Basic Information | |
---|---|
Family ID | F077760 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 45 residues |
Representative Sequence | MNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILC |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 79.31 % |
% of genes near scaffold ends (potentially truncated) | 99.15 % |
% of genes from short scaffolds (< 2000 bps) | 93.16 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.291 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (11.111 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.701 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.650 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.94% β-sheet: 0.00% Coil/Unstructured: 43.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF10531 | SLBB | 70.09 |
PF02563 | Poly_export | 5.13 |
PF00106 | adh_short | 3.42 |
PF07609 | DUF1572 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 5.13 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.29 % |
Unclassified | root | N/A | 1.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_1599_length_1535_cov_12.218241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
2162886013|SwBSRL2_contig_13260207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
3300002128|JGI24036J26619_10090068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300002244|JGI24742J22300_10092086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
3300004114|Ga0062593_101975494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300005093|Ga0062594_100350398 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
3300005238|Ga0073692_1041352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300005332|Ga0066388_106726777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
3300005332|Ga0066388_106994807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
3300005337|Ga0070682_100582678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300005338|Ga0068868_100726674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
3300005354|Ga0070675_101023897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300005364|Ga0070673_101447733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
3300005438|Ga0070701_11215981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300005441|Ga0070700_101386738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300005458|Ga0070681_10241442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1720 | Open in IMG/M |
3300005467|Ga0070706_101696133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300005535|Ga0070684_100771051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
3300005539|Ga0068853_102097704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300005543|Ga0070672_100679282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300005545|Ga0070695_100104908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1909 | Open in IMG/M |
3300005545|Ga0070695_100142702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
3300005545|Ga0070695_100385363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1059 | Open in IMG/M |
3300005546|Ga0070696_101278895 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300005577|Ga0068857_101507709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300005578|Ga0068854_100154542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1772 | Open in IMG/M |
3300005578|Ga0068854_100767418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300005615|Ga0070702_100486501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300005615|Ga0070702_101875363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300005616|Ga0068852_102361181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300005617|Ga0068859_100516510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
3300005617|Ga0068859_101018401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
3300005618|Ga0068864_101047845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300005618|Ga0068864_102178077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300005718|Ga0068866_10586052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
3300005719|Ga0068861_100532272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
3300005834|Ga0068851_10776027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300005841|Ga0068863_101342813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300005842|Ga0068858_100779360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300006169|Ga0082029_1190693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300006846|Ga0075430_101687222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300006852|Ga0075433_10966516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300006854|Ga0075425_100776568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
3300006871|Ga0075434_100321287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
3300006918|Ga0079216_10773661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
3300006954|Ga0079219_10012651 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
3300007004|Ga0079218_10123088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1836 | Open in IMG/M |
3300007004|Ga0079218_11580420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300009036|Ga0105244_10194838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
3300009093|Ga0105240_10837485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 994 | Open in IMG/M |
3300009098|Ga0105245_13284916 | Not Available | 500 | Open in IMG/M |
3300009101|Ga0105247_11314540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300009174|Ga0105241_11558995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300009174|Ga0105241_12478408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300009177|Ga0105248_10732834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
3300009177|Ga0105248_12560455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300009177|Ga0105248_13243651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300009551|Ga0105238_13068128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300009553|Ga0105249_12626569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300010038|Ga0126315_11000740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300010039|Ga0126309_10307185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300010045|Ga0126311_10000966 | All Organisms → cellular organisms → Bacteria | 13519 | Open in IMG/M |
3300010046|Ga0126384_11765098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300010047|Ga0126382_11154635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
3300010047|Ga0126382_12285626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300010166|Ga0126306_10743334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
3300010373|Ga0134128_11600571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
3300010375|Ga0105239_12677726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300010397|Ga0134124_10297117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
3300010400|Ga0134122_11218649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300010403|Ga0134123_10739548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
3300010403|Ga0134123_11018086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
3300010403|Ga0134123_12404041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300011119|Ga0105246_10046503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2960 | Open in IMG/M |
3300012285|Ga0137370_10672104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300012985|Ga0164308_11490359 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300013102|Ga0157371_10740367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
3300013307|Ga0157372_11453056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300013307|Ga0157372_11891935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300013760|Ga0120188_1006783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
3300014488|Ga0182001_10665456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300014745|Ga0157377_10465112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
3300015265|Ga0182005_1248045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 550 | Open in IMG/M |
3300015371|Ga0132258_13753724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1035 | Open in IMG/M |
3300015373|Ga0132257_103856656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300018422|Ga0190265_10038687 | All Organisms → cellular organisms → Bacteria | 4046 | Open in IMG/M |
3300018466|Ga0190268_11049302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
3300025904|Ga0207647_10498312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
3300025907|Ga0207645_10249136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
3300025908|Ga0207643_10460332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
3300025911|Ga0207654_10156585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1468 | Open in IMG/M |
3300025911|Ga0207654_10621551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
3300025934|Ga0207686_10735842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300025936|Ga0207670_11373659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300025941|Ga0207711_10469611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1172 | Open in IMG/M |
3300025941|Ga0207711_10708005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
3300025945|Ga0207679_11880176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
3300025960|Ga0207651_10046328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2923 | Open in IMG/M |
3300025960|Ga0207651_11056032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
3300026023|Ga0207677_11841416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300026035|Ga0207703_10096133 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2500 | Open in IMG/M |
3300026035|Ga0207703_12189507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
3300026088|Ga0207641_10665994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1023 | Open in IMG/M |
3300026088|Ga0207641_12393374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300026095|Ga0207676_10849538 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300026116|Ga0207674_10345548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
3300026116|Ga0207674_11612657 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300026121|Ga0207683_10385101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
3300026142|Ga0207698_10801586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300027903|Ga0209488_11225926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
3300028380|Ga0268265_10354597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1341 | Open in IMG/M |
3300030511|Ga0268241_10003992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2702 | Open in IMG/M |
3300031716|Ga0310813_10461876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
3300031716|Ga0310813_12385107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300031716|Ga0310813_12394028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300031903|Ga0307407_10095770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1831 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 11.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.55% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.13% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.13% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.42% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.42% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.56% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.71% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.71% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.71% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.85% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.85% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.85% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005238 | Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, Australia | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_00132680 | 2140918013 | Soil | MNRKTISGERRRRKLITLGWVVGLSAIVITLIYFEKTAILYILCTLGVTGLLG |
SwBSRL2_0823.00001090 | 2162886013 | Switchgrass Rhizosphere | MNRRTLAGDRRRRKMMTALWVFLISVAVIVLIYREMTAVLY |
JGI24036J26619_100900682 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILAT |
JGI24742J22300_100920862 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLG |
Ga0062593_1019754941 | 3300004114 | Soil | MNRKTLAGDRRRRKLITVAWSLGVSILVIVLISLEKTAILYILSTVS |
Ga0058861_107556361 | 3300004800 | Host-Associated | MNRRTLADDRRRRKMLTALWVFLISIAVIILIYREMTAVLYILATLGVTALLLVVAFS |
Ga0062594_1003503981 | 3300005093 | Soil | MNRKTLAGDRRRRKLMTSLWALGVSIAVIVLIYFEKTAILYVLC |
Ga0073692_10413521 | 3300005238 | Soil | MNRKTIASDRRRRKLITALWALGITAVVVVLIYFERTAILYILCTVSIGML |
Ga0066388_1067267771 | 3300005332 | Tropical Forest Soil | MNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIAVLLL |
Ga0066388_1069948072 | 3300005332 | Tropical Forest Soil | MNRKTLTSDRRRRKTITLVWALVLAAVVITLIYLEKTAILYILCTLGVTAL |
Ga0070682_1005826781 | 3300005337 | Corn Rhizosphere | MNRKTISGERRRRKLITLGWVVGLTAIVITLIYFEKTAILYILC |
Ga0068868_1007266742 | 3300005338 | Miscanthus Rhizosphere | MNRRTLADDRRRRKMMTALWVFLVSIAVIILIYREMSAVLYI |
Ga0070675_1010238971 | 3300005354 | Miscanthus Rhizosphere | MNRKTLAGDRRRRKMITFLWALGLGAVVIALIYLEKTAILYILCTLG |
Ga0070673_1014477332 | 3300005364 | Switchgrass Rhizosphere | MAGDRRRRKLITALWALGLTVLVIVLIYLEQTAILYILCTV |
Ga0070701_112159812 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKSMAGDRRRRKLITALWALGLTLLVIVLIYLEQTAILYILC |
Ga0070700_1013867381 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTIAGERRRRKLMTALWALGVAAVVITLIYLEQSAILYILCTVSIAV |
Ga0070681_102414421 | 3300005458 | Corn Rhizosphere | MSRKTLGDDRRRRKTITLVWALVLAAIVITLIYREQTAILYILCTLGVT |
Ga0070706_1016961332 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTIAGDRRRRKMMTLLWALGLAAVVITLIILEKTAIL |
Ga0070684_1007710511 | 3300005535 | Corn Rhizosphere | MNKKTLASDRRRRKTITLLWVLGVSLLVIFLIYKEMTAILYILATIGVT |
Ga0068853_1020977042 | 3300005539 | Corn Rhizosphere | MAGDRRRRKLITALWALGVTAVVITLIYLERTAILYILCTVSIAVLLL |
Ga0070672_1006792821 | 3300005543 | Miscanthus Rhizosphere | MNRKTIAGDRRRRKLMTTLWALGVAAVVITLIYLEQS |
Ga0070695_1001049083 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGV |
Ga0070695_1001427021 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILC |
Ga0070695_1003853632 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRRTLAGDRRRRKMITALWSLGVGVLMIVLIYLERTAILYILSTVSIAVL |
Ga0070696_1012788951 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKTLAGDRRRRKMITLAWVLGLAAVVITLIVLEKTAILYILCTL |
Ga0068857_1015077091 | 3300005577 | Corn Rhizosphere | MSRRTLADDRRRRKMMTALWVFLVSLAVIILIYREMSAVLYILATLGVTALLLVVAFSD |
Ga0068854_1001545423 | 3300005578 | Corn Rhizosphere | MNQKTMAGDRRRRKLITVLWALGLTVLVIVLIYLERSDILYILCTL |
Ga0068854_1007674182 | 3300005578 | Corn Rhizosphere | MNRKTLAGDRRRRKLMTALWSLGVAAVVITLIYLERTAILYI |
Ga0070702_1004865011 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTLAGDRRRRKLMTALWTLLLTVVIVTLMYLEQSAILYILSTVSI |
Ga0070702_1018753631 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MNRKTLAGDRRRRKLITALWSLGVAAVVITLIYLERTAILYILCTVSIAVL |
Ga0068852_1023611811 | 3300005616 | Corn Rhizosphere | MNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSI |
Ga0068859_1005165101 | 3300005617 | Switchgrass Rhizosphere | MNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAIL |
Ga0068859_1010184012 | 3300005617 | Switchgrass Rhizosphere | MNRKRAAGDRRRRKLITLLWALGVTAVIIALIYFE |
Ga0068864_1010478452 | 3300005618 | Switchgrass Rhizosphere | MNKKTLAGDRRRRKTITALWVLGISLLVIFLIYKEMSAVLYILATLGVTVLLMMV |
Ga0068864_1021780772 | 3300005618 | Switchgrass Rhizosphere | MNRKTIAGDRRRRKLMTALWSLGVAAVVITLIYLERTAILYILCTVSIAVLLLI |
Ga0068866_105860521 | 3300005718 | Miscanthus Rhizosphere | MNRKTLASDRRRRKTITGLWILGISIVVIFLIYKEMTAVLYIL |
Ga0068861_1005322721 | 3300005719 | Switchgrass Rhizosphere | MNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIAVLLLI |
Ga0068851_107760272 | 3300005834 | Corn Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAV |
Ga0068863_1013428131 | 3300005841 | Switchgrass Rhizosphere | MNRKTLAGDRRRRKMMTALWAGLVALAVIILMYKEQTAILYILC |
Ga0068858_1007793602 | 3300005842 | Switchgrass Rhizosphere | MNRKTLASDRRRRKTITGLWILGISIVVIFLIYKEMTAVLYILA |
Ga0082029_11906932 | 3300006169 | Termite Nest | MNRKTLAGDRRRRKLITALWSLGVAAVVILLIYLERTA |
Ga0075430_1016872221 | 3300006846 | Populus Rhizosphere | MAGDRRRRKLIAALWALGLAGVVIVLIYLEQTAVLYILCTLGITALLVI |
Ga0075433_109665162 | 3300006852 | Populus Rhizosphere | MNQRTLAGDRRRRKMITALWALGITAVIVTLIYLERTAILYILCTVSVAV |
Ga0075425_1007765681 | 3300006854 | Populus Rhizosphere | MNRRTLAGDRRRRKTLTALWVFLISIAVIILIYREMTAVLYILA |
Ga0075434_1003212871 | 3300006871 | Populus Rhizosphere | MNQKTLAGDRRRRKLITALWALGLAVIVITLIYLEKTAILYILCTLGVT |
Ga0079216_107736612 | 3300006918 | Agricultural Soil | MNGKRNAAADRRRRKLITGLWALALSAVVIVLIVL |
Ga0079219_100126514 | 3300006954 | Agricultural Soil | MNRKTLAGDRRRRKLITALWALGISAIVVTLIYFERTAIL |
Ga0079218_101230881 | 3300007004 | Agricultural Soil | MNRKTLAGDRRRRKLITFGWALALAALVITLIYFEKT |
Ga0079218_115804201 | 3300007004 | Agricultural Soil | MNGKRNAAADRRRRKLITGLWALALSAVVIVLIVLEKTAILYI |
Ga0105244_101948381 | 3300009036 | Miscanthus Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGVTVLL |
Ga0105240_108374852 | 3300009093 | Corn Rhizosphere | MNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIA |
Ga0105245_132849161 | 3300009098 | Miscanthus Rhizosphere | MNRKTIAGDRRRRKLMTALWALGIGAVVITLIYLEQSAILYILCTVSIAVLL |
Ga0105247_113145401 | 3300009101 | Switchgrass Rhizosphere | MNRKTIAGDRRRRKLITALWVLGIAAVVITLIYLEQSAILY |
Ga0105241_115589951 | 3300009174 | Corn Rhizosphere | MNRKTAAGERRLRKLIPLLWALGVTAVIIALIYFERTAILYILCT |
Ga0105241_124784081 | 3300009174 | Corn Rhizosphere | MNRRTLSGDRRRRKMITALWSLGVAALVIALVYLERTEILYILSTVSVA |
Ga0105248_107328342 | 3300009177 | Switchgrass Rhizosphere | MNRKTLAGDRRRRKLMTSLWALGVSIAVIVLIYFEKTAILYVLCTLAV |
Ga0105248_125604551 | 3300009177 | Switchgrass Rhizosphere | MNRKTLAGDRRRRKMMTTLWALGLSLVVILLIYFEKTAILYILCTLG |
Ga0105248_132436511 | 3300009177 | Switchgrass Rhizosphere | MNRKTITGERRRRKMITMGWVIALTAIVITLIYFEKTAI |
Ga0105238_130681282 | 3300009551 | Corn Rhizosphere | MNRKTLAGDRRRRKLITALYAFAITGVVIALIYFERTAILYILCTVSIAVLLLIV |
Ga0105249_126265691 | 3300009553 | Switchgrass Rhizosphere | MNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSA |
Ga0126315_110007401 | 3300010038 | Serpentine Soil | MNRKTLASDRRRRKLITALWALGVTAFVVILIYLERTAILYILCTVSIAV |
Ga0126309_103071851 | 3300010039 | Serpentine Soil | MNRKTLAGDRRRRKLITLLWTLGLAAIVITLIYLEKTAILY |
Ga0126311_100009661 | 3300010045 | Serpentine Soil | MNRRTLAGDRRRRKMITALWALGVSAVVILLIYLERTAILYILCTLSIAALLM |
Ga0126384_117650981 | 3300010046 | Tropical Forest Soil | MMSRKTLAADRRRRKLFTLLWAALLSLAVIILIYKEQTAILYILCTVGVAV |
Ga0126382_111546351 | 3300010047 | Tropical Forest Soil | MNRRTLAGDRRRRKMITALWSLGVAAVVIVLIYFERS |
Ga0126382_122856261 | 3300010047 | Tropical Forest Soil | MNRRTLAGDRRRRKMMTALWAILFSVGTIVLIYREMTAVLYILATLGV |
Ga0126306_107433341 | 3300010166 | Serpentine Soil | MNRKTLAGDRRRRKLITTLWALGLSAVVIALIYLERTAILYILCTL |
Ga0134128_116005711 | 3300010373 | Terrestrial Soil | MSRKTLAGDRRRRKMITLAWVLGLAGVVITLIVLEKTAILYILCTLGVTV |
Ga0105239_126777261 | 3300010375 | Corn Rhizosphere | MNRRTIAGDRRRRKMITALWSLGVAAVIIALIYLERTAML |
Ga0134124_102971171 | 3300010397 | Terrestrial Soil | MSQKTLAGDRRRRKLMTALWSLGVAAVVITLIYLERTAILYIL |
Ga0134122_112186491 | 3300010400 | Terrestrial Soil | MNRKTLAGDRRRRKTITALWVLVISILVIVLIYKEM |
Ga0134123_107395481 | 3300010403 | Terrestrial Soil | MNRRTLAGDRRRRKMITALWSLGVGALIIVLIYLERTAILYILSTVS |
Ga0134123_110180862 | 3300010403 | Terrestrial Soil | MSARTLAADRRRRKLMTLLWALLLTIAVIVLIYKELTAVLYIL |
Ga0134123_124040411 | 3300010403 | Terrestrial Soil | MNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIAV |
Ga0105246_100465031 | 3300011119 | Miscanthus Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGVT |
Ga0137370_106721041 | 3300012285 | Vadose Zone Soil | MNRKTLAGDRRRRKLITALWALGLAALVITLIYLEKT |
Ga0164308_114903592 | 3300012985 | Soil | MNRKTLAGDRRRRKLNTALWSLGVAIVVIALIYWERIAI |
Ga0157371_107403672 | 3300013102 | Corn Rhizosphere | MNRKTIAGERRRRKLMTALWALGVAAVVITLIYLEQSAILYILCT |
Ga0157372_114530561 | 3300013307 | Corn Rhizosphere | MNNMNRKTIAGERRRRKLMTALWALGVAAVVITLIYLEQSAILYILCTVSIAV |
Ga0157372_118919351 | 3300013307 | Corn Rhizosphere | MNRKTLAGDRRRRKLITALWALGLAVVVITLIYLEKTAILYI |
Ga0120188_10067832 | 3300013760 | Terrestrial | MNKRNAATDRRRRKLITGLWALALSTFVIVLIVLEKTAILYILA |
Ga0182001_106654561 | 3300014488 | Soil | VNRKTLAGDRRRRKLITALWALLLAVVVIVLIYLEKT |
Ga0157377_104651122 | 3300014745 | Miscanthus Rhizosphere | MNRKTIAGDRRRRKLMTALWALGVAAVVITLIYLE |
Ga0182005_12480451 | 3300015265 | Rhizosphere | MSRKTLAADRRRRKLFTLLWAALLTLAVIILIYKEQTAILYILCTLGVAVLMII |
Ga0132258_137537242 | 3300015371 | Arabidopsis Rhizosphere | MNRRTLAADRRRRKLITLLWAALLTIGVIVLIYKEQTAILYILCTLGVAALMIVVAFS |
Ga0132257_1038566562 | 3300015373 | Arabidopsis Rhizosphere | MNRKTLAGDRRRRKMITLLWALGLAALVITLIVLEKTAILYI |
Ga0190265_100386875 | 3300018422 | Soil | MNQKTLASDRRRRKLITALWALGLAAVVIALIYLERTAILYILCTLGVCV |
Ga0190268_110493022 | 3300018466 | Soil | MNRKTVASDRRRRKLITFLWAAALAAVVITLIYLERTAILYILC |
Ga0207647_104983122 | 3300025904 | Corn Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGVTVL |
Ga0207645_102491362 | 3300025907 | Miscanthus Rhizosphere | MNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMT |
Ga0207643_104603322 | 3300025908 | Miscanthus Rhizosphere | MNRRTLAGDRRRRKMITALWSLGVGALIITLIYLERTAILYILS |
Ga0207654_101565852 | 3300025911 | Corn Rhizosphere | MNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAI |
Ga0207654_106215511 | 3300025911 | Corn Rhizosphere | MNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILCTVSIAVLL |
Ga0207686_107358421 | 3300025934 | Miscanthus Rhizosphere | MNRRTLAGDRRRRKMITVLWSLGVGALIITLIYLERTAIL |
Ga0207670_113736591 | 3300025936 | Switchgrass Rhizosphere | MNRRTLAGDRRRRTMITALWSLGVGVLMIVLTYLERT |
Ga0207711_104696111 | 3300025941 | Switchgrass Rhizosphere | MNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILSV |
Ga0207711_107080051 | 3300025941 | Switchgrass Rhizosphere | MAGDRRRRKLITALWALGVGAVVIGLIYFERTAILYILCTVSIGV |
Ga0207679_118801761 | 3300025945 | Corn Rhizosphere | MNRRTLAGDRRRRKMITALWSLGVGALIIVLIYLERTAILYILSTV |
Ga0207651_100463281 | 3300025960 | Switchgrass Rhizosphere | MNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKT |
Ga0207651_110560321 | 3300025960 | Switchgrass Rhizosphere | MAGDRRRRKLITALWALGLTLLVIVLIYLEQTAILYILCTVGVAVL |
Ga0207677_118414162 | 3300026023 | Miscanthus Rhizosphere | MNRRTLAGDRRRRKMITALWSLGVGALIITLIYLERTA |
Ga0207703_100961333 | 3300026035 | Switchgrass Rhizosphere | MNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILY |
Ga0207703_121895072 | 3300026035 | Switchgrass Rhizosphere | MNRKSVAGDRRRRKTITGLWVLGISAVIIFLIYKEMTAVLYILATVGVSILLLTVAFS |
Ga0207641_106659942 | 3300026088 | Switchgrass Rhizosphere | MNRKTLAGDRRRRKLMTALWTLLLTVVIVTLMYLEQSAI |
Ga0207641_123933741 | 3300026088 | Switchgrass Rhizosphere | MSARTLAADRRRRKLITLLWALLLTVAVIILIYKELTA |
Ga0207676_108495381 | 3300026095 | Switchgrass Rhizosphere | MNKKTLAGDRRRRKTITALWVLGISLLVIFLIYKEMSA |
Ga0207674_103455483 | 3300026116 | Corn Rhizosphere | VNRKTLAGDRRRRKLMTALWALLLAVVVITLIYLEKTA |
Ga0207674_116126572 | 3300026116 | Corn Rhizosphere | MNRKTVASDRRRRKLNTALWALGVTAVVVALIYFERTAILYILCTVSI |
Ga0207683_103851011 | 3300026121 | Miscanthus Rhizosphere | MNKKTLASDRRRRKTITLLWVLGVSLLVIFLIYKEMTAILYILATIGV |
Ga0207698_108015861 | 3300026142 | Corn Rhizosphere | MNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILCTVSIAV |
Ga0209488_112259262 | 3300027903 | Vadose Zone Soil | MSGRKTLAGDRRHRQLITALWVFGLSLLVIMLIYWEQSAILYILA |
Ga0268265_103545972 | 3300028380 | Switchgrass Rhizosphere | MNRKTLAGDRRRRKLITLLWALGLSLAVILLIYFEKTAILYI |
Ga0268241_100039921 | 3300030511 | Soil | MSRKTLAGDRRRRKTITALWALGLAALVITLIVLEKTAILYILCTLGVAVLL |
Ga0310813_104618762 | 3300031716 | Soil | MNRRTLAGDRRRRKMITALWSLGVGALIIVLIYLERTAILYILSTVSI |
Ga0310813_123851072 | 3300031716 | Soil | MNRRTLAADRRRRKLITLLWAALLTIGVIVLIYKEQTAILYILC |
Ga0310813_123940282 | 3300031716 | Soil | MNRKTITGERRRRKMITLSWVIALTAIVITLIYFEKTAILYILC |
Ga0307407_100957701 | 3300031903 | Rhizosphere | MNRKTVAGDRRRRKLITVLWALALGALVITLIYLEKTAILYILCTLGVT |
⦗Top⦘ |