Metagenome / Metatranscriptome Family F078111

Overview

Basic Information

• Family ID: F078111
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 116
• Average Sequence Length: 43 residues
• Representative Sequence: MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLRTELMCHLA
• Number of Associated Samples: 87
• Number of Associated Scaffolds: 116

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 30.17 %
• % of genes near scaffold ends (potentially truncated): 21.55 %
• % of genes from short scaffolds (< 2000 bps): 100.00 %
• Associated GOLD sequencing projects: 87
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (93.966 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (61.207 % of family members)
• Environment Ontology (ENVO): Unclassified (86.207 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (74.138 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 44.44%
  β-sheet: 0.00%
  Coil/Unstructured: 55.56%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
All Organisms	root	All Organisms	6.03 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
cellular organisms	root	All Organisms → cellular organisms	6.03 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	6.03 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	6.03 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	6.03 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	6.03 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	6.03 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	6.03 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	6.03 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	6.03 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	6.03 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	6.03 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	6.03 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	6.03 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	6.03 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	6.03 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	6.03 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	6.03 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	6.03 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	6.03 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	6.03 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	4.31 %
Anthephorinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae	1.72 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	4.31 %
Digitaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria	1.72 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	2.59 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1.72 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.86 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	93.97 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	2.59 %
Digitaria exilis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	1.72 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.86 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005365|Ga0070688_100842594	Not Available	720
3300005617|Ga0068859_102906812	Not Available	524
3300005841|Ga0068863_100917536	Not Available	877
3300005841|Ga0068863_102438609	Not Available	532
3300005843|Ga0068860_102626569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	523
3300009553|Ga0105249_11669474	Not Available	710
3300009972|Ga0105137_108061	Not Available	556
3300009976|Ga0105128_104961	Not Available	784
3300009981|Ga0105133_113995	Not Available	648
3300009989|Ga0105131_122844	Not Available	630
3300009989|Ga0105131_129509	Not Available	580
3300009990|Ga0105132_124656	Not Available	615
3300009992|Ga0105120_1004866	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1149
3300009994|Ga0105126_1021380	Not Available	707
3300009995|Ga0105139_1091206	Not Available	581
3300010371|Ga0134125_11027560	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	903
3300010396|Ga0134126_12447108	Not Available	568
3300010396|Ga0134126_12838301	Not Available	525
3300010400|Ga0134122_11267472	Not Available	742
3300010401|Ga0134121_12550246	Not Available	554
3300014325|Ga0163163_13348790	Not Available	500
3300014326|Ga0157380_11082290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	840
3300014326|Ga0157380_12024950	Not Available	638
3300014968|Ga0157379_11386944	Not Available	681
3300015270|Ga0182183_1032131	Not Available	705
3300015270|Ga0182183_1089691	Not Available	513
3300015273|Ga0182102_1022199	Not Available	617
3300015273|Ga0182102_1025329	Not Available	596
3300015278|Ga0182099_1016659	Not Available	755
3300015278|Ga0182099_1048634	Not Available	568
3300015280|Ga0182100_1002630	Not Available	1479
3300015280|Ga0182100_1035483	Not Available	712
3300015293|Ga0182103_1097072	Not Available	514
3300015297|Ga0182104_1100228	Not Available	539
3300015301|Ga0182184_1034259	Not Available	724
3300015301|Ga0182184_1057522	Not Available	611
3300015306|Ga0182180_1017412	Not Available	930
3300015311|Ga0182182_1012136	Not Available	1068
3300015312|Ga0182168_1052962	Not Available	719
3300015313|Ga0182164_1009186	Not Available	1242
3300015313|Ga0182164_1088987	Not Available	596
3300015313|Ga0182164_1122273	Not Available	527
3300015316|Ga0182121_1045775	Not Available	788
3300015318|Ga0182181_1029155	Not Available	801
3300015319|Ga0182130_1056801	Not Available	692
3300015319|Ga0182130_1102293	Not Available	563
3300015320|Ga0182165_1099758	Not Available	588
3300015325|Ga0182148_1074471	Not Available	649
3300015325|Ga0182148_1116667	Not Available	549
3300015325|Ga0182148_1136514	Not Available	516
3300015327|Ga0182114_1153619	Not Available	514
3300015331|Ga0182131_1096074	Not Available	611
3300015332|Ga0182117_1119908	Not Available	585
3300015334|Ga0182132_1138211	Not Available	548
3300015335|Ga0182116_1172958	Not Available	510
3300015336|Ga0182150_1060084	Not Available	746
3300015339|Ga0182149_1050161	Not Available	821
3300015339|Ga0182149_1085811	Not Available	673
3300015339|Ga0182149_1104879	Not Available	622
3300015348|Ga0182115_1107744	Not Available	879
3300015348|Ga0182115_1205833	Not Available	630
3300015349|Ga0182185_1211555	Not Available	587
3300015350|Ga0182163_1133841	Not Available	766
3300015350|Ga0182163_1228275	Not Available	583
3300015352|Ga0182169_1185675	Not Available	680
3300015352|Ga0182169_1270086	Not Available	551
3300015354|Ga0182167_1187753	Not Available	758
3300017422|Ga0182201_1087685	Not Available	599
3300017432|Ga0182196_1125344	Not Available	544
3300017432|Ga0182196_1126824	Not Available	541
3300017432|Ga0182196_1139138	Not Available	524
3300017439|Ga0182200_1058124	Not Available	722
3300017439|Ga0182200_1078811	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis	651
3300017447|Ga0182215_1134642	Not Available	565
3300017691|Ga0182212_1068285	Not Available	787
3300017692|Ga0182210_1154536	Not Available	511
3300017694|Ga0182211_1070826	Not Available	806
3300017694|Ga0182211_1086565	Not Available	729
3300017694|Ga0182211_1124428	Not Available	609
3300017792|Ga0163161_10992345	Not Available	716
3300020023|Ga0182178_1014038	Not Available	596
3300020223|Ga0182118_111981	Not Available	544
3300028049|Ga0268322_1030633	Not Available	621
3300028049|Ga0268322_1036433	Not Available	586
3300028050|Ga0268328_1009198	Not Available	988
3300028050|Ga0268328_1065293	Not Available	521
3300028053|Ga0268346_1014791	Not Available	710
3300028056|Ga0268330_1014253	Not Available	832
3300028061|Ga0268314_1020666	Not Available	706
3300028139|Ga0268355_1013235	Not Available	564
3300028140|Ga0268334_1019883	Not Available	501
3300028143|Ga0268348_1011052	Not Available	658
3300028151|Ga0268308_1012689	Not Available	689
3300028152|Ga0268336_1021099	Not Available	569
3300028153|Ga0268320_1022371	Not Available	553
3300028248|Ga0268312_1011683	Not Available	728
3300028248|Ga0268312_1028166	Not Available	557
3300028469|Ga0268337_1019381	Not Available	507
3300028471|Ga0268323_1007554	Not Available	688
3300028474|Ga0268331_1019012	Not Available	571
3300028476|Ga0268329_1025738	Not Available	526
3300028477|Ga0268309_1011397	Not Available	608
3300032464|Ga0214492_1020595	Not Available	1220
3300032465|Ga0214493_1125636	Not Available	602
3300032465|Ga0214493_1157014	Not Available	525
3300032466|Ga0214503_1278035	Not Available	516
3300032514|Ga0214502_1135917	Not Available	943
3300032514|Ga0214502_1142361	Not Available	920
3300032550|Ga0321340_1029734	Not Available	775
3300032551|Ga0321339_1114382	Not Available	609
3300032757|Ga0314753_1038853	Not Available	865
3300032812|Ga0314745_1016089	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1474
3300032826|Ga0314732_128802	Not Available	532
3300032890|Ga0314747_1050533	Not Available	611
3300033526|Ga0314761_1030387	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1154
3300033538|Ga0314755_1150610	Not Available	592

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	94.83%
Environmental	Environmental	5.17%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	94.83%
Terrestrial	Environmental → Terrestrial	5.17%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	78.45%
Unclassified	Host-Associated → Plants → Unclassified	7.76%
Soil	Environmental → Terrestrial → Soil	5.17%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.31%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.45%
Roots	Host-Associated → Plants → Roots	0.86%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	78.45%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	7.76%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	4.31%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.45%
Loam	Environmental → Terrestrial → Soil → Loam	0.86%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.86%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	78.45%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	7.76%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	4.31%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.31%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.45%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.86%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.86%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	61.21%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	17.24%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	7.76%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.31%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.45%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.59%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.86%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.86%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated
3300015273	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated
3300020223	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated
3300028471	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1	Host-Associated
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032550	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032826	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070688_1008425942	3300005365	Switchgrass Rhizosphere	MGWMNGIPWVDWHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0068859_1029068121	3300005617	Switchgrass Rhizosphere	MGWMNGIPCVDCHMLEARTDVVEEEGWEISILSQLRTELMCHLA*
Ga0068863_1009175362	3300005841	Switchgrass Rhizosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLWTELMCHLA*
Ga0068863_1024386092	3300005841	Switchgrass Rhizosphere	MGWMNGILWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0068860_1026265692	3300005843	Switchgrass Rhizosphere	MGWLNGIPWVDCHTLEARTIVVEQEGWEISILSQLRTE
Ga0105249_116694741	3300009553	Switchgrass Rhizosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISISSQLRTELMCHLA*
Ga0105137_1080611	3300009972	Switchgrass Associated	MGWMNGIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0105128_1049612	3300009976	Switchgrass Associated	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQLRTELMCHLA*
Ga0105133_1139951	3300009981	Switchgrass Associated	MMGWMNGILCVDCHTLEARTDVVEQEGWEISILSQLRTGLTCRLA*
Ga0105131_1228441	3300009989	Switchgrass Associated	MNGIPRVDCHTLEARTVVVEQEGWEISILSQLRTELMCHLA*
Ga0105131_1295091	3300009989	Switchgrass Associated	MRWMNGIPWVDCHALEARIIVVEQGGWEIAILSQLRTELMCHLA*
Ga0105132_1246561	3300009990	Switchgrass Associated	MGWMNGIPCVDCHMLEARTDVVEQEGWEMSILSQLRTELMCHLV*
Ga0105120_10048662	3300009992	Switchgrass Associated	MGWMNGILWVDCHVLEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0105126_10213801	3300009994	Switchgrass Associated	MGWMNGIPWVDCHTLEARTVVVEKEGWEISILSQLRTELMCHLA*
Ga0105139_10912061	3300009995	Switchgrass Associated	MKWMNGIPWVDCHALEARTIVVEQEGWEISILTQLRTELMCHLA*
Ga0134125_110275601	3300010371	Terrestrial Soil	MNGIPCVDCHMLEARTNVVEQEGWEISILSQLRTELM
Ga0134126_124471081	3300010396	Terrestrial Soil	MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLRTELMCHLA*
Ga0134126_128383012	3300010396	Terrestrial Soil	MGWMNGIPWVVCHALEAHTIVVEQGGWEIAILSQLRTKLMCHLT*
Ga0134122_112674721	3300010400	Terrestrial Soil	MNGIPWVDCHALEARTIVVEQGGWEIAIMSQLRTEL
Ga0134121_125502461	3300010401	Terrestrial Soil	MGWMNGIPWVDCHALEVQTIVVEQGGLEIVILSQLRTELMCHLD*
Ga0163163_133487901	3300014325	Switchgrass Rhizosphere	MGWMNGILCVDCHMLEARTDVVEQEGWEISILSQLRTELMCHLA*
Ga0157380_110822902	3300014326	Switchgrass Rhizosphere	MGWMNGIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLS*
Ga0157380_120249501	3300014326	Switchgrass Rhizosphere	MGWMNGIPWVDCHTLEACTVVVEQEGWEISILSQLRTELMCHLA*
Ga0157379_113869442	3300014968	Switchgrass Rhizosphere	MGWMNGIPWVDCHVLEARTVVVEQEGWEISILSQLRTELMCHLA*
Ga0182183_10321311	3300015270	Switchgrass Phyllosphere	MGCMNGIPCVDCHMLEARTDVVEQEGWETYILSQLRTELMRHLA*
Ga0182183_10896911	3300015270	Switchgrass Phyllosphere	NIKMGWMNGIPWKDCHASEARTVVVEQEGWEISIMSQLRTELMCHLA*
Ga0182102_10221991	3300015273	Switchgrass Phyllosphere	MNGIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182102_10253292	3300015273	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEIVIAIN*
Ga0182099_10166591	3300015278	Switchgrass Phyllosphere	MGWMHGIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182099_10486341	3300015278	Switchgrass Phyllosphere	MGWMNGIPWEDCHASEARTVVVEQEGWEISILSQLRTELMCHLA*
Ga0182100_10026303	3300015280	Switchgrass Phyllosphere	MGSMNGIPWVDCHTLEARTVVVEQEGWEISILSQLRTELMCHLA*
Ga0182100_10354831	3300015280	Switchgrass Phyllosphere	MGWMNGISWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182103_10970721	3300015293	Switchgrass Phyllosphere	MGWMIGIPWVDCHALDARTIVVEQEGWEIFILSQLRTELMCHRA*
Ga0182104_11002281	3300015297	Switchgrass Phyllosphere	MGWMNGIPWVDCHALEARTIVVEQRGWEIAILSQLRTELMCHLA*
Ga0182184_10342591	3300015301	Switchgrass Phyllosphere	MGWTNGISVYIAVLEARTVVVEQGGWEISISSKLRTELMCHLA*
Ga0182184_10575221	3300015301	Switchgrass Phyllosphere	MGWMNDIPCVDCHMLEARADVVEQEGWEISILSQLRTELMCHLA*
Ga0182180_10174121	3300015306	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEAHTIVIEQEGWEISILSQLRTELMCHLA*
Ga0182182_10121361	3300015311	Switchgrass Phyllosphere	VKMGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLWTELMCHLA*
Ga0182168_10529621	3300015312	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLWTELMCHLA
Ga0182164_10091861	3300015313	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISIVSQLWTELMCHLA*
Ga0182164_10889871	3300015313	Switchgrass Phyllosphere	MGWMNGIPCVECHMLEARTDVVEQEGWEISISSQLRTELMCHLV*
Ga0182164_11222731	3300015313	Switchgrass Phyllosphere	MGWMNGIPWKDCHASEARTIVVEQEGWEISIQSQLRTELMCHLA*
Ga0182121_10457751	3300015316	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEAHTVVVEQEGWEISILSQLRTELMCHLA*
Ga0182181_10291552	3300015318	Switchgrass Phyllosphere	MGSMNGIPWVDCHTLEARTVAVEQEGWEISIVSQLWTELMCHLA*
Ga0182130_10568012	3300015319	Switchgrass Phyllosphere	MGWMNGIPYVDCHMLEARTDVVEQEGWDTELMCHLA*
Ga0182130_11022931	3300015319	Switchgrass Phyllosphere	EDCHVSEASTVVVEQEGCEISILSQLRTELMCHLA*
Ga0182165_10997581	3300015320	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILLQLRTELMCHLA*
Ga0182148_10744711	3300015325	Switchgrass Phyllosphere	MNCIPWVDCHVLEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182148_11166671	3300015325	Switchgrass Phyllosphere	MGWLNGIPWVDCHTLDARTIVVEQEGWEISILSQLRTELMCHLV*
Ga0182148_11365142	3300015325	Switchgrass Phyllosphere	MNGIPWVDCHALEARTIVVEQGGWEIATLLQLRTELMC
Ga0182114_11536191	3300015327	Switchgrass Phyllosphere	MGWMNDIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182131_10960741	3300015331	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQL
Ga0182117_11199081	3300015332	Switchgrass Phyllosphere	GWMNGIPCVDCHMLEARADVVEQEGWEISILSQLRTELMCHLA*
Ga0182132_11382112	3300015334	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTNVVEQEGWEISILSQLRTELMCHLA*
Ga0182116_11729581	3300015335	Switchgrass Phyllosphere	MGWMNGITCVDCHMLEARTDVVEQEGWEISILSQLRTELMCHLA*
Ga0182150_10600842	3300015336	Switchgrass Phyllosphere	MGWMTGIYCVDCHMLEARTDVVEQEGWEISILSQLRTELMCHLT*
Ga0182149_10501611	3300015339	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLRTELMCYLA*
Ga0182149_10858111	3300015339	Switchgrass Phyllosphere	VDCHTLEAHTVVVEQEGWEISILSQLRTELMCHLA*
Ga0182149_11048791	3300015339	Switchgrass Phyllosphere	NCIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182115_11077441	3300015348	Switchgrass Phyllosphere	DCHTLEARTVVVEQEGWEISILSQLWTELMCHLA*
Ga0182115_12058331	3300015348	Switchgrass Phyllosphere	MNGILWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182185_12115551	3300015349	Switchgrass Phyllosphere	MGWMDGILWVDCHALEARTVVVEQEGWEISILSQLKTELMCHLV*
Ga0182163_11338411	3300015350	Switchgrass Phyllosphere	NGILWVDCHALEARTVVVEQEGWEISILSQLKTELMCHLV*
Ga0182163_12282751	3300015350	Switchgrass Phyllosphere	MGLMNDIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA*
Ga0182169_11856751	3300015352	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLR
Ga0182169_12700861	3300015352	Switchgrass Phyllosphere	MGWMNGIYWVDCHALEALTVVVEQEGWEISILSQLRTELMCHLA*
Ga0182167_11877531	3300015354	Switchgrass Phyllosphere	MGWTNDISVYIAVLEARTVVVEQGGWEISISSKLRTELMCHLA*
Ga0182201_10876851	3300017422	Switchgrass Phyllosphere	MGWMNGIPWVDCHTLEARTIVVEQGGWEIAILSQLRTELMCHLT
Ga0182196_11253441	3300017432	Switchgrass Phyllosphere	MGWMDGILWVDCHALEARTVVVEQEGWEISILSQLKTELMCHLV
Ga0182196_11268241	3300017432	Switchgrass Phyllosphere	MMGWMNDIPWVDCRALEARTVVIEQEGWEISILSQQMTELMCHLA
Ga0182196_11391382	3300017432	Switchgrass Phyllosphere	MGWMNVIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA
Ga0182200_10581242	3300017439	Switchgrass Phyllosphere	MGWMNGIPWVDCHALEVRTIVVEQGGLEIAILSQLRTELMCHLV
Ga0182200_10788112	3300017439	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTVVVEPEGWEICILSQLR
Ga0182215_11346421	3300017447	Switchgrass Phyllosphere	MGWMIGIPWVDCHALEARTVVVEQEGWEIFILSQLRTELMCHLA
Ga0182212_10682851	3300017691	Switchgrass Phyllosphere	MEWMIGIPWVDCHALEARTIVVEQGGWEIAILSQLRTKLMCHLA
Ga0182210_11545361	3300017692	Switchgrass Phyllosphere	MGWMNDIPWVDCHALEARTVVVEQEGWEISILAQLRTELMCHLA
Ga0182211_10708261	3300017694	Switchgrass Phyllosphere	MGWMNDIPWVGCHALEARTVVVEQEGWEISILSKLRTELMCYLA
Ga0182211_10865651	3300017694	Switchgrass Phyllosphere	MNGIPWVDSHALEARTIVVEQGGWEIAILSQLRTELMCHLA
Ga0182211_11244281	3300017694	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTGVVEQEGWEISILSQLRTELMCHLA
Ga0163161_109923452	3300017792	Switchgrass Rhizosphere	MGWMNGIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCYLA
Ga0182178_10140381	3300020023	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQLRTELMCHLA
Ga0182118_1119811	3300020223	Switchgrass Phyllosphere	MGWMNGIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA
Ga0268322_10306332	3300028049	Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQLRT
Ga0268322_10364331	3300028049	Phyllosphere	MEWMNGIPGVDCHMLEARTDVVEQEGWEISILSQLRTELMYHLA
Ga0268328_10091981	3300028050	Phyllosphere	NVIPWVDCHTLEARTVVVEQEGWEISIVSQLWTELMCHLA
Ga0268328_10652931	3300028050	Phyllosphere	MGWMNGIPWVDCHTLEAHTVVVEQEGWEISILSQLRTELMCHLA
Ga0268346_10147911	3300028053	Phyllosphere	MGWMIGIPWVDCHALEARTVGVEQEGWEIAILSQLRTELMCHLA
Ga0268330_10142531	3300028056	Phyllosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISIVSQLWTELMCHLA
Ga0268314_10206661	3300028061	Phyllosphere	MNGIPWVDCHTLEARTVVVEQEGWEISIVSQLWTELMCHLA
Ga0268355_10132352	3300028139	Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQLRTE
Ga0268334_10198831	3300028140	Phyllosphere	MGWMNGIPWVDCHALEACTIVVEQGDWEIAILSQLRTELMCHLA
Ga0268348_10110522	3300028143	Phyllosphere	MGWVNGILWVDCHALEARTIVVEQGGWEIAILSQLRTKLMCHLA
Ga0268308_10126892	3300028151	Phyllosphere	MGWMNGIPWVDCHTLDARTVVVEQEGWEISIVSQLWTELMCHLA
Ga0268336_10210991	3300028152	Phyllosphere	MGWMTGIYCVDCHMLEARTDVVEQEGWEISILSQLRTELMCHLA
Ga0268320_10223712	3300028153	Phyllosphere	MGWMNGISWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA
Ga0268312_10116831	3300028248	Phyllosphere	MGWMNGIPWVDCHTLEAHTVVVEQEGWEISILSQLRTKLICHLA
Ga0268312_10281662	3300028248	Phyllosphere	MGWMNGIPWVDCHVLGARTIVVEREGWEISILSQLRTELMCHLA
Ga0268337_10193811	3300028469	Phyllosphere	MGWMNGIPWVDCHTLEACTVVVEQEGWEISILSQLRTELMCHLA
Ga0268323_10075541	3300028471	Phyllosphere	MGWMNGIPWVDCHTLEARTVVVEQEGWEISILSQLRTELMCHLA
Ga0268331_10190121	3300028474	Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQLRTELTCHL
Ga0268329_10257381	3300028476	Phyllosphere	KEKNVKMRWMNGIPCVDCHILEARTDVVEQEGWEISILSQLRTELMCHLA
Ga0268309_10113971	3300028477	Phyllosphere	MGWMNGIPWKDCHASEARTIVVEQEGWEISILSQLRTELMCHLA
Ga0214492_10205951	3300032464	Switchgrass Phyllosphere	MGWMNGIPWEDCHASEARTVVVEQEGWEISILSQLRTELMCHLA
Ga0214493_11256361	3300032465	Switchgrass Phyllosphere	MGWMNGILWVDCHVLEARTIVVEQGGWEIAILSQLRIELMCHLA
Ga0214493_11570141	3300032465	Switchgrass Phyllosphere	MGWMNSIPRVDCHALEARTVVVEKEGWEISILSQLRTELMCHLT
Ga0214503_12780351	3300032466	Switchgrass Phyllosphere	GWMNGIYWVDCHALEALTVVVEQEGWEISILSQLRTELMCHLA
Ga0214502_11359171	3300032514	Switchgrass Phyllosphere	MNGIPWVDCHVLEARTIVVEQGGWEIAILSQLRTELMCHLT
Ga0214502_11423611	3300032514	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEDWEISILSQLRTELMCHLA
Ga0321340_10297341	3300032550	Switchgrass Phyllosphere	MGWMNGIPSVDCHALEARNVVVEQEGWEISILSQLRTELMCHLA
Ga0321339_11143821	3300032551	Switchgrass Phyllosphere	MGWMNGIPCVDCHMLEARTDVVEQEGWEISILSQLRTKLMCHLA
Ga0314753_10388531	3300032757	Switchgrass Phyllosphere	MGWMNSIPRVDCHALEARTVVVEKEGWEISILSQLRTELMCHLG
Ga0314745_10160891	3300032812	Switchgrass Phyllosphere	MGWMNGIPWEDCHASEARTVVVEQESWEISILSQLRTELMCHLA
Ga0314732_1288021	3300032826	Switchgrass Phyllosphere	MGWMNSIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA
Ga0314747_10505332	3300032890	Switchgrass Phyllosphere	MGWMNGIPWEDCHASEARTVVVEQEGWEISILSQLSTELMWHFA
Ga0314761_10303871	3300033526	Switchgrass Phyllosphere	VKMGWMNGIPWEDCHASDARTVVVEQEGWEISILSQLRTELMCHLA
Ga0314755_11506101	3300033538	Switchgrass Phyllosphere	MGWMNGIPWEDCHASEARTVVVEQEGWEISILSQLSTELMCHLA