753 | 3300026334 | Soil | LGGFTLAPEDMAHWTSAFRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA |
Ga0209377_12759372 | 3300026334 | Soil | EDMAFWTRALRERIGTAPVAAVLEGGYRLDLLAAGVRAVVRALA |
Ga0209159_10321974 | 3300026343 | Soil | HCATELRRRAAPAPVVAVLEGGYRLDRLAAGAAAVVRALA |
Ga0209806_12718791 | 3300026529 | Soil | AHCAVELRRRAGRAPVVAVLEGGYRLDLLAAGAVAVARALA |
Ga0209807_10136534 | 3300026530 | Soil | WTEALRARMGNRPIAAVLEGGYRLDLLAAGVVALVRALS |
Ga0209056_103665212 | 3300026538 | Soil | ALRARVAPAPVVGLLEGGYRLDLLAAGARAHVRALA |
Ga0209376_13085451 | 3300026540 | Soil | DITHWMEVLRARMGKRPVVGVLEGGYRLDLLAAGVVALVRALS |
Ga0209178_12666632 | 3300027725 | Agricultural Soil | MATWTAVFRERMAPAPVVGILEGGYRLDLLAAGVRAHVRALAA |
Ga0209178_14180172 | 3300027725 | Agricultural Soil | PEDMAVWTAAFRERVAPAPVVGVLEGGYRLDLLAAGVRAHVRALAA |
Ga0209180_100661311 | 3300027846 | Vadose Zone Soil | WTEAFRARVAPAPVVGVLEGGYRLDLLAAGARAHVRALA |
Ga0137415_108778631 | 3300028536 | Vadose Zone Soil | DIAQWTAALRERMRGRPVIGVLEGGYRLDLLAAGASAHVRALA |
Ga0307284_102395071 | 3300028799 | Soil | EPEDMAQLTTALRERVAPASVVGILEGGYNVERLAAGVQFHVRALA |
Ga0310902_106232772 | 3300032012 | Soil | SFSHALRERMKTRPVVAVLEGGYRLDLLAAGVVALARALS |
Ga0307471_1029420462 | 3300032180 | Hardwood Forest Soil | HWTEALRERMGARPVVAVLEGGYRLDLLAAGVVALVRALS |
Ga0335071_108212762 | 3300032897 | Soil | AFRERVAPAPVVGVLEGGYRLDLLAAGAQAHVRALA |
⦗Top⦘ |