Basic Information | |
---|---|
Family ID | F077982 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 51 residues |
Representative Sequence | AGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.15 % |
% of genes from short scaffolds (< 2000 bps) | 99.15 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.145 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (12.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.316 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.171 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.87% β-sheet: 0.00% Coil/Unstructured: 70.13% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF09587 | PGA_cap | 95.73 |
PF00890 | FAD_binding_2 | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.15 % |
Unclassified | root | N/A | 0.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_17067153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1005 | Open in IMG/M |
3300000043|ARcpr5yngRDRAFT_c026313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300000550|F24TB_10787437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1113 | Open in IMG/M |
3300000550|F24TB_10862667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1104 | Open in IMG/M |
3300000550|F24TB_12038710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1264 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10031169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1249 | Open in IMG/M |
3300000955|JGI1027J12803_100897914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1203 | Open in IMG/M |
3300001372|YBBDRAFT_1278759 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300002459|JGI24751J29686_10069020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 728 | Open in IMG/M |
3300003998|Ga0055472_10134238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 723 | Open in IMG/M |
3300004009|Ga0055437_10220079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
3300004047|Ga0055499_10089001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
3300004114|Ga0062593_101410051 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300004145|Ga0055489_10075023 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
3300004148|Ga0055521_10139021 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300004156|Ga0062589_101893626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
3300004463|Ga0063356_102866008 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
3300004463|Ga0063356_104386982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Leucobacter → Leucobacter chromiiresistens | 607 | Open in IMG/M |
3300005218|Ga0068996_10084751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
3300005289|Ga0065704_10219092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1080 | Open in IMG/M |
3300005295|Ga0065707_10777834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
3300005327|Ga0070658_10150798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1946 | Open in IMG/M |
3300005340|Ga0070689_100577651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 971 | Open in IMG/M |
3300005343|Ga0070687_100198453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1214 | Open in IMG/M |
3300005354|Ga0070675_100297375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1421 | Open in IMG/M |
3300005354|Ga0070675_100972559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 779 | Open in IMG/M |
3300005366|Ga0070659_101372879 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
3300005367|Ga0070667_101005609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 778 | Open in IMG/M |
3300005441|Ga0070700_101348479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
3300005445|Ga0070708_102277661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
3300005458|Ga0070681_11533269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
3300005467|Ga0070706_101549681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
3300005518|Ga0070699_101804597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
3300005563|Ga0068855_101898818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 603 | Open in IMG/M |
3300005615|Ga0070702_101866032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
3300005616|Ga0068852_102192570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 574 | Open in IMG/M |
3300005713|Ga0066905_101246562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 667 | Open in IMG/M |
3300005718|Ga0068866_10394009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 891 | Open in IMG/M |
3300006572|Ga0074051_10736280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 543 | Open in IMG/M |
3300006845|Ga0075421_100452108 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300006846|Ga0075430_101118996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 649 | Open in IMG/M |
3300006954|Ga0079219_10562013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 821 | Open in IMG/M |
3300006969|Ga0075419_10761795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
3300007004|Ga0079218_12746518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 588 | Open in IMG/M |
3300009094|Ga0111539_10812457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1088 | Open in IMG/M |
3300009111|Ga0115026_11170231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300009171|Ga0105101_10533616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 578 | Open in IMG/M |
3300009545|Ga0105237_10632445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1077 | Open in IMG/M |
3300009678|Ga0105252_10092681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1203 | Open in IMG/M |
3300010043|Ga0126380_11439969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 607 | Open in IMG/M |
3300010046|Ga0126384_11094388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 730 | Open in IMG/M |
3300010047|Ga0126382_12049252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 546 | Open in IMG/M |
3300010336|Ga0134071_10098867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1384 | Open in IMG/M |
3300010371|Ga0134125_11510299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
3300010375|Ga0105239_13039210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 547 | Open in IMG/M |
3300010400|Ga0134122_10456797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1144 | Open in IMG/M |
3300010403|Ga0134123_12862689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 551 | Open in IMG/M |
3300011406|Ga0137454_1031659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300011423|Ga0137436_1186700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 548 | Open in IMG/M |
3300011430|Ga0137423_1263330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
3300011435|Ga0137426_1187356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 616 | Open in IMG/M |
3300011438|Ga0137451_1150170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
3300011439|Ga0137432_1142305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
3300012022|Ga0120191_10150627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300012038|Ga0137431_1197614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300012172|Ga0137320_1112439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 581 | Open in IMG/M |
3300012175|Ga0137321_1087500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
3300012200|Ga0137382_10236116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1264 | Open in IMG/M |
3300012227|Ga0137449_1155450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 503 | Open in IMG/M |
3300012360|Ga0137375_10140758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2373 | Open in IMG/M |
3300012362|Ga0137361_11231070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 672 | Open in IMG/M |
3300012506|Ga0157324_1016891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
3300012514|Ga0157330_1080315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
3300012515|Ga0157338_1002049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1537 | Open in IMG/M |
3300012929|Ga0137404_10724747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 900 | Open in IMG/M |
3300012930|Ga0137407_10697915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 956 | Open in IMG/M |
3300012948|Ga0126375_11736419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 542 | Open in IMG/M |
3300012987|Ga0164307_10273022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1192 | Open in IMG/M |
3300012988|Ga0164306_10138887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1642 | Open in IMG/M |
3300012989|Ga0164305_12082781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 520 | Open in IMG/M |
3300014262|Ga0075301_1157947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 532 | Open in IMG/M |
3300014299|Ga0075303_1095058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 572 | Open in IMG/M |
3300014865|Ga0180078_1035328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 804 | Open in IMG/M |
3300014868|Ga0180088_1004838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1831 | Open in IMG/M |
3300014868|Ga0180088_1101713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
3300014883|Ga0180086_1211706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 501 | Open in IMG/M |
3300014968|Ga0157379_10247735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Propylenellaceae → Propylenella → Propylenella binzhouense | 1617 | Open in IMG/M |
3300015241|Ga0137418_10681427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 792 | Open in IMG/M |
3300015373|Ga0132257_101163883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 975 | Open in IMG/M |
3300015374|Ga0132255_104146245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 615 | Open in IMG/M |
3300018053|Ga0184626_10147164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1002 | Open in IMG/M |
3300018056|Ga0184623_10141601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1112 | Open in IMG/M |
3300018061|Ga0184619_10448803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
3300018076|Ga0184609_10543269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300018469|Ga0190270_10756796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 972 | Open in IMG/M |
3300020027|Ga0193752_1147805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 926 | Open in IMG/M |
3300020583|Ga0210401_10223653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1741 | Open in IMG/M |
3300021432|Ga0210384_11873497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 505 | Open in IMG/M |
3300022534|Ga0224452_1261819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 529 | Open in IMG/M |
3300025315|Ga0207697_10135081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1067 | Open in IMG/M |
3300025315|Ga0207697_10225068 | Not Available | 828 | Open in IMG/M |
3300025939|Ga0207665_11379560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 561 | Open in IMG/M |
3300025959|Ga0210116_1065368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 703 | Open in IMG/M |
3300025961|Ga0207712_11367687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 633 | Open in IMG/M |
3300027722|Ga0209819_10322084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 530 | Open in IMG/M |
3300027815|Ga0209726_10094199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1836 | Open in IMG/M |
3300027831|Ga0209797_10047003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1931 | Open in IMG/M |
3300027907|Ga0207428_10157875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1724 | Open in IMG/M |
3300027909|Ga0209382_10546071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1270 | Open in IMG/M |
3300031231|Ga0170824_126267560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
3300031740|Ga0307468_101512774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
3300031820|Ga0307473_11100315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 586 | Open in IMG/M |
3300032174|Ga0307470_10113711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1582 | Open in IMG/M |
3300032782|Ga0335082_11085922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 666 | Open in IMG/M |
3300032893|Ga0335069_11155552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 850 | Open in IMG/M |
3300034148|Ga0364927_0112088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 765 | Open in IMG/M |
3300034150|Ga0364933_152429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 12.82% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.13% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.13% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.56% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.71% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.71% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.71% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.71% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.71% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.71% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.85% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.85% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.85% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001372 | YB-Back-sed | Environmental | Open in IMG/M |
3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004047 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004145 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004148 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012172 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT366_2 | Environmental | Open in IMG/M |
3300012175 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT399_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012227 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2 | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03141430 | 2088090014 | Soil | TDVVSPLMKQAPPKMKVVPLPMTLATRYNEYFQTYRKVMGLK |
ARcpr5yngRDRAFT_0263131 | 3300000043 | Arabidopsis Rhizosphere | DVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
F24TB_107874371 | 3300000550 | Soil | LSREGQEILAAVGYYAPRTDVVSPLMKQAPPKMKVVPLPMMLAIRYNEYFQTYRKVMGLK |
F24TB_108626671 | 3300000550 | Soil | LLSREGQEVLAAVGYYAPRTDVVSPLMKQAPPKMKVVPLPMMLATRYNEYFQMYRKVMGLK* |
F24TB_120387102 | 3300000550 | Soil | PILKEAPAKTKIVPLPMTLASRYNEYFETYRKVMGLR* |
AF_2010_repII_A001DRAFT_100311692 | 3300000793 | Forest Soil | VGYYAPRTDVVSPLMKQVPAKIKVLPLPMMLATRYNEYFQTYGKVMGLK* |
JGI1027J12803_1008979141 | 3300000955 | Soil | PRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
YBBDRAFT_12787591 | 3300001372 | Marine Estuarine | ARLFNDFILSREGQELTAAAGYYAPRTDVTSPILKEAPPKTKIIPLAMTLAPRYNEYFQTYRKIMGLK* |
JGI24751J29686_100690201 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFLLSREGQEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0055472_101342382 | 3300003998 | Natural And Restored Wetlands | ILSREGQEILAAVGYYAPRTDVVSPLMKQAPPNMKVVPLPMTLATRYNEYFQTYRKLMGLK* |
Ga0055437_102200791 | 3300004009 | Natural And Restored Wetlands | AASGYYVPRTDVSSPILREAPPKTKVIPLPMTLAPRYSEYYQTYRRVMGLK* |
Ga0055499_100890011 | 3300004047 | Natural And Restored Wetlands | AAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0062593_1014100512 | 3300004114 | Soil | FLLSREGQELTAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0055489_100750231 | 3300004145 | Natural And Restored Wetlands | AAGYYVPRSDVASPILKEAPAKTKVLPLPMALAARYNEYFQTYRKLMGLK* |
Ga0055521_101390211 | 3300004148 | Natural And Restored Wetlands | PNAARLFNDFLLSRDGQELTAAAGYYAPRTDVTSPILKEAPPNTKIIPLAMTLAPRYNEYFQIYRKIMGLK* |
Ga0062589_1018936262 | 3300004156 | Soil | EGQELTAAAGYYVPRTDVASPILKEAPPRTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0063356_1028660081 | 3300004463 | Arabidopsis Thaliana Rhizosphere | ARLLNDFLLSREGQELTAAAGYYVPRTDVASPILKEAPPRTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0063356_1043869821 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LFHDFLLSREGQEVIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0068996_100847512 | 3300005218 | Natural And Restored Wetlands | REGQELTAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0065704_102190922 | 3300005289 | Switchgrass Rhizosphere | GAAGYFAPRTDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0065707_107778341 | 3300005295 | Switchgrass Rhizosphere | FNDFLLSREGQEAIAADGYYVPRLDVLSPILKEAPPKTKVIPLPMTLAPRYNEYYQTYRKLMGLK* |
Ga0070658_101507981 | 3300005327 | Corn Rhizosphere | PRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0070689_1005776511 | 3300005340 | Switchgrass Rhizosphere | QEVIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0070687_1001984531 | 3300005343 | Switchgrass Rhizosphere | EILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0070675_1002973752 | 3300005354 | Miscanthus Rhizosphere | YFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0070675_1009725591 | 3300005354 | Miscanthus Rhizosphere | YVPRTDVASPILKEAPPRTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0070659_1013728792 | 3300005366 | Corn Rhizosphere | SAAHLFVDFLLSHEGQEILGAAGYFAPRSDVISPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP* |
Ga0070667_1010056093 | 3300005367 | Switchgrass Rhizosphere | LFVDFLLSHEGQEILGAAGYFAPRSDVISPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP* |
Ga0070700_1013484792 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | ILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0070708_1022776611 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GQEILASVGYYAPRTDVVSPLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK* |
Ga0070681_115332691 | 3300005458 | Corn Rhizosphere | RTDVASPILKEAAPKTKVIPLPMTLASRYNEYYQTYRKVMGLK* |
Ga0070706_1015496812 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DFLLSREGQEVFAAAGYFSPRSDVSSPILKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0070699_1018045971 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0068855_1018988182 | 3300005563 | Corn Rhizosphere | KEAPAGTKIVPLPMNLAPRYNEYFQTYRKVMGLR* |
Ga0070702_1018660321 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VIAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLASRYNEYYQTYRKVMGLK* |
Ga0068852_1021925701 | 3300005616 | Corn Rhizosphere | QEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0066905_1012465622 | 3300005713 | Tropical Forest Soil | LMKQAPPKMKVVPLPMMLATRYNEYFQIYRKVMGLK* |
Ga0068866_103940092 | 3300005718 | Miscanthus Rhizosphere | IAAAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0074051_107362801 | 3300006572 | Soil | TAAAGYYAPRIDVASPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0075421_1004521082 | 3300006845 | Populus Rhizosphere | RLLVDFLLSREGQEILGAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0075430_1011189961 | 3300006846 | Populus Rhizosphere | DVASPILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0079219_105620131 | 3300006954 | Agricultural Soil | LSEAPPKTKIVPLPMSLAPRYGEYFQTYRKIMGLR* |
Ga0075419_107617952 | 3300006969 | Populus Rhizosphere | LSREGQEILGAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK |
Ga0079218_127465181 | 3300007004 | Agricultural Soil | TDVASPILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGRK* |
Ga0111539_108124572 | 3300009094 | Populus Rhizosphere | ILKDAAPKTKVIPLPMRMAPRYNEYYQTYRRLMGLK* |
Ga0115026_111702312 | 3300009111 | Wetland | AAGYYAPRTDVASPILKETPAKTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0105101_105336162 | 3300009171 | Freshwater Sediment | AGYYVPRTDVTSPILKEAPPKTKILPLPMSLAPRYNEYFQTYRKLMGLK* |
Ga0105237_106324452 | 3300009545 | Corn Rhizosphere | FAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0105252_100926812 | 3300009678 | Soil | YAPRTDVASPILKETPAKTKILPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0126380_114399692 | 3300010043 | Tropical Forest Soil | RTDVVSPLMKQVPAKIKVLSLPMMLATRYNEYFQTYGKVMGLK* |
Ga0126384_110943881 | 3300010046 | Tropical Forest Soil | RTDVVSPLMKQVPAKMKVIPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0126382_120492522 | 3300010047 | Tropical Forest Soil | REGQEILAAVGYYAPRTDVVSPLMKQVPAKMKVIPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0134071_100988671 | 3300010336 | Grasslands Soil | LKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGL* |
Ga0134125_115102991 | 3300010371 | Terrestrial Soil | ISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0105239_130392102 | 3300010375 | Corn Rhizosphere | REGQEILAAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0134122_104567971 | 3300010400 | Terrestrial Soil | GYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0134123_128626891 | 3300010403 | Terrestrial Soil | PILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP* |
Ga0137454_10316591 | 3300011406 | Soil | LLSREGQEAIAADGYYVPRSDVLSAILKEAPPKTKVVPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0137436_11867002 | 3300011423 | Soil | YFVPRTDVASPILKETPAKTKIVPLPMSLAPRYNEYFQSYRKLMGLK* |
Ga0137423_12633302 | 3300011430 | Soil | AAGYYVPRTDVASPILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0137426_11873561 | 3300011435 | Soil | QEILAAVGYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKLMGLK* |
Ga0137451_11501701 | 3300011438 | Soil | NDYLLSREGQEVIAAAGYHVPRTDVASPILKDAAPKTRVVPLPMSLAPRYNEYFQTYRKVMGLK* |
Ga0137432_11423051 | 3300011439 | Soil | DFILSREGQEILAAVGYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKVMGLK* |
Ga0120191_101506272 | 3300012022 | Terrestrial | LMKQAAPKMKVLPLPMMLATRYNEYFQMYRKVMGLK* |
Ga0137431_11976142 | 3300012038 | Soil | YVPRRDVAAPIMKQVPPKMKVIPLPMSLAARYSEYFQTYRKLMGLK* |
Ga0137320_11124391 | 3300012172 | Soil | SREGQEAIAADGYYVPRLDVLSPILKEAPAKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0137321_10875002 | 3300012175 | Soil | VPRTDVASPILREAPAKTKVIPLPMTLAPRYNEYYQTYRKVMGLK* |
Ga0137382_102361162 | 3300012200 | Vadose Zone Soil | GYFAPRTDISSPILSEATPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0137449_11554502 | 3300012227 | Soil | SREGQEIIAAAGYFVPRTDVASPILKETPAKTKIVPLPMSLAPRYNEYFQSYRKLMGLK* |
Ga0137375_101407581 | 3300012360 | Vadose Zone Soil | AAAGYFSPRSDVSSPILKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGLR* |
Ga0137361_112310702 | 3300012362 | Vadose Zone Soil | EGQEILASVGYYAPRTDVVSPLMKQAPPQIKVIPLPMTMASRYDEYFQLYRKVMGLK* |
Ga0157324_10168911 | 3300012506 | Arabidopsis Rhizosphere | AAGYFAPRTDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0157330_10803151 | 3300012514 | Soil | GQEILGAAGYFAPRTDVISPILSEAPPKTKIVPLPMSLAPRYGEYFQT* |
Ga0157338_10020491 | 3300012515 | Arabidopsis Rhizosphere | GYFAPRTDVSSPILGEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0137404_107247472 | 3300012929 | Vadose Zone Soil | LAAAGYYAPRTDVISPLMKQAPAKMKVFPLPMMLATRYNEYFQTYRKVMGLK* |
Ga0137407_106979152 | 3300012930 | Vadose Zone Soil | GQEVFAAAGYFSPRSDVSSPILKEAPAKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0126375_117364192 | 3300012948 | Tropical Forest Soil | AVGYYAPRTDVVTPLMKQVPPKIKVIPLPMALATRYNEYFQTYRKVMGLK* |
Ga0164307_102730222 | 3300012987 | Soil | SPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP* |
Ga0164306_101388872 | 3300012988 | Soil | AARLFVDFLLSHEGQEILGAAGYFAPRSDVISPILSEAPPRTKIVPLPMTLAARYNDYFQMYRKIMGLP* |
Ga0164305_120827811 | 3300012989 | Soil | LSREGQEILASVGYYAPRTDVVSPLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK |
Ga0075301_11579471 | 3300014262 | Natural And Restored Wetlands | IAASGYYVPRTDVASPILREAPPKTKVLPLPMTLAPRYTEYFQTYRKVMGLK* |
Ga0075303_10950581 | 3300014299 | Natural And Restored Wetlands | VLAASGYYVPRTDVSSPILREAPPKTKVIPLPMTLAPRYSEYYQTYRRVMGLK* |
Ga0180078_10353282 | 3300014865 | Soil | YYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKLMGLK* |
Ga0180088_10048383 | 3300014868 | Soil | YVPRRDVAAPIMKQVPAKMKVIPLPMSLASRYNEYFQTYRKLMGLK* |
Ga0180088_11017132 | 3300014868 | Soil | EILAAVGYYAPRTDVVSPLMKQAPPNIKVVPLPMMLATRYNEYFQTYRKLMGLK* |
Ga0180086_12117062 | 3300014883 | Soil | YFVPRTDVASPILKETPAKTKIIPLPMSLAPRYNEYFQSYRKLMGLK* |
Ga0157379_102477351 | 3300014968 | Switchgrass Rhizosphere | TDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR* |
Ga0137418_106814272 | 3300015241 | Vadose Zone Soil | FAPRTDISSPILSEATPKTKIVPLPMTLASRYNEYFQTYRKVMGLK* |
Ga0132257_1011638832 | 3300015373 | Arabidopsis Rhizosphere | HEGQEILGAAGYFPPRTDVISPILSETPPKTKIVPLPMSLAPRYGEHFQTYRKIMGLR* |
Ga0132255_1041462452 | 3300015374 | Arabidopsis Rhizosphere | AGYFAPRTDVISPILSEAPPKMKIVPLPMSLAPRYGEYFQTYRKIMGLR* |
Ga0184626_101471642 | 3300018053 | Groundwater Sediment | GQEIIAEAGYYVPRRDVAAPIMKQVPAKMKVIPLPMSLAPRYNEYFQTYRKLMGLK |
Ga0184623_101416012 | 3300018056 | Groundwater Sediment | LKEAPPKTKVVPLPMTLAPRYNEYFQTYRKIMKLK |
Ga0184619_104488031 | 3300018061 | Groundwater Sediment | GQEVIAGAGYYVPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK |
Ga0184609_105432692 | 3300018076 | Groundwater Sediment | LMKQAPPKIKVVPLPMTLATRYNEYFQMYRKVMGLK |
Ga0190270_107567962 | 3300018469 | Soil | ARLFNDFLLSREGQEITAAAGYFVPRTDVASPILKETPAKTKIIPLPMTLAPRYNEYFQNYRKLMGLK |
Ga0193752_11478052 | 3300020027 | Soil | YYVPRTDVASPILKEAAPKTKVIPLPMTLASRYNEYYQTYRKVMGLK |
Ga0210401_102236532 | 3300020583 | Soil | IDFMLSREGQEAMGISGYFVPRSDVSSPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK |
Ga0210384_118734971 | 3300021432 | Soil | PILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK |
Ga0224452_12618192 | 3300022534 | Groundwater Sediment | QEVIASAGYYSPRADVTSPILKEAPARTKIVPLPMTLASRYNEYFQSYRKVMGLR |
Ga0207697_101350812 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GQEILGAAGYFAPRTDVISPILNEASPKTKIVPLPMTLAARYNEYFQMYRKIMGLR |
Ga0207697_102250682 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | LGAAGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK |
Ga0207665_113795602 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK |
Ga0210116_10653682 | 3300025959 | Natural And Restored Wetlands | AAGYYVPRSDVASPILKEAPAKTKVLPLPMALAARYNEYFQTYRKLMGLK |
Ga0207712_113676872 | 3300025961 | Switchgrass Rhizosphere | PRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK |
Ga0209819_103220842 | 3300027722 | Freshwater Sediment | YAPRTDVVSPLMKQAPAKMKVVPLPMTLATRYNEYFQTYRKVMGLK |
Ga0209726_100941991 | 3300027815 | Groundwater | IAAAGYHVPRADVASPILKEAPAKTKVIPLPMSMAPRYNEYYQTYRKVMGLK |
Ga0209797_100470033 | 3300027831 | Wetland Sediment | FNDFLLSREGQEITAAAGYFVPRSDVVSPILRETPAKTKVLPLPMSLAPRYNEYFQTYRKLMGLK |
Ga0207428_101578752 | 3300027907 | Populus Rhizosphere | AGYFAPRTDVSSPILSEAPPKTKIVPLPMTLASRYNEYFQTYRKVMGLK |
Ga0209382_105460711 | 3300027909 | Populus Rhizosphere | ILKDAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK |
Ga0170824_1262675601 | 3300031231 | Forest Soil | FAPRTDVSSPILSEAPPKLKIVPLPMTLASRYNEYFQTYRKVMGLK |
Ga0307468_1015127742 | 3300031740 | Hardwood Forest Soil | EGQEVMGISGYFVPRSDVSSPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK |
Ga0307473_111003152 | 3300031820 | Hardwood Forest Soil | RTDVVSPLMKQAPPKIKVIPLPMTMASRYDEYFQLYRKVMGLK |
Ga0307470_101137112 | 3300032174 | Hardwood Forest Soil | REGQEVMGISGYFVPRSDVSSPILKEAPPKTKVIPLPMTLAPHYDEYFQTYRKVMGLK |
Ga0335082_110859222 | 3300032782 | Soil | SVGYYAPRSDVVSPLMKQAPPKTKVIPLPMMMASRYDEYFQLYRKVMGLK |
Ga0335069_111555521 | 3300032893 | Soil | LSREGQEAMGVSGYYVPRTDVASPILQEAPPKTKVIPLPMTLAPRYNEYFQTFRKVMGLK |
Ga0364927_0112088_654_764 | 3300034148 | Sediment | ILKETPAKTKILPLPMSLAPRYNEYFQTYRKVMGLK |
Ga0364933_152429_458_595 | 3300034150 | Sediment | VPRTDVASPILKEAAPKTKVIPLPMTLAPRYNEYYQTYRKVMGLK |
⦗Top⦘ |