NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077760

Metagenome / Metatranscriptome Family F077760

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077760
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 45 residues
Representative Sequence MNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILC
Number of Associated Samples 94
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 79.31 %
% of genes near scaffold ends (potentially truncated) 99.15 %
% of genes from short scaffolds (< 2000 bps) 93.16 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.291 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere
(11.111 % of family members)
Environment Ontology (ENVO) Unclassified
(54.701 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(72.650 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.94%    β-sheet: 0.00%    Coil/Unstructured: 43.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF10531SLBB 70.09
PF02563Poly_export 5.13
PF00106adh_short 3.42
PF07609DUF1572 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG1596Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp foldCell wall/membrane/envelope biogenesis [M] 5.13


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.29 %
UnclassifiedrootN/A1.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918013|NODE_1599_length_1535_cov_12.218241All Organisms → cellular organisms → Bacteria → Acidobacteria1567Open in IMG/M
2162886013|SwBSRL2_contig_13260207All Organisms → cellular organisms → Bacteria → Acidobacteria914Open in IMG/M
3300002128|JGI24036J26619_10090068All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300002244|JGI24742J22300_10092086All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300004114|Ga0062593_101975494All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300005093|Ga0062594_100350398All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300005238|Ga0073692_1041352All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300005332|Ga0066388_106726777All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300005332|Ga0066388_106994807All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300005337|Ga0070682_100582678All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300005338|Ga0068868_100726674All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300005354|Ga0070675_101023897All Organisms → cellular organisms → Bacteria → Acidobacteria758Open in IMG/M
3300005364|Ga0070673_101447733All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300005438|Ga0070701_11215981All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300005441|Ga0070700_101386738All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300005458|Ga0070681_10241442All Organisms → cellular organisms → Bacteria → Acidobacteria1720Open in IMG/M
3300005467|Ga0070706_101696133All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300005535|Ga0070684_100771051All Organisms → cellular organisms → Bacteria → Acidobacteria898Open in IMG/M
3300005539|Ga0068853_102097704All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300005543|Ga0070672_100679282All Organisms → cellular organisms → Bacteria → Acidobacteria901Open in IMG/M
3300005545|Ga0070695_100104908All Organisms → cellular organisms → Bacteria → Acidobacteria1909Open in IMG/M
3300005545|Ga0070695_100142702All Organisms → cellular organisms → Bacteria → Acidobacteria1663Open in IMG/M
3300005545|Ga0070695_100385363All Organisms → cellular organisms → Bacteria → Acidobacteria1059Open in IMG/M
3300005546|Ga0070696_101278895All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300005577|Ga0068857_101507709All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300005578|Ga0068854_100154542All Organisms → cellular organisms → Bacteria → Acidobacteria1772Open in IMG/M
3300005578|Ga0068854_100767418All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300005615|Ga0070702_100486501All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300005615|Ga0070702_101875363All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300005616|Ga0068852_102361181All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300005617|Ga0068859_100516510All Organisms → cellular organisms → Bacteria → Acidobacteria1289Open in IMG/M
3300005617|Ga0068859_101018401All Organisms → cellular organisms → Bacteria → Acidobacteria910Open in IMG/M
3300005618|Ga0068864_101047845All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300005618|Ga0068864_102178077All Organisms → cellular organisms → Bacteria → Acidobacteria561Open in IMG/M
3300005718|Ga0068866_10586052All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300005719|Ga0068861_100532272All Organisms → cellular organisms → Bacteria → Acidobacteria1067Open in IMG/M
3300005834|Ga0068851_10776027All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300005841|Ga0068863_101342813All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300005842|Ga0068858_100779360All Organisms → cellular organisms → Bacteria → Acidobacteria932Open in IMG/M
3300006169|Ga0082029_1190693All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300006846|Ga0075430_101687222All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300006852|Ga0075433_10966516All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300006854|Ga0075425_100776568All Organisms → cellular organisms → Bacteria → Acidobacteria1098Open in IMG/M
3300006871|Ga0075434_100321287All Organisms → cellular organisms → Bacteria → Acidobacteria1568Open in IMG/M
3300006918|Ga0079216_10773661All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300006954|Ga0079219_10012651All Organisms → cellular organisms → Bacteria2893Open in IMG/M
3300007004|Ga0079218_10123088All Organisms → cellular organisms → Bacteria → Acidobacteria1836Open in IMG/M
3300007004|Ga0079218_11580420All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300009036|Ga0105244_10194838All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300009093|Ga0105240_10837485All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300009098|Ga0105245_13284916Not Available500Open in IMG/M
3300009101|Ga0105247_11314540All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300009174|Ga0105241_11558995All Organisms → cellular organisms → Bacteria → Acidobacteria638Open in IMG/M
3300009174|Ga0105241_12478408All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300009177|Ga0105248_10732834All Organisms → cellular organisms → Bacteria → Acidobacteria1115Open in IMG/M
3300009177|Ga0105248_12560455All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300009177|Ga0105248_13243651All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300009551|Ga0105238_13068128All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300009553|Ga0105249_12626569All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300010038|Ga0126315_11000740All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300010039|Ga0126309_10307185All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300010045|Ga0126311_10000966All Organisms → cellular organisms → Bacteria13519Open in IMG/M
3300010046|Ga0126384_11765098All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300010047|Ga0126382_11154635All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300010047|Ga0126382_12285626All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300010166|Ga0126306_10743334All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300010373|Ga0134128_11600571All Organisms → cellular organisms → Bacteria → Acidobacteria717Open in IMG/M
3300010375|Ga0105239_12677726All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300010397|Ga0134124_10297117All Organisms → cellular organisms → Bacteria → Acidobacteria1504Open in IMG/M
3300010400|Ga0134122_11218649All Organisms → cellular organisms → Bacteria → Acidobacteria755Open in IMG/M
3300010403|Ga0134123_10739548All Organisms → cellular organisms → Bacteria → Acidobacteria968Open in IMG/M
3300010403|Ga0134123_11018086All Organisms → cellular organisms → Bacteria → Acidobacteria845Open in IMG/M
3300010403|Ga0134123_12404041All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300011119|Ga0105246_10046503All Organisms → cellular organisms → Bacteria → Acidobacteria2960Open in IMG/M
3300012285|Ga0137370_10672104All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300012985|Ga0164308_11490359All Organisms → cellular organisms → Bacteria → Acidobacteria621Open in IMG/M
3300013102|Ga0157371_10740367All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300013307|Ga0157372_11453056All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300013307|Ga0157372_11891935All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300013760|Ga0120188_1006783All Organisms → cellular organisms → Bacteria → Acidobacteria943Open in IMG/M
3300014488|Ga0182001_10665456All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300014745|Ga0157377_10465112All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300015265|Ga0182005_1248045All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes550Open in IMG/M
3300015371|Ga0132258_13753724All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1035Open in IMG/M
3300015373|Ga0132257_103856656All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300018422|Ga0190265_10038687All Organisms → cellular organisms → Bacteria4046Open in IMG/M
3300018466|Ga0190268_11049302All Organisms → cellular organisms → Bacteria → Acidobacteria656Open in IMG/M
3300025904|Ga0207647_10498312All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300025907|Ga0207645_10249136All Organisms → cellular organisms → Bacteria → Acidobacteria1175Open in IMG/M
3300025908|Ga0207643_10460332All Organisms → cellular organisms → Bacteria → Acidobacteria810Open in IMG/M
3300025911|Ga0207654_10156585All Organisms → cellular organisms → Bacteria → Acidobacteria1468Open in IMG/M
3300025911|Ga0207654_10621551All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300025934|Ga0207686_10735842All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300025936|Ga0207670_11373659All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300025941|Ga0207711_10469611All Organisms → cellular organisms → Bacteria → Acidobacteria1172Open in IMG/M
3300025941|Ga0207711_10708005All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300025945|Ga0207679_11880176All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300025960|Ga0207651_10046328All Organisms → cellular organisms → Bacteria → Acidobacteria2923Open in IMG/M
3300025960|Ga0207651_11056032All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300026023|Ga0207677_11841416All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300026035|Ga0207703_10096133All Organisms → cellular organisms → Bacteria → Acidobacteria2500Open in IMG/M
3300026035|Ga0207703_12189507All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300026088|Ga0207641_10665994All Organisms → cellular organisms → Bacteria → Acidobacteria1023Open in IMG/M
3300026088|Ga0207641_12393374All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300026095|Ga0207676_10849538All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300026116|Ga0207674_10345548All Organisms → cellular organisms → Bacteria → Acidobacteria1438Open in IMG/M
3300026116|Ga0207674_11612657All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300026121|Ga0207683_10385101All Organisms → cellular organisms → Bacteria → Acidobacteria1289Open in IMG/M
3300026142|Ga0207698_10801586All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300027903|Ga0209488_11225926All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300028380|Ga0268265_10354597All Organisms → cellular organisms → Bacteria → Acidobacteria1341Open in IMG/M
3300030511|Ga0268241_10003992All Organisms → cellular organisms → Bacteria → Acidobacteria2702Open in IMG/M
3300031716|Ga0310813_10461876All Organisms → cellular organisms → Bacteria → Acidobacteria1103Open in IMG/M
3300031716|Ga0310813_12385107All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300031716|Ga0310813_12394028All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300031903|Ga0307407_10095770All Organisms → cellular organisms → Bacteria → Acidobacteria1831Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere11.11%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere8.55%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere5.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere5.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.13%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.13%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.42%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.56%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.71%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.71%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.85%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005238Microbial communities on the surface of aged kaolinite enhanced biochar from soil in Sydney, AustraliaEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Iowa-Corn-GraphCirc_001326802140918013SoilMNRKTISGERRRRKLITLGWVVGLSAIVITLIYFEKTAILYILCTLGVTGLLG
SwBSRL2_0823.000010902162886013Switchgrass RhizosphereMNRRTLAGDRRRRKMMTALWVFLISVAVIVLIYREMTAVLY
JGI24036J26619_1009006823300002128Corn, Switchgrass And Miscanthus RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILAT
JGI24742J22300_1009208623300002244Corn, Switchgrass And Miscanthus RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLG
Ga0062593_10197549413300004114SoilMNRKTLAGDRRRRKLITVAWSLGVSILVIVLISLEKTAILYILSTVS
Ga0058861_1075563613300004800Host-AssociatedMNRRTLADDRRRRKMLTALWVFLISIAVIILIYREMTAVLYILATLGVTALLLVVAFS
Ga0062594_10035039813300005093SoilMNRKTLAGDRRRRKLMTSLWALGVSIAVIVLIYFEKTAILYVLC
Ga0073692_104135213300005238SoilMNRKTIASDRRRRKLITALWALGITAVVVVLIYFERTAILYILCTVSIGML
Ga0066388_10672677713300005332Tropical Forest SoilMNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIAVLLL
Ga0066388_10699480723300005332Tropical Forest SoilMNRKTLTSDRRRRKTITLVWALVLAAVVITLIYLEKTAILYILCTLGVTAL
Ga0070682_10058267813300005337Corn RhizosphereMNRKTISGERRRRKLITLGWVVGLTAIVITLIYFEKTAILYILC
Ga0068868_10072667423300005338Miscanthus RhizosphereMNRRTLADDRRRRKMMTALWVFLVSIAVIILIYREMSAVLYI
Ga0070675_10102389713300005354Miscanthus RhizosphereMNRKTLAGDRRRRKMITFLWALGLGAVVIALIYLEKTAILYILCTLG
Ga0070673_10144773323300005364Switchgrass RhizosphereMAGDRRRRKLITALWALGLTVLVIVLIYLEQTAILYILCTV
Ga0070701_1121598123300005438Corn, Switchgrass And Miscanthus RhizosphereMNRKSMAGDRRRRKLITALWALGLTLLVIVLIYLEQTAILYILC
Ga0070700_10138673813300005441Corn, Switchgrass And Miscanthus RhizosphereMNRKTIAGERRRRKLMTALWALGVAAVVITLIYLEQSAILYILCTVSIAV
Ga0070681_1024144213300005458Corn RhizosphereMSRKTLGDDRRRRKTITLVWALVLAAIVITLIYREQTAILYILCTLGVT
Ga0070706_10169613323300005467Corn, Switchgrass And Miscanthus RhizosphereMNRKTIAGDRRRRKMMTLLWALGLAAVVITLIILEKTAIL
Ga0070684_10077105113300005535Corn RhizosphereMNKKTLASDRRRRKTITLLWVLGVSLLVIFLIYKEMTAILYILATIGVT
Ga0068853_10209770423300005539Corn RhizosphereMAGDRRRRKLITALWALGVTAVVITLIYLERTAILYILCTVSIAVLLL
Ga0070672_10067928213300005543Miscanthus RhizosphereMNRKTIAGDRRRRKLMTTLWALGVAAVVITLIYLEQS
Ga0070695_10010490833300005545Corn, Switchgrass And Miscanthus RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGV
Ga0070695_10014270213300005545Corn, Switchgrass And Miscanthus RhizosphereMNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILC
Ga0070695_10038536323300005545Corn, Switchgrass And Miscanthus RhizosphereMNRRTLAGDRRRRKMITALWSLGVGVLMIVLIYLERTAILYILSTVSIAVL
Ga0070696_10127889513300005546Corn, Switchgrass And Miscanthus RhizosphereMSRKTLAGDRRRRKMITLAWVLGLAAVVITLIVLEKTAILYILCTL
Ga0068857_10150770913300005577Corn RhizosphereMSRRTLADDRRRRKMMTALWVFLVSLAVIILIYREMSAVLYILATLGVTALLLVVAFSD
Ga0068854_10015454233300005578Corn RhizosphereMNQKTMAGDRRRRKLITVLWALGLTVLVIVLIYLERSDILYILCTL
Ga0068854_10076741823300005578Corn RhizosphereMNRKTLAGDRRRRKLMTALWSLGVAAVVITLIYLERTAILYI
Ga0070702_10048650113300005615Corn, Switchgrass And Miscanthus RhizosphereMNRKTLAGDRRRRKLMTALWTLLLTVVIVTLMYLEQSAILYILSTVSI
Ga0070702_10187536313300005615Corn, Switchgrass And Miscanthus RhizosphereMNRKTLAGDRRRRKLITALWSLGVAAVVITLIYLERTAILYILCTVSIAVL
Ga0068852_10236118113300005616Corn RhizosphereMNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSI
Ga0068859_10051651013300005617Switchgrass RhizosphereMNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAIL
Ga0068859_10101840123300005617Switchgrass RhizosphereMNRKRAAGDRRRRKLITLLWALGVTAVIIALIYFE
Ga0068864_10104784523300005618Switchgrass RhizosphereMNKKTLAGDRRRRKTITALWVLGISLLVIFLIYKEMSAVLYILATLGVTVLLMMV
Ga0068864_10217807723300005618Switchgrass RhizosphereMNRKTIAGDRRRRKLMTALWSLGVAAVVITLIYLERTAILYILCTVSIAVLLLI
Ga0068866_1058605213300005718Miscanthus RhizosphereMNRKTLASDRRRRKTITGLWILGISIVVIFLIYKEMTAVLYIL
Ga0068861_10053227213300005719Switchgrass RhizosphereMNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIAVLLLI
Ga0068851_1077602723300005834Corn RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAV
Ga0068863_10134281313300005841Switchgrass RhizosphereMNRKTLAGDRRRRKMMTALWAGLVALAVIILMYKEQTAILYILC
Ga0068858_10077936023300005842Switchgrass RhizosphereMNRKTLASDRRRRKTITGLWILGISIVVIFLIYKEMTAVLYILA
Ga0082029_119069323300006169Termite NestMNRKTLAGDRRRRKLITALWSLGVAAVVILLIYLERTA
Ga0075430_10168722213300006846Populus RhizosphereMAGDRRRRKLIAALWALGLAGVVIVLIYLEQTAVLYILCTLGITALLVI
Ga0075433_1096651623300006852Populus RhizosphereMNQRTLAGDRRRRKMITALWALGITAVIVTLIYLERTAILYILCTVSVAV
Ga0075425_10077656813300006854Populus RhizosphereMNRRTLAGDRRRRKTLTALWVFLISIAVIILIYREMTAVLYILA
Ga0075434_10032128713300006871Populus RhizosphereMNQKTLAGDRRRRKLITALWALGLAVIVITLIYLEKTAILYILCTLGVT
Ga0079216_1077366123300006918Agricultural SoilMNGKRNAAADRRRRKLITGLWALALSAVVIVLIVL
Ga0079219_1001265143300006954Agricultural SoilMNRKTLAGDRRRRKLITALWALGISAIVVTLIYFERTAIL
Ga0079218_1012308813300007004Agricultural SoilMNRKTLAGDRRRRKLITFGWALALAALVITLIYFEKT
Ga0079218_1158042013300007004Agricultural SoilMNGKRNAAADRRRRKLITGLWALALSAVVIVLIVLEKTAILYI
Ga0105244_1019483813300009036Miscanthus RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGVTVLL
Ga0105240_1083748523300009093Corn RhizosphereMNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIA
Ga0105245_1328491613300009098Miscanthus RhizosphereMNRKTIAGDRRRRKLMTALWALGIGAVVITLIYLEQSAILYILCTVSIAVLL
Ga0105247_1131454013300009101Switchgrass RhizosphereMNRKTIAGDRRRRKLITALWVLGIAAVVITLIYLEQSAILY
Ga0105241_1155899513300009174Corn RhizosphereMNRKTAAGERRLRKLIPLLWALGVTAVIIALIYFERTAILYILCT
Ga0105241_1247840813300009174Corn RhizosphereMNRRTLSGDRRRRKMITALWSLGVAALVIALVYLERTEILYILSTVSVA
Ga0105248_1073283423300009177Switchgrass RhizosphereMNRKTLAGDRRRRKLMTSLWALGVSIAVIVLIYFEKTAILYVLCTLAV
Ga0105248_1256045513300009177Switchgrass RhizosphereMNRKTLAGDRRRRKMMTTLWALGLSLVVILLIYFEKTAILYILCTLG
Ga0105248_1324365113300009177Switchgrass RhizosphereMNRKTITGERRRRKMITMGWVIALTAIVITLIYFEKTAI
Ga0105238_1306812823300009551Corn RhizosphereMNRKTLAGDRRRRKLITALYAFAITGVVIALIYFERTAILYILCTVSIAVLLLIV
Ga0105249_1262656913300009553Switchgrass RhizosphereMNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSA
Ga0126315_1100074013300010038Serpentine SoilMNRKTLASDRRRRKLITALWALGVTAFVVILIYLERTAILYILCTVSIAV
Ga0126309_1030718513300010039Serpentine SoilMNRKTLAGDRRRRKLITLLWTLGLAAIVITLIYLEKTAILY
Ga0126311_1000096613300010045Serpentine SoilMNRRTLAGDRRRRKMITALWALGVSAVVILLIYLERTAILYILCTLSIAALLM
Ga0126384_1176509813300010046Tropical Forest SoilMMSRKTLAADRRRRKLFTLLWAALLSLAVIILIYKEQTAILYILCTVGVAV
Ga0126382_1115463513300010047Tropical Forest SoilMNRRTLAGDRRRRKMITALWSLGVAAVVIVLIYFERS
Ga0126382_1228562613300010047Tropical Forest SoilMNRRTLAGDRRRRKMMTALWAILFSVGTIVLIYREMTAVLYILATLGV
Ga0126306_1074333413300010166Serpentine SoilMNRKTLAGDRRRRKLITTLWALGLSAVVIALIYLERTAILYILCTL
Ga0134128_1160057113300010373Terrestrial SoilMSRKTLAGDRRRRKMITLAWVLGLAGVVITLIVLEKTAILYILCTLGVTV
Ga0105239_1267772613300010375Corn RhizosphereMNRRTIAGDRRRRKMITALWSLGVAAVIIALIYLERTAML
Ga0134124_1029711713300010397Terrestrial SoilMSQKTLAGDRRRRKLMTALWSLGVAAVVITLIYLERTAILYIL
Ga0134122_1121864913300010400Terrestrial SoilMNRKTLAGDRRRRKTITALWVLVISILVIVLIYKEM
Ga0134123_1073954813300010403Terrestrial SoilMNRRTLAGDRRRRKMITALWSLGVGALIIVLIYLERTAILYILSTVS
Ga0134123_1101808623300010403Terrestrial SoilMSARTLAADRRRRKLMTLLWALLLTIAVIVLIYKELTAVLYIL
Ga0134123_1240404113300010403Terrestrial SoilMNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILYILCTVSIAV
Ga0105246_1004650313300011119Miscanthus RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGVT
Ga0137370_1067210413300012285Vadose Zone SoilMNRKTLAGDRRRRKLITALWALGLAALVITLIYLEKT
Ga0164308_1149035923300012985SoilMNRKTLAGDRRRRKLNTALWSLGVAIVVIALIYWERIAI
Ga0157371_1074036723300013102Corn RhizosphereMNRKTIAGERRRRKLMTALWALGVAAVVITLIYLEQSAILYILCT
Ga0157372_1145305613300013307Corn RhizosphereMNNMNRKTIAGERRRRKLMTALWALGVAAVVITLIYLEQSAILYILCTVSIAV
Ga0157372_1189193513300013307Corn RhizosphereMNRKTLAGDRRRRKLITALWALGLAVVVITLIYLEKTAILYI
Ga0120188_100678323300013760TerrestrialMNKRNAATDRRRRKLITGLWALALSTFVIVLIVLEKTAILYILA
Ga0182001_1066545613300014488SoilVNRKTLAGDRRRRKLITALWALLLAVVVIVLIYLEKT
Ga0157377_1046511223300014745Miscanthus RhizosphereMNRKTIAGDRRRRKLMTALWALGVAAVVITLIYLE
Ga0182005_124804513300015265RhizosphereMSRKTLAADRRRRKLFTLLWAALLTLAVIILIYKEQTAILYILCTLGVAVLMII
Ga0132258_1375372423300015371Arabidopsis RhizosphereMNRRTLAADRRRRKLITLLWAALLTIGVIVLIYKEQTAILYILCTLGVAALMIVVAFS
Ga0132257_10385665623300015373Arabidopsis RhizosphereMNRKTLAGDRRRRKMITLLWALGLAALVITLIVLEKTAILYI
Ga0190265_1003868753300018422SoilMNQKTLASDRRRRKLITALWALGLAAVVIALIYLERTAILYILCTLGVCV
Ga0190268_1104930223300018466SoilMNRKTVASDRRRRKLITFLWAAALAAVVITLIYLERTAILYILC
Ga0207647_1049831223300025904Corn RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMTAVLYILATLGVTVL
Ga0207645_1024913623300025907Miscanthus RhizosphereMNRKTLAGDRRRRKTITALWVLGISILVIVLIYKEMT
Ga0207643_1046033223300025908Miscanthus RhizosphereMNRRTLAGDRRRRKMITALWSLGVGALIITLIYLERTAILYILS
Ga0207654_1015658523300025911Corn RhizosphereMNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAI
Ga0207654_1062155113300025911Corn RhizosphereMNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILCTVSIAVLL
Ga0207686_1073584213300025934Miscanthus RhizosphereMNRRTLAGDRRRRKMITVLWSLGVGALIITLIYLERTAIL
Ga0207670_1137365913300025936Switchgrass RhizosphereMNRRTLAGDRRRRTMITALWSLGVGVLMIVLTYLERT
Ga0207711_1046961113300025941Switchgrass RhizosphereMNRKTIAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILSV
Ga0207711_1070800513300025941Switchgrass RhizosphereMAGDRRRRKLITALWALGVGAVVIGLIYFERTAILYILCTVSIGV
Ga0207679_1188017613300025945Corn RhizosphereMNRRTLAGDRRRRKMITALWSLGVGALIIVLIYLERTAILYILSTV
Ga0207651_1004632813300025960Switchgrass RhizosphereMNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKT
Ga0207651_1105603213300025960Switchgrass RhizosphereMAGDRRRRKLITALWALGLTLLVIVLIYLEQTAILYILCTVGVAVL
Ga0207677_1184141623300026023Miscanthus RhizosphereMNRRTLAGDRRRRKMITALWSLGVGALIITLIYLERTA
Ga0207703_1009613333300026035Switchgrass RhizosphereMNRKTVAGDRRRRKLMTALWALGIAAVVITLIYLEQSAILY
Ga0207703_1218950723300026035Switchgrass RhizosphereMNRKSVAGDRRRRKTITGLWVLGISAVIIFLIYKEMTAVLYILATVGVSILLLTVAFS
Ga0207641_1066599423300026088Switchgrass RhizosphereMNRKTLAGDRRRRKLMTALWTLLLTVVIVTLMYLEQSAI
Ga0207641_1239337413300026088Switchgrass RhizosphereMSARTLAADRRRRKLITLLWALLLTVAVIILIYKELTA
Ga0207676_1084953813300026095Switchgrass RhizosphereMNKKTLAGDRRRRKTITALWVLGISLLVIFLIYKEMSA
Ga0207674_1034554833300026116Corn RhizosphereVNRKTLAGDRRRRKLMTALWALLLAVVVITLIYLEKTA
Ga0207674_1161265723300026116Corn RhizosphereMNRKTVASDRRRRKLNTALWALGVTAVVVALIYFERTAILYILCTVSI
Ga0207683_1038510113300026121Miscanthus RhizosphereMNKKTLASDRRRRKTITLLWVLGVSLLVIFLIYKEMTAILYILATIGV
Ga0207698_1080158613300026142Corn RhizosphereMNRKTVAGDRRRRKLITALWALGVAAVVITLIYLEKTAILYILCTVSIAV
Ga0209488_1122592623300027903Vadose Zone SoilMSGRKTLAGDRRHRQLITALWVFGLSLLVIMLIYWEQSAILYILA
Ga0268265_1035459723300028380Switchgrass RhizosphereMNRKTLAGDRRRRKLITLLWALGLSLAVILLIYFEKTAILYI
Ga0268241_1000399213300030511SoilMSRKTLAGDRRRRKTITALWALGLAALVITLIVLEKTAILYILCTLGVAVLL
Ga0310813_1046187623300031716SoilMNRRTLAGDRRRRKMITALWSLGVGALIIVLIYLERTAILYILSTVSI
Ga0310813_1238510723300031716SoilMNRRTLAADRRRRKLITLLWAALLTIGVIVLIYKEQTAILYILC
Ga0310813_1239402823300031716SoilMNRKTITGERRRRKMITLSWVIALTAIVITLIYFEKTAILYILC
Ga0307407_1009577013300031903RhizosphereMNRKTVAGDRRRRKLITVLWALALGALVITLIYLEKTAILYILCTLGVT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.