NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077982

Metagenome / Metatranscriptome Family F077982

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077982
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 51 residues
Representative Sequence AGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK
Number of Associated Samples 111
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 99.15 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.145 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(12.821 % of family members)
Environment Ontology (ENVO) Unclassified
(39.316 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.171 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.87%    β-sheet: 0.00%    Coil/Unstructured: 70.13%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF09587PGA_cap 95.73
PF00890FAD_binding_2 0.85



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.15 %
UnclassifiedrootN/A0.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17067153All Organisms → cellular organisms → Bacteria → Proteobacteria1005Open in IMG/M
3300000043|ARcpr5yngRDRAFT_c026313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300000550|F24TB_10787437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1113Open in IMG/M
3300000550|F24TB_10862667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1104Open in IMG/M
3300000550|F24TB_12038710All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1264Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10031169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1249Open in IMG/M
3300000955|JGI1027J12803_100897914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1203Open in IMG/M
3300001372|YBBDRAFT_1278759All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300002459|JGI24751J29686_10069020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium728Open in IMG/M
3300003998|Ga0055472_10134238All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium723Open in IMG/M
3300004009|Ga0055437_10220079All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300004047|Ga0055499_10089001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300004114|Ga0062593_101410051All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300004145|Ga0055489_10075023All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300004148|Ga0055521_10139021All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300004156|Ga0062589_101893626All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300004463|Ga0063356_102866008All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300004463|Ga0063356_104386982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leucobacter → Leucobacter chromiiresistens607Open in IMG/M
3300005218|Ga0068996_10084751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300005289|Ga0065704_10219092All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1080Open in IMG/M
3300005295|Ga0065707_10777834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300005327|Ga0070658_10150798All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1946Open in IMG/M
3300005340|Ga0070689_100577651All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium971Open in IMG/M
3300005343|Ga0070687_100198453All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1214Open in IMG/M
3300005354|Ga0070675_100297375All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1421Open in IMG/M
3300005354|Ga0070675_100972559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium779Open in IMG/M
3300005366|Ga0070659_101372879All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300005367|Ga0070667_101005609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium778Open in IMG/M
3300005441|Ga0070700_101348479All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300005445|Ga0070708_102277661All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300005458|Ga0070681_11533269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium591Open in IMG/M
3300005467|Ga0070706_101549681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300005518|Ga0070699_101804597All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300005563|Ga0068855_101898818All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300005615|Ga0070702_101866032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300005616|Ga0068852_102192570All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300005713|Ga0066905_101246562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300005718|Ga0068866_10394009All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium891Open in IMG/M
3300006572|Ga0074051_10736280All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300006845|Ga0075421_100452108All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300006846|Ga0075430_101118996All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300006954|Ga0079219_10562013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300006969|Ga0075419_10761795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300007004|Ga0079218_12746518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium588Open in IMG/M
3300009094|Ga0111539_10812457All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1088Open in IMG/M
3300009111|Ga0115026_11170231All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium625Open in IMG/M
3300009171|Ga0105101_10533616All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300009545|Ga0105237_10632445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1077Open in IMG/M
3300009678|Ga0105252_10092681All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1203Open in IMG/M
3300010043|Ga0126380_11439969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300010046|Ga0126384_11094388All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300010047|Ga0126382_12049252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300010336|Ga0134071_10098867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1384Open in IMG/M
3300010371|Ga0134125_11510299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300010375|Ga0105239_13039210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300010400|Ga0134122_10456797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1144Open in IMG/M
3300010403|Ga0134123_12862689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300011406|Ga0137454_1031659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium774Open in IMG/M
3300011423|Ga0137436_1186700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300011430|Ga0137423_1263330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300011435|Ga0137426_1187356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium616Open in IMG/M
3300011438|Ga0137451_1150170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium729Open in IMG/M
3300011439|Ga0137432_1142305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium768Open in IMG/M
3300012022|Ga0120191_10150627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium531Open in IMG/M
3300012038|Ga0137431_1197614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium569Open in IMG/M
3300012172|Ga0137320_1112439All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium581Open in IMG/M
3300012175|Ga0137321_1087500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M
3300012200|Ga0137382_10236116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1264Open in IMG/M
3300012227|Ga0137449_1155450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300012360|Ga0137375_10140758All Organisms → cellular organisms → Bacteria → Proteobacteria2373Open in IMG/M
3300012362|Ga0137361_11231070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium672Open in IMG/M
3300012506|Ga0157324_1016891All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300012514|Ga0157330_1080315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300012515|Ga0157338_1002049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1537Open in IMG/M
3300012929|Ga0137404_10724747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium900Open in IMG/M
3300012930|Ga0137407_10697915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium956Open in IMG/M
3300012948|Ga0126375_11736419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300012987|Ga0164307_10273022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1192Open in IMG/M
3300012988|Ga0164306_10138887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1642Open in IMG/M
3300012989|Ga0164305_12082781All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300014262|Ga0075301_1157947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300014299|Ga0075303_1095058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300014865|Ga0180078_1035328All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium804Open in IMG/M
3300014868|Ga0180088_1004838All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1831Open in IMG/M
3300014868|Ga0180088_1101713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium521Open in IMG/M
3300014883|Ga0180086_1211706All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium501Open in IMG/M
3300014968|Ga0157379_10247735All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Propylenellaceae → Propylenella → Propylenella binzhouense1617Open in IMG/M
3300015241|Ga0137418_10681427All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium792Open in IMG/M
3300015373|Ga0132257_101163883All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium975Open in IMG/M
3300015374|Ga0132255_104146245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300018053|Ga0184626_10147164All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1002Open in IMG/M
3300018056|Ga0184623_10141601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1112Open in IMG/M
3300018061|Ga0184619_10448803All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300018076|Ga0184609_10543269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium525Open in IMG/M
3300018469|Ga0190270_10756796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium972Open in IMG/M
3300020027|Ga0193752_1147805All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium926Open in IMG/M
3300020583|Ga0210401_10223653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1741Open in IMG/M
3300021432|Ga0210384_11873497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300022534|Ga0224452_1261819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300025315|Ga0207697_10135081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1067Open in IMG/M
3300025315|Ga0207697_10225068Not Available828Open in IMG/M
3300025939|Ga0207665_11379560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300025959|Ga0210116_1065368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300025961|Ga0207712_11367687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium633Open in IMG/M
3300027722|Ga0209819_10322084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300027815|Ga0209726_10094199All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1836Open in IMG/M
3300027831|Ga0209797_10047003All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1931Open in IMG/M
3300027907|Ga0207428_10157875All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1724Open in IMG/M
3300027909|Ga0209382_10546071All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1270Open in IMG/M
3300031231|Ga0170824_126267560All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium691Open in IMG/M
3300031740|Ga0307468_101512774All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium623Open in IMG/M
3300031820|Ga0307473_11100315All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300032174|Ga0307470_10113711All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1582Open in IMG/M
3300032782|Ga0335082_11085922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium666Open in IMG/M
3300032893|Ga0335069_11155552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium850Open in IMG/M
3300034148|Ga0364927_0112088All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium765Open in IMG/M
3300034150|Ga0364933_152429All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium598Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil12.82%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.13%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.13%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.56%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.56%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.71%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.71%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.71%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.85%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.85%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.85%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000043Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphereHost-AssociatedOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004009Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004148Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012172Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2EnvironmentalOpen in IMG/M
3300012175Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012227Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2EnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012506Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610Host-AssociatedOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012515Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610Host-AssociatedOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020027Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025959Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_031414302088090014SoilTDVVSPLMKQAPPKMKVVPLPMTLATRYNEYFQTYRKVMGLK
ARcpr5yngRDRAFT_02631313300000043Arabidopsis RhizosphereDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
F24TB_1078743713300000550SoilLSREGQEILAAVGYYAPRTDVVSPLMKQAPPKMKVVPLPMMLAIRYNEYFQTYRKVMGLK
F24TB_1086266713300000550SoilLLSREGQEVLAAVGYYAPRTDVVSPLMKQAPPKMKVVPLPMMLATRYNEYFQMYRKVMGLK*
F24TB_1203871023300000550SoilPILKEAPAKTKIVPLPMTLASRYNEYFETYRKVMGLR*
AF_2010_repII_A001DRAFT_1003116923300000793Forest SoilVGYYAPRTDVVSPLMKQVPAKIKVLPLPMMLATRYNEYFQTYGKVMGLK*
JGI1027J12803_10089791413300000955SoilPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
YBBDRAFT_127875913300001372Marine EstuarineARLFNDFILSREGQELTAAAGYYAPRTDVTSPILKEAPPKTKIIPLAMTLAPRYNEYFQTYRKIMGLK*
JGI24751J29686_1006902013300002459Corn, Switchgrass And Miscanthus RhizosphereVDFLLSREGQEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0055472_1013423823300003998Natural And Restored WetlandsILSREGQEILAAVGYYAPRTDVVSPLMKQAPPNMKVVPLPMTLATRYNEYFQTYRKLMGLK*
Ga0055437_1022007913300004009Natural And Restored WetlandsAASGYYVPRTDVSSPILREAPPKTKVIPLPMTLAPRYSEYYQTYRRVMGLK*
Ga0055499_1008900113300004047Natural And Restored WetlandsAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0062593_10141005123300004114SoilFLLSREGQELTAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0055489_1007502313300004145Natural And Restored WetlandsAAGYYVPRSDVASPILKEAPAKTKVLPLPMALAARYNEYFQTYRKLMGLK*
Ga0055521_1013902113300004148Natural And Restored WetlandsPNAARLFNDFLLSRDGQELTAAAGYYAPRTDVTSPILKEAPPNTKIIPLAMTLAPRYNEYFQIYRKIMGLK*
Ga0062589_10189362623300004156SoilEGQELTAAAGYYVPRTDVASPILKEAPPRTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0063356_10286600813300004463Arabidopsis Thaliana RhizosphereARLLNDFLLSREGQELTAAAGYYVPRTDVASPILKEAPPRTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0063356_10438698213300004463Arabidopsis Thaliana RhizosphereLFHDFLLSREGQEVIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0068996_1008475123300005218Natural And Restored WetlandsREGQELTAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0065704_1021909223300005289Switchgrass RhizosphereGAAGYFAPRTDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0065707_1077783413300005295Switchgrass RhizosphereFNDFLLSREGQEAIAADGYYVPRLDVLSPILKEAPPKTKVIPLPMTLAPRYNEYYQTYRKLMGLK*
Ga0070658_1015079813300005327Corn RhizospherePRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0070689_10057765113300005340Switchgrass RhizosphereQEVIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0070687_10019845313300005343Switchgrass RhizosphereEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0070675_10029737523300005354Miscanthus RhizosphereYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0070675_10097255913300005354Miscanthus RhizosphereYVPRTDVASPILKEAPPRTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0070659_10137287923300005366Corn RhizosphereSAAHLFVDFLLSHEGQEILGAAGYFAPRSDVISPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP*
Ga0070667_10100560933300005367Switchgrass RhizosphereLFVDFLLSHEGQEILGAAGYFAPRSDVISPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP*
Ga0070700_10134847923300005441Corn, Switchgrass And Miscanthus RhizosphereILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0070708_10227766113300005445Corn, Switchgrass And Miscanthus RhizosphereGQEILASVGYYAPRTDVVSPLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK*
Ga0070681_1153326913300005458Corn RhizosphereRTDVASPILKEAAPKTKVIPLPMTLASRYNEYYQTYRKVMGLK*
Ga0070706_10154968123300005467Corn, Switchgrass And Miscanthus RhizosphereDFLLSREGQEVFAAAGYFSPRSDVSSPILKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0070699_10180459713300005518Corn, Switchgrass And Miscanthus RhizospherePRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0068855_10189881823300005563Corn RhizosphereKEAPAGTKIVPLPMNLAPRYNEYFQTYRKVMGLR*
Ga0070702_10186603213300005615Corn, Switchgrass And Miscanthus RhizosphereVIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLASRYNEYYQTYRKVMGLK*
Ga0068852_10219257013300005616Corn RhizosphereQEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0066905_10124656223300005713Tropical Forest SoilLMKQAPPKMKVVPLPMMLATRYNEYFQIYRKVMGLK*
Ga0068866_1039400923300005718Miscanthus RhizosphereIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0074051_1073628013300006572SoilTAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0075421_10045210823300006845Populus RhizosphereRLLVDFLLSREGQEILGAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0075430_10111899613300006846Populus RhizosphereDVASPILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0079219_1056201313300006954Agricultural SoilLSEAPPKTKIVPLPMSLAPRYGEYFQTYRKIMGLR*
Ga0075419_1076179523300006969Populus RhizosphereLSREGQEILGAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK
Ga0079218_1274651813300007004Agricultural SoilTDVASPILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGRK*
Ga0111539_1081245723300009094Populus RhizosphereILKDAAPKTKVIPLPMRMAPRYNEYYQTYRRLMGLK*
Ga0115026_1117023123300009111WetlandAAGYYAPRTDVASPILKETPAKTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0105101_1053361623300009171Freshwater SedimentAGYYVPRTDVTSPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKLMGLK*
Ga0105237_1063244523300009545Corn RhizosphereFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0105252_1009268123300009678SoilYAPRTDVASPILKETPAKTKILPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0126380_1143996923300010043Tropical Forest SoilRTDVVSPLMKQVPAKIKVLSLPMMLATRYNEYFQTYGKVMGLK*
Ga0126384_1109438813300010046Tropical Forest SoilRTDVVSPLMKQVPAKMKVIPLPMTLASRYNEYFQTYRKVMGLK*
Ga0126382_1204925223300010047Tropical Forest SoilREGQEILAAVGYYAPRTDVVSPLMKQVPAKMKVIPLPMTLASRYNEYFQTYRKVMGLK*
Ga0134071_1009886713300010336Grasslands SoilLKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGL*
Ga0134125_1151029913300010371Terrestrial SoilISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0105239_1303921023300010375Corn RhizosphereREGQEILAAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0134122_1045679713300010400Terrestrial SoilGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0134123_1286268913300010403Terrestrial SoilPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP*
Ga0137454_103165913300011406SoilLLSREGQEAIAADGYYVPRSDVLSAILKEAPPKTKVVPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0137436_118670023300011423SoilYFVPRTDVASPILKETPAKTKIVPLPMSLAPRYNEYFQSYRKLMGLK*
Ga0137423_126333023300011430SoilAAGYYVPRTDVASPILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0137426_118735613300011435SoilQEILAAVGYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKLMGLK*
Ga0137451_115017013300011438SoilNDYLLSREGQEVIAAAGYHVPRTDVASPILKDAAPKTRVVPLPMSLAPRYNEYFQTYRKVMGLK*
Ga0137432_114230513300011439SoilDFILSREGQEILAAVGYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKVMGLK*
Ga0120191_1015062723300012022TerrestrialLMKQAAPKMKVLPLPMMLATRYNEYFQMYRKVMGLK*
Ga0137431_119761423300012038SoilYVPRRDVAAPIMKQVPPKMKVIPLPMSLAARYSEYFQTYRKLMGLK*
Ga0137320_111243913300012172SoilSREGQEAIAADGYYVPRLDVLSPILKEAPAKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0137321_108750023300012175SoilVPRTDVASPILREAPAKTKVIPLPMTLAPRYNEYYQTYRKVMGLK*
Ga0137382_1023611623300012200Vadose Zone SoilGYFAPRTDISSPILSEATPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0137449_115545023300012227SoilSREGQEIIAAAGYFVPRTDVASPILKETPAKTKIVPLPMSLAPRYNEYFQSYRKLMGLK*
Ga0137375_1014075813300012360Vadose Zone SoilAAAGYFSPRSDVSSPILKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGLR*
Ga0137361_1123107023300012362Vadose Zone SoilEGQEILASVGYYAPRTDVVSPLMKQAPPQIKVIPLPMTMASRYDEYFQLYRKVMGLK*
Ga0157324_101689113300012506Arabidopsis RhizosphereAAGYFAPRTDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0157330_108031513300012514SoilGQEILGAAGYFAPRTDVISPILSEAPPKTKIVPLPMSLAPRYGEYFQT*
Ga0157338_100204913300012515Arabidopsis RhizosphereGYFAPRTDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0137404_1072474723300012929Vadose Zone SoilLAAAGYYAPRTDVISPLMKQAPAKMKVFPLPMMLATRYNEYFQTYRKVMGLK*
Ga0137407_1069791523300012930Vadose Zone SoilGQEVFAAAGYFSPRSDVSSPILKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0126375_1173641923300012948Tropical Forest SoilAVGYYAPRTDVVTPLMKQVPPKIKVIPLPMALATRYNEYFQTYRKVMGLK*
Ga0164307_1027302223300012987SoilSPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP*
Ga0164306_1013888723300012988SoilAARLFVDFLLSHEGQEILGAAGYFAPRSDVISPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP*
Ga0164305_1208278113300012989SoilLSREGQEILASVGYYAPRTDVVSPLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK
Ga0075301_115794713300014262Natural And Restored WetlandsIAASGYYVPRTDVASPILREAPPKTKVLPLPMTLAPRYTEYFQTYRKVMGLK*
Ga0075303_109505813300014299Natural And Restored WetlandsVLAASGYYVPRTDVSSPILREAPPKTKVIPLPMTLAPRYSEYYQTYRRVMGLK*
Ga0180078_103532823300014865SoilYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKLMGLK*
Ga0180088_100483833300014868SoilYVPRRDVAAPIMKQVPAKMKVIPLPMSLASRYNEYFQTYRKLMGLK*
Ga0180088_110171323300014868SoilEILAAVGYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKLMGLK*
Ga0180086_121170623300014883SoilYFVPRTDVASPILKETPAKTKIIPLPMSLAPRYNEYFQSYRKLMGLK*
Ga0157379_1024773513300014968Switchgrass RhizosphereTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR*
Ga0137418_1068142723300015241Vadose Zone SoilFAPRTDISSPILSEATPKTKIVPLPMTLASRYNEYFQTYRKVMGLK*
Ga0132257_10116388323300015373Arabidopsis RhizosphereHEGQEILGAAGYFPPRTDVISPILSETPPKTKIVPLPMSLAPRYGEHFQTYRKIMGLR*
Ga0132255_10414624523300015374Arabidopsis RhizosphereAGYFAPRTDVISPILSEAPPKMKIVPLPMSLAPRYGEYFQTYRKIMGLR*
Ga0184626_1014716423300018053Groundwater SedimentGQEIIAEAGYYVPRRDVAAPIMKQVPAKMKVIPLPMSLAPRYNEYFQTYRKLMGLK
Ga0184623_1014160123300018056Groundwater SedimentLKEAPPKTKVVPLPMTLAPRYNEYFQTYRKIMKLK
Ga0184619_1044880313300018061Groundwater SedimentGQEVIAGAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK
Ga0184609_1054326923300018076Groundwater SedimentLMKQAPPKIKVVPLPMTLATRYNEYFQMYRKVMGLK
Ga0190270_1075679623300018469SoilARLFNDFLLSREGQEITAAAGYFVPRTDVASPILKETPAKTKIIPLPMTLAPRYNEYFQNYRKLMGLK
Ga0193752_114780523300020027SoilYYVPRTDVASPILKEAAPKTKVIPLPMTLASRYNEYYQTYRKVMGLK
Ga0210401_1022365323300020583SoilIDFMLSREGQEAMGISGYFVPRSDVSSPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK
Ga0210384_1187349713300021432SoilPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK
Ga0224452_126181923300022534Groundwater SedimentQEVIASAGYYSPRADVTSPILKEAPARTKIVPLPMTLASRYNEYFQSYRKVMGLR
Ga0207697_1013508123300025315Corn, Switchgrass And Miscanthus RhizosphereGQEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR
Ga0207697_1022506823300025315Corn, Switchgrass And Miscanthus RhizosphereLGAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK
Ga0207665_1137956023300025939Corn, Switchgrass And Miscanthus RhizospherePLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK
Ga0210116_106536823300025959Natural And Restored WetlandsAAGYYVPRSDVASPILKEAPAKTKVLPLPMALAARYNEYFQTYRKLMGLK
Ga0207712_1136768723300025961Switchgrass RhizospherePRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK
Ga0209819_1032208423300027722Freshwater SedimentYAPRTDVVSPLMKQAPAKMKVVPLPMTLATRYNEYFQTYRKVMGLK
Ga0209726_1009419913300027815GroundwaterIAAAGYHVPRADVASPILKEAPAKTKVIPLPMSMAPRYNEYYQTYRKVMGLK
Ga0209797_1004700333300027831Wetland SedimentFNDFLLSREGQEITAAAGYFVPRSDVVSPILRETPAKTKVLPLPMSLAPRYNEYFQTYRKLMGLK
Ga0207428_1015787523300027907Populus RhizosphereAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK
Ga0209382_1054607113300027909Populus RhizosphereILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK
Ga0170824_12626756013300031231Forest SoilFAPRTDVSSPILSEAPPKLKIVPLPMTLASRYNEYFQTYRKVMGLK
Ga0307468_10151277423300031740Hardwood Forest SoilEGQEVMGISGYFVPRSDVSSPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK
Ga0307473_1110031523300031820Hardwood Forest SoilRTDVVSPLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK
Ga0307470_1011371123300032174Hardwood Forest SoilREGQEVMGISGYFVPRSDVSSPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK
Ga0335082_1108592223300032782SoilSVGYYAPRSDVVSPLMKQAPPKTKVIPLPMMMASRYDEYFQLYRKVMGLK
Ga0335069_1115555213300032893SoilLSREGQEAMGVSGYYVPRTDVASPILQEAPPKTKVIPLPMTLAPRYNEYFQTFRKVMGLK
Ga0364927_0112088_654_7643300034148SedimentILKETPAKTKILPLPMSLAPRYNEYFQTYRKVMGLK
Ga0364933_152429_458_5953300034150SedimentVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.