Metagenome / Metatranscriptome Family F077743

Basic Information
Family ID	F077743
Family Type	Metagenome / Metatranscriptome
Number of Sequences	117
Average Sequence Length	42 residues
Representative Sequence	RGYPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Number of Associated Samples	96
Number of Associated Scaffolds	117

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.56 %
% of genes near scaffold ends (potentially truncated)	94.87 %
% of genes from short scaffolds (< 2000 bps)	93.16 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Bacteria (70.085 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (23.932 % of family members)
Environment Ontology (ENVO)	Unclassified (36.752 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (47.009 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF06736	TMEM175	11.11
PF01035	DNA_binding_1	5.98
PF03129	HGTP_anticodon	5.13
PF07676	PD40	5.13
PF12006	DUF3500	4.27
PF01266	DAO	3.42
PF07040	DUF1326	3.42
PF08281	Sigma70_r4_2	2.56
PF02525	Flavodoxin_2	2.56
PF00892	EamA	1.71
PF12706	Lactamase_B_2	1.71
PF00970	FAD_binding_6	1.71
PF04542	Sigma70_r2	1.71
PF13205	Big_5	0.85
PF12697	Abhydrolase_6	0.85
PF09851	SHOCT	0.85
PF01872	RibD_C	0.85
PF03577	Peptidase_C69	0.85
PF13560	HTH_31	0.85
PF01479	S4	0.85
PF01061	ABC2_membrane	0.85
PF03018	Dirigent	0.85
PF10313	DUF2415	0.85
PF00440	TetR_N	0.85
PF00196	GerE	0.85
PF04041	Glyco_hydro_130	0.85
PF04689	S1FA	0.85
PF13191	AAA_16	0.85
PF12847	Methyltransf_18	0.85

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG3548	Uncharacterized membrane protein	Function unknown [S]	11.11
COG0350	DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)	Replication, recombination and repair [L]	5.98
COG3695	Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain	Transcription [K]	5.98
COG0124	Histidyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	5.13
COG0423	Glycyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	5.13
COG0441	Threonyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	5.13
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	5.13
COG5588	Uncharacterized conserved protein, DUF1326 domain	Function unknown [S]	3.42
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	1.71
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	1.71
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	1.71
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	1.71
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.85
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.85
COG2152	Predicted glycosyl hydrolase, GH43/DUF377 family	Carbohydrate transport and metabolism [G]	0.85
COG4690	Dipeptidase	Amino acid transport and metabolism [E]	0.85

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.09 %
Unclassified	root	N/A	29.91 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.09 %
Unclassified	root	N/A	29.91 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.09 %
Unclassified	root	N/A	29.91 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	48.72 %
Unclassified	root	N/A	29.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.71 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	26.50 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	11.11 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	20.51 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	6.84 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.85 %
Rubrobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria	0.85 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	18.80 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	3.42 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	2.56 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1.71 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.85 %
Jiangellales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales	0.85 %
Rubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales	0.85 %
Chloroflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	18.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.42 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	2.56 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1.71 %
Jiangellaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae	0.85 %
Roseiflexineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae	0.85 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.85 %
Rubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	18.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.42 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	2.56 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1.71 %
Jiangella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella	0.85 %
Roseiflexaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae	0.85 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.85 %
Rubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	18.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.42 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	2.56 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1.71 %
unclassified Chitinophagaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae	0.85 %
Jiangella alba	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba	0.85 %
Roseiflexus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus	0.85 %
Rubrobacter xylanophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	18.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.42 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	2.56 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1.71 %
Chitinophagaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	0.85 %
unclassified Roseiflexus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus	0.85 %
Jiangella alba	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba	0.85 %
Rubrobacter xylanophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.91 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	18.80 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	3.42 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	2.56 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1.71 %
Roseiflexus sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.	0.85 %
Chitinophagaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	0.85 %
Jiangella alba	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba	0.85 %
Rubrobacter xylanophilus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000574\|JGI1357J11328_10206956	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	527	Open in IMG/M
3300000880\|AL20A1W_1347166	Not Available	500	Open in IMG/M
3300000956\|JGI10216J12902_100314483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1952	Open in IMG/M
3300000956\|JGI10216J12902_101531476	Not Available	982	Open in IMG/M
3300000956\|JGI10216J12902_102292658	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2158	Open in IMG/M
3300000956\|JGI10216J12902_103854999	All Organisms → cellular organisms → Bacteria	573	Open in IMG/M
3300000956\|JGI10216J12902_111514131	All Organisms → cellular organisms → Bacteria → Terrabacteria group	513	Open in IMG/M
3300000956\|JGI10216J12902_112625422	All Organisms → cellular organisms → Bacteria → Terrabacteria group	720	Open in IMG/M
3300000956\|JGI10216J12902_114760367	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300000956\|JGI10216J12902_115659492	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp.	2060	Open in IMG/M
3300000956\|JGI10216J12902_117654791	Not Available	608	Open in IMG/M
3300000956\|JGI10216J12902_118211349	Not Available	1374	Open in IMG/M
3300000956\|JGI10216J12902_124942887	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	519	Open in IMG/M
3300002568\|C688J35102_117911282	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium	515	Open in IMG/M
3300004081\|Ga0063454_101327141	Not Available	604	Open in IMG/M
3300004114\|Ga0062593_100615925	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1039	Open in IMG/M
3300004156\|Ga0062589_100770860	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	866	Open in IMG/M
3300004479\|Ga0062595_100116699	All Organisms → cellular organisms → Bacteria	1465	Open in IMG/M
3300004479\|Ga0062595_102522592	Not Available	513	Open in IMG/M
3300005093\|Ga0062594_100662124	Not Available	932	Open in IMG/M
3300005334\|Ga0068869_101159606	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300005341\|Ga0070691_11104186	All Organisms → cellular organisms → Bacteria → Terrabacteria group	500	Open in IMG/M
3300005455\|Ga0070663_101342203	All Organisms → cellular organisms → Bacteria → Terrabacteria group	632	Open in IMG/M
3300005539\|Ga0068853_100443118	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus	1221	Open in IMG/M
3300005543\|Ga0070672_100240261	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1523	Open in IMG/M
3300005545\|Ga0070695_100142526	All Organisms → cellular organisms → Bacteria	1663	Open in IMG/M
3300005764\|Ga0066903_100934972	All Organisms → cellular organisms → Bacteria	1574	Open in IMG/M
3300005834\|Ga0068851_10611754	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	664	Open in IMG/M
3300005844\|Ga0068862_102233726	Not Available	559	Open in IMG/M
3300005985\|Ga0081539_10008755	All Organisms → cellular organisms → Bacteria	8687	Open in IMG/M
3300006046\|Ga0066652_100018163	All Organisms → cellular organisms → Bacteria → Proteobacteria	4762	Open in IMG/M
3300006046\|Ga0066652_100848558	Not Available	873	Open in IMG/M
3300006169\|Ga0082029_1778666	Not Available	1320	Open in IMG/M
3300006358\|Ga0068871_101828077	Not Available	577	Open in IMG/M
3300006358\|Ga0068871_101998882	All Organisms → cellular organisms → Bacteria	552	Open in IMG/M
3300006581\|Ga0074048_12869136	All Organisms → cellular organisms → Bacteria	602	Open in IMG/M
3300006845\|Ga0075421_102639456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	520	Open in IMG/M
3300006852\|Ga0075433_11237953	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	647	Open in IMG/M
3300006953\|Ga0074063_13668071	Not Available	607	Open in IMG/M
3300006954\|Ga0079219_12224722	All Organisms → cellular organisms → Bacteria → Terrabacteria group	528	Open in IMG/M
3300009011\|Ga0105251_10544971	All Organisms → cellular organisms → Bacteria	546	Open in IMG/M
3300009012\|Ga0066710_101456645	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1059	Open in IMG/M
3300009012\|Ga0066710_102833460	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	684	Open in IMG/M
3300009094\|Ga0111539_10451317	Not Available	1497	Open in IMG/M
3300009098\|Ga0105245_10328488	All Organisms → cellular organisms → Bacteria	1509	Open in IMG/M
3300009098\|Ga0105245_11745470	Not Available	675	Open in IMG/M
3300009100\|Ga0075418_11502511	Not Available	731	Open in IMG/M
3300009177\|Ga0105248_10140220	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2727	Open in IMG/M
3300010036\|Ga0126305_10420062	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	884	Open in IMG/M
3300010039\|Ga0126309_11278602	Not Available	507	Open in IMG/M
3300010397\|Ga0134124_10305065	All Organisms → cellular organisms → Bacteria	1485	Open in IMG/M
3300010397\|Ga0134124_11852856	All Organisms → cellular organisms → Bacteria → Terrabacteria group	638	Open in IMG/M
3300010401\|Ga0134121_12142901	All Organisms → cellular organisms → Bacteria → Terrabacteria group	595	Open in IMG/M
3300010403\|Ga0134123_12301761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	602	Open in IMG/M
3300012203\|Ga0137399_10116635	All Organisms → cellular organisms → Bacteria	2091	Open in IMG/M
3300012895\|Ga0157309_10319994	Not Available	530	Open in IMG/M
3300012902\|Ga0157291_10088012	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	821	Open in IMG/M
3300012907\|Ga0157283_10195224	Not Available	634	Open in IMG/M
3300012914\|Ga0157297_10285060	Not Available	614	Open in IMG/M
3300012924\|Ga0137413_11600752	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	532	Open in IMG/M
3300012961\|Ga0164302_11444026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	564	Open in IMG/M
3300012985\|Ga0164308_10610754	Not Available	929	Open in IMG/M
3300012986\|Ga0164304_10291043	Not Available	1115	Open in IMG/M
3300012988\|Ga0164306_11796670	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300013772\|Ga0120158_10362829	Not Available	677	Open in IMG/M
3300013832\|Ga0120132_1149603	Not Available	511	Open in IMG/M
3300014326\|Ga0157380_10041542	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3589	Open in IMG/M
3300015371\|Ga0132258_12074329	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1429	Open in IMG/M
3300015372\|Ga0132256_102139040	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	665	Open in IMG/M
3300017792\|Ga0163161_11674651	All Organisms → cellular organisms → Bacteria	563	Open in IMG/M
3300017965\|Ga0190266_10941766	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300017974\|Ga0187777_10674090	Not Available	732	Open in IMG/M
3300018053\|Ga0184626_10378081	Not Available	571	Open in IMG/M
3300018066\|Ga0184617_1222287	All Organisms → cellular organisms → Bacteria	564	Open in IMG/M
3300018422\|Ga0190265_10723796	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1117	Open in IMG/M
3300018429\|Ga0190272_12232331	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	588	Open in IMG/M
3300018432\|Ga0190275_12631657	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	580	Open in IMG/M
3300018432\|Ga0190275_13458713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	511	Open in IMG/M
3300018466\|Ga0190268_12097882	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	524	Open in IMG/M
3300018476\|Ga0190274_10930714	Not Available	938	Open in IMG/M
3300018476\|Ga0190274_12750459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	589	Open in IMG/M
3300018481\|Ga0190271_12184294	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	660	Open in IMG/M
3300019767\|Ga0190267_11113644	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	568	Open in IMG/M
3300021972\|Ga0193737_1044500	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Jiangellales → Jiangellaceae → Jiangella → Jiangella alba	638	Open in IMG/M
3300025915\|Ga0207693_10552156	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	898	Open in IMG/M
3300025925\|Ga0207650_10511548	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1004	Open in IMG/M
3300025925\|Ga0207650_11668698	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	540	Open in IMG/M
3300025935\|Ga0207709_10180221	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1491	Open in IMG/M
3300025937\|Ga0207669_10042227	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2660	Open in IMG/M
3300025940\|Ga0207691_11582626	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	533	Open in IMG/M
3300025944\|Ga0207661_10348229	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1336	Open in IMG/M
3300025960\|Ga0207651_11129387	All Organisms → cellular organisms → Bacteria	703	Open in IMG/M
3300025961\|Ga0207712_11575162	Not Available	589	Open in IMG/M
3300026118\|Ga0207675_100470388	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1248	Open in IMG/M
3300026118\|Ga0207675_101696072	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	652	Open in IMG/M
3300027787\|Ga0209074_10292083	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	649	Open in IMG/M
3300027876\|Ga0209974_10273969	Not Available	640	Open in IMG/M
3300028720\|Ga0307317_10037822	All Organisms → cellular organisms → Bacteria	1523	Open in IMG/M
3300028720\|Ga0307317_10154928	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	770	Open in IMG/M
3300028771\|Ga0307320_10343105	Not Available	596	Open in IMG/M
3300028784\|Ga0307282_10402166	Not Available	663	Open in IMG/M
3300028787\|Ga0307323_10141437	Not Available	868	Open in IMG/M
3300028828\|Ga0307312_10111159	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1707	Open in IMG/M
3300028875\|Ga0307289_10396098	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	568	Open in IMG/M
3300030336\|Ga0247826_10243315	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1259	Open in IMG/M
3300031226\|Ga0307497_10749594	Not Available	508	Open in IMG/M
3300031833\|Ga0310917_11178728	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	510	Open in IMG/M
3300031854\|Ga0310904_11001947	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300031903\|Ga0307407_10524575	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300031910\|Ga0306923_10434598	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1491	Open in IMG/M
3300032076\|Ga0306924_10422333	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1525	Open in IMG/M
3300032205\|Ga0307472_102380075	All Organisms → cellular organisms → Bacteria → Terrabacteria group	537	Open in IMG/M
3300032421\|Ga0310812_10292814	Not Available	722	Open in IMG/M
3300034114\|Ga0364938_030613	Not Available	870	Open in IMG/M
3300034115\|Ga0364945_0289605	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300034125\|Ga0370484_0076286	Not Available	857	Open in IMG/M
3300034149\|Ga0364929_0164770	All Organisms → cellular organisms → Bacteria → Terrabacteria group	723	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.65%
Host-Associated	Host-Associated	27.35%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	70.09%
Plants	Host-Associated → Plants	27.35%
Aquatic	Environmental → Aquatic	2.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	67.52%
Rhizosphere	Host-Associated → Plants → Rhizosphere	17.09%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.55%
Floodplain	Environmental → Terrestrial → Floodplain	2.56%
Sediment	Environmental → Aquatic → Sediment	1.71%
Roots	Host-Associated → Plants → Roots	1.71%
Freshwater	Environmental → Aquatic → Freshwater	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	59.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.26%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.69%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.84%
Loam	Environmental → Terrestrial → Soil → Loam	5.98%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.71%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.71%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	12.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.26%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.84%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.98%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.42%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.42%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	2.56%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.71%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.71%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.71%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.71%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.71%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.85%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	23.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	11.11%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.27%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.42%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.42%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	2.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.56%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.56%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.56%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.71%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.71%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.71%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.71%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.71%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.71%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.71%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.85%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.85%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.85%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.85%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.85%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.85%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.85%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.85%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.85%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.85%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.85%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental	Open in IMG/M
3300000880	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006953	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300010036	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26	Environmental	Open in IMG/M
3300010039	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012895	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2	Environmental	Open in IMG/M
3300012902	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012914	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental	Open in IMG/M
3300013832	Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300021972	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2	Environmental	Open in IMG/M
3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300028720	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357	Environmental	Open in IMG/M
3300028771	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369	Environmental	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028787	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental	Open in IMG/M
3300030336	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300034114	Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17	Environmental	Open in IMG/M
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental	Open in IMG/M
3300034125	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15	Environmental	Open in IMG/M
3300034149	Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F077743

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI1357J11328_102069561	3300000574	Groundwater	AAEATLLERGFPEPQVKKELYWPKGKEPRGALGAADAAADADE*
AL20A1W_13471661	3300000880	Permafrost	LLDRGYPEEQVHKELYWPKGKEPRGVAGAADVAAAMDAIEANADQ*
JGI10216J12902_1003144833	3300000956	Soil	VHKELYWPKGKEPRGAAGADLAAAIEAAEANADQ*
JGI10216J12902_1015314761	3300000956	Soil	LSAEATLLERGYAEDQVHKELYWPKGKEPRGAAGADLAAAIDAAESNADQ*
JGI10216J12902_1022926581	3300000956	Soil	YPEDQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ*
JGI10216J12902_1038549991	3300000956	Soil	EAAVKKELYWPKGKEPRGLAAADLASAIEEAEANADQ*
JGI10216J12902_1115141311	3300000956	Soil	RGYPEEQVHKELYWPKGKEPRGAAGADLAAAIDAAEANADQ*
JGI10216J12902_1126254221	3300000956	Soil	YPEDQVHKELYWPKGKEPRGMAAADLAAAIEMAEANEDQ*
JGI10216J12902_1147603672	3300000956	Soil	EDQVHKELYWPKGKEPRGATGADLAAAIDAAEANADQ*
JGI10216J12902_1156594923	3300000956	Soil	EQVHKELYWPKGKEPRGLAAADLASAIEAAEHNADQ*
JGI10216J12902_1176547911	3300000956	Soil	RGFEEAAVKKELYWPKGKEPRGLASADLATAIEEAEANADQ*
JGI10216J12902_1182113493	3300000956	Soil	VHKELYWPKGKEPRGLAGADLATAIDAAEHNSDQ*
JGI10216J12902_1249428872	3300000956	Soil	VHKELYWPKGKEPRGLAGADLAQAIDAAEANADQ*
C688J35102_1179112821	3300002568	Soil	LERGYPEEQVHKELYWPKGKEPRGITGAADLAAAMDAAASNADQ*
Ga0063454_1013271412	3300004081	Soil	QTLLARGYPEEQVHKELYWPKGKEPRGLAGAADIAAEIDAAISNSDE*
Ga0062593_1006159252	3300004114	Soil	GYPEEQVHKELYWPKGKEPRGVAAADLAAAIDAAESNADQ*
Ga0062589_1007708602	3300004156	Soil	DMILAAEATLLERGYAEEQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ*
Ga0062595_1001166993	3300004479	Soil	GRGYPEDQVHKELYWPKGKEPRGAAATDLAAAIEAAEANADQ*
Ga0062595_1025225922	3300004479	Soil	LARDYPPEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ*
Ga0062594_1006621242	3300005093	Soil	PEDQVHKELYWPKGKEPRGVVGAADVAAEIDAMAANADQ*
Ga0068869_1011596061	3300005334	Miscanthus Rhizosphere	RGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0070691_111041861	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	LTAEATLLARGYPEDQVHKELYWPKGKEPRGVAGAADVAAAMDAIEANADQ*
Ga0070663_1013422032	3300005455	Corn Rhizosphere	LLARDYPPEQVHKELYWPKGKEPRGLAGADLAAVIEAAEANSDQ*
Ga0068853_1004431183	3300005539	Corn Rhizosphere	RGYPEDQVHKELYWPKGKEPRGVVGAADVAAEIDAMAANADQ*
Ga0070672_1002402611	3300005543	Miscanthus Rhizosphere	EEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0070695_1001425264	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	IARGYPEDQIHKELYWPKGKEPRGVTGAADLAAAIDAAEANADQ*
Ga0066903_1009349724	3300005764	Tropical Forest Soil	RGYPEDQVHKELYWPKGKEPRGVTGADLAAAIEAAEANEDQ*
Ga0068851_106117542	3300005834	Corn Rhizosphere	PEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0068862_1022337261	3300005844	Switchgrass Rhizosphere	RGYPEDQVHKELYWPKGKEPRGASSADLATAIEMAEANEDQ*
Ga0081539_1000875511	3300005985	Tabebuia Heterophylla Rhizosphere	AEETLVGRGYPEDQVHKELYWPKGKEPRGASATDLASAIDAAEANADQ*
Ga0066652_1000181637	3300006046	Soil	EDQVHKELYWPKGKEPRGVSGADLAAAIDAAEANSDQ*
Ga0066652_1008485582	3300006046	Soil	AEQTLLVRGYPEDQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADE*
Ga0082029_17786662	3300006169	Termite Nest	AAEQTFLERGYPEDQVHKELYWPKGKEPRGASAADLAAAIEMAEANEDQ*
Ga0068871_1018280772	3300006358	Miscanthus Rhizosphere	VKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ*
Ga0068871_1019988821	3300006358	Miscanthus Rhizosphere	QVHKELYWPKGKEPRGLAGADLAAAIDAAEANEDQ*
Ga0074048_128691362	3300006581	Soil	GYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0075421_1026394562	3300006845	Populus Rhizosphere	GTLLGLGFAEEAVKKELYWPKGKEPRGASASDLAAAIDAAEANADQ*
Ga0075433_112379532	3300006852	Populus Rhizosphere	DMIIAAEATLLELGLPETAVKKELYWPKGKEPRGVAGAADVAAAEDE*
Ga0074063_136680711	3300006953	Soil	LLGRGYPEDQVHKELYWPKGKEPRGLVGADLAAAIDAAESNEDQ*
Ga0079219_122247221	3300006954	Agricultural Soil	EATLLERGYPGDQVHKELYWPKGKEPRGMAASDLASAIEMAEANEDQ*
Ga0105251_105449711	3300009011	Switchgrass Rhizosphere	ERGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0066710_1014566451	3300009012	Grasslands Soil	EETLLERGFPEEQVKKELYWPKGKEARGAAAPGESPSADLE
Ga0066710_1028334602	3300009012	Grasslands Soil	GYPEEQIHKELYWPKGKEPRGMAAVDIAAAIDAAEANADQ
Ga0111539_104513171	3300009094	Populus Rhizosphere	YAEDQVHKELYWPKGKEPRGVAGAADLAAEIDAAMSNTDQ*
Ga0105245_103284883	3300009098	Miscanthus Rhizosphere	MINSAEATLLSRDYPPEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ*
Ga0105245_117454702	3300009098	Miscanthus Rhizosphere	GYPEDQVHKELYWPKGKEPRGLAGADLAAAIEMAEGNEDQ*
Ga0075418_115025112	3300009100	Populus Rhizosphere	LLERGYAEDQVHKELYWPKGKEPRGVAGAADLAAAIDAAEQNADQ*
Ga0105248_101402201	3300009177	Switchgrass Rhizosphere	EQTLLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ*
Ga0126305_104200621	3300010036	Serpentine Soil	VHKELYWPKGKEPRGVAGAADAAIAADLAEANADQ*
Ga0126309_112786021	3300010039	Serpentine Soil	EDQVHKELYWPKGKEPRGVAAADLATAIDAAEANADQ*
Ga0134124_103050651	3300010397	Terrestrial Soil	VHKELYWPKGKEPRGVAGAADVAAAIDAMEDNADQ*
Ga0134124_118528561	3300010397	Terrestrial Soil	PEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ*
Ga0134121_121429011	3300010401	Terrestrial Soil	QVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ*
Ga0134123_123017611	3300010403	Terrestrial Soil	QVHKELYWPKGKEPRGVAAADLAAAIDAAEANADE*
Ga0137399_101166351	3300012203	Vadose Zone Soil	TLLERGYAEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0157309_103199941	3300012895	Soil	KEQVHKELYWPKGKEPRGLANADLAAAIDAAEHNADQ*
Ga0157291_100880122	3300012902	Soil	MILAAEATLLERGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0157283_101952243	3300012907	Soil	YPEDQVHKELYWPKGKEPRGATAVDLATAIEMAEANQ*
Ga0157297_102850601	3300012914	Soil	LLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ*
Ga0137413_116007521	3300012924	Vadose Zone Soil	LERGYPEGQVHKELYWPKGKEPRGVAEGDLAAAIEAAEEHADQ*
Ga0164302_114440261	3300012961	Soil	MILSAEETLLGRGYPEERVHKELYWPKGKEPRGVAGADLAAAIDAAEANADE*
Ga0164308_106107542	3300012985	Soil	RGYPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ*
Ga0164304_102910432	3300012986	Soil	AEQTLLGRGYPEDQVHKELYWPKGKEPRGLAGADLAAAIEMAEGNEDQ*
Ga0164306_117966701	3300012988	Soil	DMILAAEATLLERGYAEDQVHKELYWPKGKEPRGMVGADLATAIDAAEANADQ*
Ga0120158_103628291	3300013772	Permafrost	QQVHKELYWPKGKEPRGLVGADLASTIEAAEQNQDQ*
Ga0120132_11496032	3300013832	Permafrost	EEQVHKELYWPKGKEPRGMLGADLATAIDAAEANADE*
Ga0157380_100415422	3300014326	Switchgrass Rhizosphere	VIPTHGYWPKGKEPRGVAAADLAAAIDAAEANADQ*
Ga0132258_120743293	3300015371	Arabidopsis Rhizosphere	RGYPADQVHKELYWPKGKEPRGASAMDLAAAIDAAEANEDQ*
Ga0132256_1021390401	3300015372	Arabidopsis Rhizosphere	ATLLERGYPEEQVHKELYWPKGKEPRGVAAGDLAAAIEMAEENADQ*
Ga0163161_116746512	3300017792	Switchgrass Rhizosphere	GYPEDQVHKELYWPKGKEPRGMAGADLATAIDAAEANADQ
Ga0190266_109417661	3300017965	Soil	TLLGLGLPEEAVKKELYWPKGKEPRGAAGADLAAAIDAAEANADQ
Ga0187777_106740902	3300017974	Tropical Peatland	AAEALLTDRGYPEEQVHKELYWPKGKEPRGATAGDLAAAIAAAEANTDE
Ga0184626_103780811	3300018053	Groundwater Sediment	QVHKELYWPKGKEPRGVAAADLAAAIDAAEANADQ
Ga0184617_12222871	3300018066	Groundwater Sediment	PDMILSAESTLLERGYAEEQVHKELYWPKGKEPRGFTGADLAAAIEAAEENADQ
Ga0190265_107237961	3300018422	Soil	ELGLPEEAVKKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Ga0190272_122323311	3300018429	Soil	EQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Ga0190275_126316571	3300018432	Soil	GFPEEAVHKELYWPKGKEPRGLAAADLAAAIDAAEANADQ
Ga0190275_134587131	3300018432	Soil	TLLELGFPEPAVKKELYWPKGKEPRGAAVADLAAAIDAAEMNADQ
Ga0190268_120978821	3300018466	Soil	EDQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ
Ga0190274_109307141	3300018476	Soil	LELGYPEEQVHKELYWPKGKEPRGAAGADLAAAIDAAEANADQ
Ga0190274_127504592	3300018476	Soil	SAEATLLERGYPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Ga0190271_121842943	3300018481	Soil	DLGLPEDAVHKELYWPKGKEPRGLAAADLATAIEAAEHNADQ
Ga0190267_111136442	3300019767	Soil	MILSAEETLLGRGYPQEQVHKELYWPKGKEPRGVAGAADVAAAMDAVEANADQ
Ga0193737_10445001	3300021972	Soil	TLLELDLPETAVKKELYWPKGKEPRGVATADLAAAIDAAEANADQ
Ga0207693_105521562	3300025915	Corn, Switchgrass And Miscanthus Rhizosphere	EATLLARGYPEEQVHKELYWPKGKEPRGVAAGDLAAAIEAAEANADQ
Ga0207650_105115481	3300025925	Switchgrass Rhizosphere	AVKKELYWPKGKEPRGLAAADLAAAIDAAESNADQ
Ga0207650_116686982	3300025925	Switchgrass Rhizosphere	GRGYPEDQVHKELYWPKGKEPRGMAATDLATAIEMAEANEDQ
Ga0207709_101802211	3300025935	Miscanthus Rhizosphere	MILSAEETLLGRGYPEEQVHKELYWPKGKEPRGVAAADLAAAIDAAEANADE
Ga0207669_100422271	3300025937	Miscanthus Rhizosphere	AAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ
Ga0207691_115826262	3300025940	Miscanthus Rhizosphere	YPEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Ga0207661_103482293	3300025944	Corn Rhizosphere	AEQTLLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ
Ga0207651_111293871	3300025960	Switchgrass Rhizosphere	EAILLERGYPEDQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Ga0207712_115751621	3300025961	Switchgrass Rhizosphere	EQTLLELGMPEAAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ
Ga0207675_1004703883	3300026118	Switchgrass Rhizosphere	MILTAEATLLERGFEEAAVKKELYWPKGKEPRGLAAADLASAIEEAEANADQ
Ga0207675_1016960721	3300026118	Switchgrass Rhizosphere	TLLSRDYPPEQVHKELYWPKGKEPRGLAAGDLAAAIDAAEANEDQ
Ga0209074_102920832	3300027787	Agricultural Soil	ELGMAEDAVKKELYWPKGKEPRGATGADLAAAIEAAEANADQ
Ga0209974_102739692	3300027876	Arabidopsis Thaliana Rhizosphere	PEDAVKKELYWPKGKEPRGVTGADLAAAIEAAEANADQ
Ga0307317_100378223	3300028720	Soil	ETLLARGYPEEQVHKELYWPKGKEPRGMAGADLAAAIDAAEANADQ
Ga0307317_101549281	3300028720	Soil	EQVHKELYWPKGKEPRGVAAGDLAAAIEAAEANADQ
Ga0307320_103431051	3300028771	Soil	AEETLLGLGLPEEAIKKELYWPKGKEPRGVAGAADAAADADAEG
Ga0307282_104021661	3300028784	Soil	LGRGYPEEQVHKELYWPKGKEPRGVAAADLAAAIDAAEANADQ
Ga0307323_101414372	3300028787	Soil	ARGYPEEQVHKELYWPKGKEPRGMAGADLAAAIDAAEANADQ
Ga0307312_101111591	3300028828	Soil	LSAEETLIGRGYPEEQVHKELYWPKGKEPRGVVGAADVAAAIDAMEANADQ
Ga0307289_103960981	3300028875	Soil	GRGYPEEQVHKELYWPKGKEPRGVAGADLAAAIEAAEANADQ
Ga0247826_102433152	3300030336	Soil	VIPTHGYWPKGREPRGVAAADLAAAIDAAEANADQ
Ga0307497_107495941	3300031226	Soil	LARGYAEEQVHKELYWPKGKEPRGVAGADLAAAIDAAEANADQ
Ga0310917_111787282	3300031833	Soil	FEEASVKKELYWPKGKEPRGLAAADLASAIEEAEANEDQ
Ga0310904_110019471	3300031854	Soil	EQTLLGRGFAEEAIKKELFWPKGKEPRGLAAADLAAAIDAAEANADQ
Ga0307407_105245753	3300031903	Rhizosphere	QVKKELYWPKGKEPRGVAAADLAAAIDAAEANADQ
Ga0306923_104345981	3300031910	Soil	EEAAVKKELYWPKGKEPRGLAAADLASAIEEAEANEDQ
Ga0306924_104223331	3300032076	Soil	LLDRGFEEASVKKELYWPKGKEPRGLAAADLASAIEEAEANEDQ
Ga0307472_1023800751	3300032205	Hardwood Forest Soil	DRGFEETAVKKELYWPKGKEPRGLAAADLASAIEEAEANADQ
Ga0310812_102928141	3300032421	Soil	ERGFPEEQVKKELYWPKGKEPQGLGTASLAEAIEAIEENADQ
Ga0364938_030613_728_868	3300034114	Sediment	ETLLARGYPEDQVHKELYWPKGTEPRGVAAGDLAAAIDAAEANADQ
Ga0364945_0289605_22_180	3300034115	Sediment	MILAAEATLLDRGYAEAQVHKELYWPKGKEPRGVVGADLATAIEAAEANADQ
Ga0370484_0076286_728_856	3300034125	Untreated Peat Soil	LLERGFPEAQVKKELYWPKGKEPRGVTGAGDSAAAADANADE
Ga0364929_0164770_1_108	3300034149	Sediment	AVKKELYWPKGKEPRGLAGMELASAIEAAEQNADE

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign