Basic Information | |
---|---|
Family ID | F077841 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 48 residues |
Representative Sequence | MGKFKPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Number of Associated Samples | 96 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 11.97 % |
% of genes near scaffold ends (potentially truncated) | 39.32 % |
% of genes from short scaffolds (< 2000 bps) | 91.45 % |
Associated GOLD sequencing projects | 86 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.068 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (11.111 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.205 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.171 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.53% β-sheet: 0.00% Coil/Unstructured: 64.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF01138 | RNase_PH | 47.86 |
PF03725 | RNase_PH_C | 21.37 |
PF02934 | GatB_N | 11.11 |
PF01725 | Ham1p_like | 5.98 |
PF02308 | MgtC | 1.71 |
PF07927 | HicA_toxin | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 69.23 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 69.23 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 69.23 |
COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 11.11 |
COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 11.11 |
COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 5.98 |
COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 1.71 |
COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 1.71 |
COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.07 % |
Unclassified | root | N/A | 23.93 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459013|GO6OHWN02F4PQ0 | Not Available | 512 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105374049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1120 | Open in IMG/M |
3300001396|JGI20175J14863_1021241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 843 | Open in IMG/M |
3300002515|JGI24144J35610_10116062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 621 | Open in IMG/M |
3300003369|JGI24140J50213_10213567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 599 | Open in IMG/M |
3300005328|Ga0070676_10454803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 901 | Open in IMG/M |
3300005328|Ga0070676_10475824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 883 | Open in IMG/M |
3300005329|Ga0070683_100435577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1251 | Open in IMG/M |
3300005329|Ga0070683_101460728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 657 | Open in IMG/M |
3300005332|Ga0066388_103051037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300005332|Ga0066388_106727835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 579 | Open in IMG/M |
3300005334|Ga0068869_101041218 | Not Available | 714 | Open in IMG/M |
3300005335|Ga0070666_11153251 | Not Available | 577 | Open in IMG/M |
3300005340|Ga0070689_101293157 | Not Available | 657 | Open in IMG/M |
3300005354|Ga0070675_100589614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1007 | Open in IMG/M |
3300005356|Ga0070674_102002786 | Not Available | 527 | Open in IMG/M |
3300005367|Ga0070667_100496958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 1118 | Open in IMG/M |
3300005367|Ga0070667_100737237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 913 | Open in IMG/M |
3300005435|Ga0070714_100198810 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300005437|Ga0070710_11105612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 582 | Open in IMG/M |
3300005456|Ga0070678_100610438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 975 | Open in IMG/M |
3300005618|Ga0068864_101546728 | Not Available | 667 | Open in IMG/M |
3300005764|Ga0066903_107102457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300005938|Ga0066795_10031719 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
3300006052|Ga0075029_100648345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 709 | Open in IMG/M |
3300006055|Ga0097691_1009273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5008 | Open in IMG/M |
3300006162|Ga0075030_100577380 | Not Available | 892 | Open in IMG/M |
3300006162|Ga0075030_101179516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300006163|Ga0070715_10589738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 650 | Open in IMG/M |
3300006163|Ga0070715_11097185 | Not Available | 501 | Open in IMG/M |
3300006172|Ga0075018_10771540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 525 | Open in IMG/M |
3300006174|Ga0075014_100831277 | Not Available | 548 | Open in IMG/M |
3300006237|Ga0097621_100891493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300006237|Ga0097621_102190710 | Not Available | 529 | Open in IMG/M |
3300006358|Ga0068871_100104072 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
3300006358|Ga0068871_100614074 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
3300006358|Ga0068871_101304804 | Not Available | 683 | Open in IMG/M |
3300006642|Ga0075521_10561672 | Not Available | 561 | Open in IMG/M |
3300006755|Ga0079222_10999838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
3300006795|Ga0075520_1046199 | Not Available | 2106 | Open in IMG/M |
3300006864|Ga0066797_1197731 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300006954|Ga0079219_11048671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 684 | Open in IMG/M |
3300009029|Ga0066793_10079871 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
3300009029|Ga0066793_10568496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 646 | Open in IMG/M |
3300009551|Ga0105238_11918991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 625 | Open in IMG/M |
3300010366|Ga0126379_12679867 | Not Available | 595 | Open in IMG/M |
3300010376|Ga0126381_102474712 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300010376|Ga0126381_104158661 | Not Available | 562 | Open in IMG/M |
3300012209|Ga0137379_10553649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1058 | Open in IMG/M |
3300012357|Ga0137384_10832810 | Not Available | 745 | Open in IMG/M |
3300012469|Ga0150984_116602543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1158 | Open in IMG/M |
3300012948|Ga0126375_11636141 | Not Available | 556 | Open in IMG/M |
3300013296|Ga0157374_12320611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 564 | Open in IMG/M |
3300013306|Ga0163162_10325219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1670 | Open in IMG/M |
3300014492|Ga0182013_10098192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1987 | Open in IMG/M |
3300014494|Ga0182017_10512881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 734 | Open in IMG/M |
3300014498|Ga0182019_10246607 | Not Available | 1173 | Open in IMG/M |
3300014498|Ga0182019_10417267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 918 | Open in IMG/M |
3300014498|Ga0182019_11189578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 560 | Open in IMG/M |
3300014502|Ga0182021_10027246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6745 | Open in IMG/M |
3300014969|Ga0157376_11376872 | Not Available | 737 | Open in IMG/M |
3300014969|Ga0157376_11820537 | Not Available | 645 | Open in IMG/M |
3300015372|Ga0132256_101123340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 900 | Open in IMG/M |
3300016270|Ga0182036_11107972 | Not Available | 656 | Open in IMG/M |
3300016319|Ga0182033_12157725 | Not Available | 508 | Open in IMG/M |
3300016371|Ga0182034_10952104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 740 | Open in IMG/M |
3300016371|Ga0182034_11244761 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300017792|Ga0163161_10531459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 961 | Open in IMG/M |
3300017940|Ga0187853_10231325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 855 | Open in IMG/M |
3300019785|Ga0182022_1312658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1863 | Open in IMG/M |
3300021168|Ga0210406_10040205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4156 | Open in IMG/M |
3300021478|Ga0210402_10738866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 908 | Open in IMG/M |
3300021861|Ga0213853_10540811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 680 | Open in IMG/M |
3300022756|Ga0222622_10404379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 962 | Open in IMG/M |
3300022756|Ga0222622_10743169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 715 | Open in IMG/M |
3300023311|Ga0256681_10320725 | Not Available | 583 | Open in IMG/M |
3300025481|Ga0208079_1003221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 7585 | Open in IMG/M |
3300025579|Ga0207927_1005271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 4838 | Open in IMG/M |
3300025650|Ga0209385_1054215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1450 | Open in IMG/M |
3300025829|Ga0209484_10036692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1040 | Open in IMG/M |
3300025836|Ga0209748_1118865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 994 | Open in IMG/M |
3300025878|Ga0209584_10315557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 601 | Open in IMG/M |
3300025888|Ga0209540_10269978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 979 | Open in IMG/M |
3300025903|Ga0207680_10230282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1273 | Open in IMG/M |
3300025927|Ga0207687_10991821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 720 | Open in IMG/M |
3300025936|Ga0207670_10386379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1116 | Open in IMG/M |
3300025941|Ga0207711_10865949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 840 | Open in IMG/M |
3300026041|Ga0207639_10696553 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300026551|Ga0209648_10175640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1663 | Open in IMG/M |
3300027787|Ga0209074_10211092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 734 | Open in IMG/M |
3300027911|Ga0209698_10200789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1613 | Open in IMG/M |
3300027911|Ga0209698_10271528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1349 | Open in IMG/M |
3300028379|Ga0268266_11358207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 686 | Open in IMG/M |
3300029984|Ga0311332_11476304 | Not Available | 551 | Open in IMG/M |
3300030114|Ga0311333_10749710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 817 | Open in IMG/M |
3300030294|Ga0311349_11829676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 560 | Open in IMG/M |
3300030339|Ga0311360_11058261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 640 | Open in IMG/M |
3300031344|Ga0265316_10047009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3416 | Open in IMG/M |
3300031573|Ga0310915_10111064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1864 | Open in IMG/M |
3300031573|Ga0310915_10788432 | Not Available | 669 | Open in IMG/M |
3300031726|Ga0302321_101625053 | Not Available | 746 | Open in IMG/M |
3300031902|Ga0302322_101457288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 835 | Open in IMG/M |
3300031938|Ga0308175_102002927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 649 | Open in IMG/M |
3300031954|Ga0306926_10522046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1458 | Open in IMG/M |
3300032180|Ga0307471_101987562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 729 | Open in IMG/M |
3300032205|Ga0307472_101981698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 583 | Open in IMG/M |
3300032770|Ga0335085_10057619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5208 | Open in IMG/M |
3300032782|Ga0335082_10225069 | All Organisms → cellular organisms → Bacteria | 1767 | Open in IMG/M |
3300032783|Ga0335079_10117486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3003 | Open in IMG/M |
3300032828|Ga0335080_12051201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 553 | Open in IMG/M |
3300033289|Ga0310914_11001281 | Not Available | 736 | Open in IMG/M |
3300033289|Ga0310914_11312715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 626 | Open in IMG/M |
3300034125|Ga0370484_0062512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 937 | Open in IMG/M |
3300034125|Ga0370484_0184331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. ER1/6 | 568 | Open in IMG/M |
3300034170|Ga0370487_0171775 | Not Available | 714 | Open in IMG/M |
3300034282|Ga0370492_0074429 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300034282|Ga0370492_0096197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1212 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 11.11% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.13% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 5.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.27% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 4.27% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.27% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 4.27% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.71% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.71% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.71% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.71% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.71% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.71% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.85% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.85% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.85% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001396 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 | Environmental | Open in IMG/M |
3300002515 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A | Environmental | Open in IMG/M |
3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N57_04772670 | 2170459013 | Grass Soil | MAKFRPIRANAKKTSRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
INPhiseqgaiiFebDRAFT_1053740492 | 3300000364 | Soil | MGATIAVMAKFKPVRPKTKTAPRPQGAVGCVVLVVLLMIGVAIFMYMVMTSHAS* |
JGI20175J14863_10212412 | 3300001396 | Arctic Peat Soil | IISHDATIGFMGKFKPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
JGI24144J35610_101160621 | 3300002515 | Arctic Peat Soil | GKFKPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
JGI24140J50213_102135671 | 3300003369 | Arctic Peat Soil | GVMGKYKPVRANAKKTPRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0070676_104548031 | 3300005328 | Miscanthus Rhizosphere | MGKFKPVRAGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0070676_104758242 | 3300005328 | Miscanthus Rhizosphere | MAKFKPVRPSGKKSPRPNGAAGCVILILLLMVGVMIFLYLVMRGNANG* |
Ga0070683_1004355771 | 3300005329 | Corn Rhizosphere | MARFRPVRANAKKTTRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0070683_1014607282 | 3300005329 | Corn Rhizosphere | MAKFRPIRANAKKTSRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0066388_1030510372 | 3300005332 | Tropical Forest Soil | MAKFKPVRPKTKTAPRPQGAVGCVVLVILLMIGVAIFLYLVMTSHAS* |
Ga0066388_1067278352 | 3300005332 | Tropical Forest Soil | MGKFKLAGAKGKRAAARPQGAAGCVILILLLMAGVMVFLYLVMKSANG* |
Ga0068869_1010412181 | 3300005334 | Miscanthus Rhizosphere | ISHDATIGFMGKFKPVRPGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0070666_111532512 | 3300005335 | Switchgrass Rhizosphere | MGKFKPVRAGGKKASRPQGAAGCVVMILLIMIGVMVFLYLVMTSNANR* |
Ga0070689_1012931571 | 3300005340 | Switchgrass Rhizosphere | RPIRANAKKTSRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0070675_1005896142 | 3300005354 | Miscanthus Rhizosphere | MGKFKPVRAGGKKAARPQGAAGCVVMILLIMVGVMVFLYLVMTSNANR* |
Ga0070674_1020027862 | 3300005356 | Miscanthus Rhizosphere | VRPGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0070667_1004969583 | 3300005367 | Switchgrass Rhizosphere | MGKFKPVRANAKKAARPQGAAGCVILILLIMVGVMVFLYLVMK |
Ga0070667_1007372371 | 3300005367 | Switchgrass Rhizosphere | MAKFRPIRANAKTSRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0070714_1001988104 | 3300005435 | Agricultural Soil | MAKFKPVRPKTKSVPRPQGAVGCVVLVLLLMLGVLIFLYMAMSNAK* |
Ga0070710_111056122 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKFKPVRPKTKSVPRPQGAVGCVVLVLLLMLGVLIFLYMAMSNA |
Ga0070678_1006104382 | 3300005456 | Miscanthus Rhizosphere | MGKFKPVRPGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0068864_1015467282 | 3300005618 | Switchgrass Rhizosphere | GKFKPVRPGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0066903_1071024572 | 3300005764 | Tropical Forest Soil | MAKFKPVRVKPASSPKPQGAAGCVILIILIMLGVMVFLYLVMRSNAS* |
Ga0066795_100317193 | 3300005938 | Soil | MGKFKPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0075029_1006483451 | 3300006052 | Watersheds | KAAPPQGAAGCVILILAIMAGVMVFLYLVMKSNANG* |
Ga0097691_10092734 | 3300006055 | Arctic Peat Soil | MGKFKPVRASGKKAARPQGAAGCVILILAIMAGVMVFLYLVMKSNANG* |
Ga0075030_1005773802 | 3300006162 | Watersheds | MAKFRLAGAKGKKSGRPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0075030_1011795162 | 3300006162 | Watersheds | MAKFRPVRANARKTTRPQGAAGCVILILLLMVGVMLFLYLVMKSNANG* |
Ga0070715_105897382 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFKPVRANAKKAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0070715_110971852 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFKPVRAGGKKTARPQGAAGCVVMILLIMIGVMVFLYLVMKSNA |
Ga0075018_107715401 | 3300006172 | Watersheds | MGKFKPVRANAKKTARPQGAAGCVILILLIMVGVMAFLYLVMKSNANG* |
Ga0075014_1008312771 | 3300006174 | Watersheds | GGIISHDATIGFMGKFKPVRANAKKASRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0097621_1008914932 | 3300006237 | Miscanthus Rhizosphere | MAKFKPVRPKGKSVPRPQGAVGCVVLVLLLMLGVLIFLYMAMSNAR* |
Ga0097621_1021907101 | 3300006237 | Miscanthus Rhizosphere | DATIGFMGKFKPVRAGGKKTARPQGAAGCVVMILLIMIGVMVFLYLVMKSNANG* |
Ga0068871_1001040724 | 3300006358 | Miscanthus Rhizosphere | MGKFKPVRPGGKKTARPQGAAGCVVMILLIMVGVMVFLYLVMKSNANG* |
Ga0068871_1006140742 | 3300006358 | Miscanthus Rhizosphere | MGKFKPVRAGGKKAPRPQGAAGCVVMILLIMIGVMVFLYLVMKSNANG* |
Ga0068871_1013048041 | 3300006358 | Miscanthus Rhizosphere | GKFKPVRAGGKKASRPQGAAGCVVMILLIMIGVMVFLYLVMTSNANR* |
Ga0075521_105616722 | 3300006642 | Arctic Peat Soil | MAKFRPVRPNAKKTARPQGAAGCVILILLIMAGVMVFLYLVMKSNANG* |
Ga0079222_109998382 | 3300006755 | Agricultural Soil | MAKFKPVRAKPRSTPKPQGAVGCVVLIILIMFGVMAFLYLVMKSHAS* |
Ga0075520_10461992 | 3300006795 | Arctic Peat Soil | MAKFRPVRANAKPAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0066797_11977312 | 3300006864 | Soil | MARFRPVRANAKKTARPQGAAGCVVLILLIMVGVGVFF* |
Ga0079219_110486712 | 3300006954 | Agricultural Soil | ALMAKFKPVRAKPRSTPKPQGAVGCVVLIILIMFGVMAFLYLVMKSHAS* |
Ga0066793_100798712 | 3300009029 | Prmafrost Soil | MARFRPVRANAKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG* |
Ga0066793_105684962 | 3300009029 | Prmafrost Soil | MGKFRPVRAKAKKTTRPQGAAGCVVLILAIMVGVMVFLY |
Ga0105238_119189912 | 3300009551 | Corn Rhizosphere | MAKFRPIRANAKKTSRPQGAAGCVILILLIMVGVMV |
Ga0126379_126798672 | 3300010366 | Tropical Forest Soil | MAKFKPVRAKTKSPPRPQGAVGCVVLLLLIMFGVMAFLYLVMKSHAS* |
Ga0126381_1024747122 | 3300010376 | Tropical Forest Soil | MAKFKPVRVKSKSAPRPQGAAGCVILILLIMAGVMLLLYLVMSSHANR* |
Ga0126381_1041586612 | 3300010376 | Tropical Forest Soil | MAKFKPVRPKSKETPRPQGAVGCVVLVFLLMIGVLVFLYLVMTSHAS* |
Ga0137379_105536491 | 3300012209 | Vadose Zone Soil | MGKFKLAGSKGRKNARPQGAAGCVILILLIMVGVMVFLYLVMKSANG* |
Ga0137384_108328101 | 3300012357 | Vadose Zone Soil | TIALMGKFKLAGSKGRKSPRPQGAAGCVILILLIMVGVMVFLYLVMKSANG* |
Ga0150984_1166025431 | 3300012469 | Avena Fatua Rhizosphere | RGKGKKNTRPQGAAGCVILILLIMLGVMVFLYLVMKSANGQ* |
Ga0126375_116361411 | 3300012948 | Tropical Forest Soil | MAKFKPVRPKTKTAPRPQGAVGCVVLVILLMIGLAIFLYLVMTSHAS* |
Ga0157374_123206111 | 3300013296 | Miscanthus Rhizosphere | GRVISHDATIGFMGKFKPVRANAKKAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0163162_103252192 | 3300013306 | Switchgrass Rhizosphere | MGKFKPVRPGGKKTARPQGAAGCVVMILLIMVGVMVFLYLVMTSNANR* |
Ga0182013_100981923 | 3300014492 | Bog | MAKFRPVRAHAKTAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0182017_105128812 | 3300014494 | Fen | MAKFRPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0182019_102466071 | 3300014498 | Fen | MGKFKPVRPNAKKTTRPQGAAGCVILILAIMVGVMVFLYLVMKSNANG* |
Ga0182019_104172671 | 3300014498 | Fen | PVRASASAKKTPRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG* |
Ga0182019_111895782 | 3300014498 | Fen | MGKFKPVRASGKKAARPQGAAGCVILILAIMVGVMVF |
Ga0182021_100272466 | 3300014502 | Fen | MAKFRPVRANAKKTARPQGAAGCVILILAIMVGVMVFLYLVMKSNANG* |
Ga0157376_113768722 | 3300014969 | Miscanthus Rhizosphere | IGFMGKFKPVRAGGKKAARPQGAAGCVVMILLIMIGVMVFLYLVMKSNANG* |
Ga0157376_118205371 | 3300014969 | Miscanthus Rhizosphere | IISHDATIGFMGKFKPVRPGGKKTARPQGAAGCVVMILLIMVGVMVFLYLVMKSNANG* |
Ga0132256_1011233401 | 3300015372 | Arabidopsis Rhizosphere | KPRSTPKPQGAVGCVVLIILIMFGVMAFLYLVMKSHAS* |
Ga0182036_111079721 | 3300016270 | Soil | SDDANIGLMGKFKPVRASAKKTARPQGAAGCVILILLIMVGVMAFLYLVMKSNANG |
Ga0182033_121577252 | 3300016319 | Soil | MAKFKPVRPKTKTAPRPQGAVGCVVLVILLMIGVAIFLYLVMTSHAS |
Ga0182034_109521041 | 3300016371 | Soil | ISHDATIALMGKFKLAGAKGRKNPRPQQAAGCVILILLMMVGVMVFLYLVMKSANGQ |
Ga0182034_112447612 | 3300016371 | Soil | RAKPKDVPRPQGAVGCVVLVILLIIGVGLFLYFVMTSHAS |
Ga0163161_105314591 | 3300017792 | Switchgrass Rhizosphere | AARPQGAAGCVVMILLIMIGVMVFLYLVMKSNANG |
Ga0187853_102313252 | 3300017940 | Peatland | MAKFRPVRAHAKTAARPQGAAGCVILILLLMVGVMVFLYLVMKSNANG |
Ga0182022_13126583 | 3300019785 | Fen | MAKFRPVRANAKKTARPQGAAGCVILILAIMVGVMVFLYLVMKSNANG |
Ga0210406_100402053 | 3300021168 | Soil | MGKFKLAGSKGRKNPRPQQAAGCVILILLMMVGVMVFLYLVMKSANGQ |
Ga0210402_107388661 | 3300021478 | Soil | MAKFKPVRPKSKDAPRPQGAVGCVILVILIMFAIMVFLYLVMKSHAS |
Ga0213853_105408111 | 3300021861 | Watersheds | MARFKPVRANARKTTRPQGAAGCVILILLMMVGVMVFLYLVMKSNANG |
Ga0222622_104043791 | 3300022756 | Groundwater Sediment | TIGFMAKFRPIRANAKKTSRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0222622_107431693 | 3300022756 | Groundwater Sediment | MAKFRPIRANAKKTSRPQGAAGCVILILLIMVGVMVFLYLVMNSNA |
Ga0256681_103207252 | 3300023311 | Freshwater | KFKPVRASGKKAARPQGAAGCVILILAIMAGVMVFLYLVMKSNANG |
Ga0208079_10032216 | 3300025481 | Arctic Peat Soil | MGKFKPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0207927_10052716 | 3300025579 | Arctic Peat Soil | MGKFKPVRAGGKKAVRPQGAAGCVILILAIMAGVMVFLYLVMKSNANG |
Ga0209385_10542153 | 3300025650 | Arctic Peat Soil | MAKFRPVRANAKPAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0209484_100366923 | 3300025829 | Arctic Peat Soil | CIISHDATIGFMGKFKPVRANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0209748_11188653 | 3300025836 | Arctic Peat Soil | RANAKKTARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0209584_103155571 | 3300025878 | Arctic Peat Soil | TIGVMAKFRPVRANAKPAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0209540_102699781 | 3300025888 | Arctic Peat Soil | MGKFKPVRANAKKAARPQGAAGCVILILAIMVGVMVFLYLVM |
Ga0207680_102302822 | 3300025903 | Switchgrass Rhizosphere | MGKFKPVRAGGKKASRPQGAAGCVVMILLIMIGVMVFLYLVMTSNANR |
Ga0207687_109918212 | 3300025927 | Miscanthus Rhizosphere | MGKFKPVRAGGKKTARPQGAAGCVVMILLIMIGVMVFLYLVMKSNANG |
Ga0207670_103863793 | 3300025936 | Switchgrass Rhizosphere | MGKFKPVRAGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG |
Ga0207711_108659492 | 3300025941 | Switchgrass Rhizosphere | MGKFKLAGSKGRKNARPQGAAGCVILLLLIMVGVMVFLYLVMKSANGQ |
Ga0207639_106965532 | 3300026041 | Corn Rhizosphere | MARFRPVRANAKKTTRPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0209648_101756402 | 3300026551 | Grasslands Soil | MGKFKPVRANAKKTTRPQGAAGCVILILLIMVGVMAFLYLVMKSNANG |
Ga0209074_102110922 | 3300027787 | Agricultural Soil | MAKFKPVRAKPRSTPKPQGAVGCVVLIILIMFGVMAFLYLVMKSHAS |
Ga0209698_102007892 | 3300027911 | Watersheds | MARFKPVRANARKTTRPQGAAGCVIVILLLMAGVMLFFYWAMKSNANG |
Ga0209698_102715283 | 3300027911 | Watersheds | MAKFRPVRANARKTTRPQGAAGCVILILLLMVGVMLFLYLVMKSNANG |
Ga0268266_113582072 | 3300028379 | Switchgrass Rhizosphere | MGKFKPVRPGGKKTARPQGAAGCVVLILLIMVGVMVFLYLVMKSNANG |
Ga0311332_114763041 | 3300029984 | Fen | MGKFKPVRANAKKTTRPQGAAGCVILVLGIMVGVMVFLYLVMKSNANG |
Ga0311333_107497102 | 3300030114 | Fen | HDATIGFMAKFRPVRANAKKTVRPQGAADCVILILLIMVGVMVFLYLVMKSNANG |
Ga0311349_118296762 | 3300030294 | Fen | MGKFKPVRPNAKKAARPQGAAGCVILILLIMVGVMVFLYLVMKSNANG |
Ga0311360_110582613 | 3300030339 | Bog | VRASGKKAARPQGAAGCVILILAIMVGVMVFLYLVMKSNANG |
Ga0265316_100470094 | 3300031344 | Rhizosphere | MAKFKPVRAHARKAARPRGAAGCVVLILVLMAGVMVLLYLVMKSNANG |
Ga0310915_101110643 | 3300031573 | Soil | MGKFKLAGAKGRKNPRPQQAAGCVILILLMMVGVMVFLYLVMKSANGQ |
Ga0310915_107884321 | 3300031573 | Soil | KESVKPQGALGCVILLILIMVGVMVFLYFVMRSNAS |
Ga0302321_1016250532 | 3300031726 | Fen | SMAKFKPVRLKGKKAPRPQGAAGCVILILLLMVGVMVFLYLVMKSNANG |
Ga0302322_1014572882 | 3300031902 | Fen | MGKFKPVRGNAKKTARPQGAAGCVILILLMMVGVMVFLYLVMKSNANG |
Ga0308175_1020029272 | 3300031938 | Soil | MAKFKPVRAAGKKTARPQGAAGCVVMILLIMVGVMIFLYLVMKSNANG |
Ga0306926_105220462 | 3300031954 | Soil | MGKFKLAGAKGRKSARPQGAAGCVILILLIMVGVMVFLYLVMKSANGQ |
Ga0307471_1019875622 | 3300032180 | Hardwood Forest Soil | MGKFKLAGAKGKKSTRPQGAAGCVILILLIMVGVMVFLYLVMKSANGQ |
Ga0307472_1019816982 | 3300032205 | Hardwood Forest Soil | MGKFKLAGAKGKKSTRPQGAAGCVILILLIMVGVMVFLYLVMKSANG |
Ga0335085_100576193 | 3300032770 | Soil | MAKFKPVRVKPKTPARPQGAVGCVVLILLIMFGVMVFLYFAMRSNAS |
Ga0335082_102250692 | 3300032782 | Soil | MAKFKPVRMKPKSAAPPQGAVGCVILLLLILLGGMVFLYFVMSSHAT |
Ga0335079_101174865 | 3300032783 | Soil | MAKFKPVRVKPKSPARPQGAVGCVVLILLIMIGVMVFLYFAMRSNAS |
Ga0335080_120512012 | 3300032828 | Soil | MAKYRPVRAKSKSPTRPQGAVGCVVLLILIMFGVMFFLYLVMKSNAS |
Ga0310914_110012811 | 3300033289 | Soil | MGKFKPVRASAKKTARPQGAAGCVILILLIMVGVMAFLYLVMKSNANG |
Ga0310914_113127152 | 3300033289 | Soil | MAKFRPVRANPKKTARPQGAAGCVILILLTMVGVMVFLYLVMKSNANG |
Ga0370484_0062512_663_809 | 3300034125 | Untreated Peat Soil | MGKFKPVRASGKKAARPQGAAGCVILILAIMAGVMVFLYLVMKSNANG |
Ga0370484_0184331_409_555 | 3300034125 | Untreated Peat Soil | MGKFKPVRASGKKTARPQGAAGCVILILAIMAGVMVFLYLVMKSNANG |
Ga0370487_0171775_413_559 | 3300034170 | Untreated Peat Soil | MAKFRPVRTNAKKAARPQGAAGCVILILLIMTGVMVFLYLVMKSNANG |
Ga0370492_0074429_384_536 | 3300034282 | Untreated Peat Soil | MAKFRPVGSKGKGKRAGRPQNAIGCVVLILLIMVGVMVFLYLVMKSNANG |
Ga0370492_0096197_424_576 | 3300034282 | Untreated Peat Soil | MAKFRPVGSKGKGKRAGRPQNAVGCVVLILLIMLGVMVFLYLVMKSNANG |
⦗Top⦘ |