Basic Information | |
---|---|
Family ID | F077507 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 37 residues |
Representative Sequence | MSSQGKTYLKFGGATVVILLLLGYLAYTGVQDSKSYY |
Number of Associated Samples | 107 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 73.50 % |
% of genes near scaffold ends (potentially truncated) | 98.29 % |
% of genes from short scaffolds (< 2000 bps) | 87.18 % |
Associated GOLD sequencing projects | 105 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.667 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.547 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.077 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.154 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.23% β-sheet: 0.00% Coil/Unstructured: 50.77% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00719 | Pyrophosphatase | 37.61 |
PF00933 | Glyco_hydro_3 | 4.27 |
PF01964 | ThiC_Rad_SAM | 3.42 |
PF13620 | CarboxypepD_reg | 3.42 |
PF00392 | GntR | 2.56 |
PF01431 | Peptidase_M13 | 2.56 |
PF09907 | HigB_toxin | 1.71 |
PF02452 | PemK_toxin | 1.71 |
PF05649 | Peptidase_M13_N | 1.71 |
PF01915 | Glyco_hydro_3_C | 1.71 |
PF14378 | PAP2_3 | 1.71 |
PF14310 | Fn3-like | 0.85 |
PF12850 | Metallophos_2 | 0.85 |
PF02687 | FtsX | 0.85 |
PF03100 | CcmE | 0.85 |
PF00144 | Beta-lactamase | 0.85 |
PF04389 | Peptidase_M28 | 0.85 |
PF13518 | HTH_28 | 0.85 |
PF09976 | TPR_21 | 0.85 |
PF00903 | Glyoxalase | 0.85 |
PF07228 | SpoIIE | 0.85 |
PF03551 | PadR | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 37.61 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 5.98 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 4.27 |
COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 3.42 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 1.71 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.85 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.85 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.67 % |
Unclassified | root | N/A | 33.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352031|2206289761 | Not Available | 506 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101213041 | Not Available | 602 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100487686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1109 | Open in IMG/M |
3300004092|Ga0062389_102841044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 647 | Open in IMG/M |
3300005537|Ga0070730_10419711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 864 | Open in IMG/M |
3300005538|Ga0070731_10787225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 631 | Open in IMG/M |
3300005538|Ga0070731_10970439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 563 | Open in IMG/M |
3300005542|Ga0070732_10097699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1729 | Open in IMG/M |
3300005552|Ga0066701_10148480 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
3300005554|Ga0066661_10297711 | Not Available | 994 | Open in IMG/M |
3300005568|Ga0066703_10434053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 788 | Open in IMG/M |
3300005591|Ga0070761_10116726 | Not Available | 1547 | Open in IMG/M |
3300005591|Ga0070761_10197436 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
3300005610|Ga0070763_10105843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1424 | Open in IMG/M |
3300005610|Ga0070763_10648732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 615 | Open in IMG/M |
3300005764|Ga0066903_104369395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
3300005829|Ga0074479_10137523 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300005843|Ga0068860_101657657 | Not Available | 661 | Open in IMG/M |
3300005876|Ga0075300_1001838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1755 | Open in IMG/M |
3300005921|Ga0070766_10224360 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300006162|Ga0075030_101318336 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 566 | Open in IMG/M |
3300006176|Ga0070765_102013509 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300006640|Ga0075527_10216525 | Not Available | 554 | Open in IMG/M |
3300006893|Ga0073928_10813238 | Not Available | 645 | Open in IMG/M |
3300006904|Ga0075424_101765431 | Not Available | 655 | Open in IMG/M |
3300009089|Ga0099828_10480382 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300009525|Ga0116220_10237487 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300009628|Ga0116125_1255655 | Not Available | 509 | Open in IMG/M |
3300009632|Ga0116102_1191171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
3300009759|Ga0116101_1000369 | All Organisms → cellular organisms → Bacteria | 4624 | Open in IMG/M |
3300009759|Ga0116101_1038101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1005 | Open in IMG/M |
3300009764|Ga0116134_1160955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 790 | Open in IMG/M |
3300010335|Ga0134063_10441090 | Not Available | 644 | Open in IMG/M |
3300010358|Ga0126370_12514469 | Not Available | 513 | Open in IMG/M |
3300010360|Ga0126372_11597248 | Not Available | 691 | Open in IMG/M |
3300010362|Ga0126377_10670864 | Not Available | 1087 | Open in IMG/M |
3300010373|Ga0134128_10030512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6338 | Open in IMG/M |
3300010376|Ga0126381_103576673 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300010396|Ga0134126_10354861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1710 | Open in IMG/M |
3300011119|Ga0105246_11395970 | Not Available | 653 | Open in IMG/M |
3300011270|Ga0137391_10034640 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4254 | Open in IMG/M |
3300011270|Ga0137391_11372214 | Not Available | 553 | Open in IMG/M |
3300012207|Ga0137381_11626936 | Not Available | 537 | Open in IMG/M |
3300012208|Ga0137376_10929927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300012361|Ga0137360_11473827 | Not Available | 584 | Open in IMG/M |
3300012362|Ga0137361_10396279 | Not Available | 1268 | Open in IMG/M |
3300012582|Ga0137358_10308565 | Not Available | 1074 | Open in IMG/M |
3300012683|Ga0137398_11182032 | Not Available | 523 | Open in IMG/M |
3300012918|Ga0137396_11041040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300012960|Ga0164301_10334017 | Not Available | 1035 | Open in IMG/M |
3300012986|Ga0164304_11622493 | Not Available | 539 | Open in IMG/M |
3300014165|Ga0181523_10064493 | All Organisms → cellular organisms → Bacteria | 2243 | Open in IMG/M |
3300014490|Ga0182010_10323491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300014495|Ga0182015_10288093 | Not Available | 1076 | Open in IMG/M |
3300014657|Ga0181522_10038054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2681 | Open in IMG/M |
3300017926|Ga0187807_1212237 | Not Available | 629 | Open in IMG/M |
3300017932|Ga0187814_10382110 | Not Available | 547 | Open in IMG/M |
3300017933|Ga0187801_10020181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2260 | Open in IMG/M |
3300017948|Ga0187847_10226908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
3300017961|Ga0187778_11310288 | Not Available | 510 | Open in IMG/M |
3300017995|Ga0187816_10305055 | Not Available | 699 | Open in IMG/M |
3300018006|Ga0187804_10333190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
3300018018|Ga0187886_1256705 | Not Available | 659 | Open in IMG/M |
3300018023|Ga0187889_10188742 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Leptospirillum | 954 | Open in IMG/M |
3300018026|Ga0187857_10512820 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300018034|Ga0187863_10126592 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300018034|Ga0187863_10295760 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
3300018034|Ga0187863_10490467 | Not Available | 687 | Open in IMG/M |
3300018035|Ga0187875_10439956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300018040|Ga0187862_10090377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2140 | Open in IMG/M |
3300018040|Ga0187862_10228456 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300018085|Ga0187772_10062445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2320 | Open in IMG/M |
3300018088|Ga0187771_11249436 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300018090|Ga0187770_10914321 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300019787|Ga0182031_1331713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1455 | Open in IMG/M |
3300019787|Ga0182031_1507769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1457 | Open in IMG/M |
3300020061|Ga0193716_1088786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1351 | Open in IMG/M |
3300020580|Ga0210403_10877944 | Not Available | 708 | Open in IMG/M |
3300020583|Ga0210401_10060493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3568 | Open in IMG/M |
3300021046|Ga0215015_10777504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
3300021180|Ga0210396_10210167 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300021420|Ga0210394_10020447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 6141 | Open in IMG/M |
3300021432|Ga0210384_11774689 | Not Available | 522 | Open in IMG/M |
3300023090|Ga0224558_1065171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1402 | Open in IMG/M |
3300025442|Ga0208034_1063837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 712 | Open in IMG/M |
3300025500|Ga0208686_1073624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300025911|Ga0207654_10365254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 997 | Open in IMG/M |
3300025922|Ga0207646_10616776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 973 | Open in IMG/M |
3300026078|Ga0207702_11831943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
3300027825|Ga0209039_10098054 | Not Available | 1260 | Open in IMG/M |
3300027857|Ga0209166_10023559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3804 | Open in IMG/M |
3300027879|Ga0209169_10594649 | Not Available | 578 | Open in IMG/M |
3300027898|Ga0209067_10458800 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300028718|Ga0307307_10165903 | Not Available | 693 | Open in IMG/M |
3300028808|Ga0302228_10058033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1855 | Open in IMG/M |
3300028866|Ga0302278_10473040 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300028906|Ga0308309_10799720 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300029939|Ga0311328_10365358 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1048 | Open in IMG/M |
3300029943|Ga0311340_10858021 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300029953|Ga0311343_11158521 | Not Available | 593 | Open in IMG/M |
3300030057|Ga0302176_10004625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5441 | Open in IMG/M |
3300030494|Ga0310037_10063282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1748 | Open in IMG/M |
3300030813|Ga0265750_1088704 | Not Available | 525 | Open in IMG/M |
3300030814|Ga0265741_103744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 959 | Open in IMG/M |
3300031234|Ga0302325_10395493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2158 | Open in IMG/M |
3300031258|Ga0302318_10226384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 909 | Open in IMG/M |
3300031474|Ga0170818_115430624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
3300031682|Ga0318560_10701103 | Not Available | 547 | Open in IMG/M |
3300031708|Ga0310686_118374508 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300031753|Ga0307477_10704259 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300032094|Ga0318540_10369543 | Not Available | 693 | Open in IMG/M |
3300032160|Ga0311301_10557461 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
3300032174|Ga0307470_10061174 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
3300032180|Ga0307471_101768801 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300032180|Ga0307471_103284152 | Not Available | 573 | Open in IMG/M |
3300032893|Ga0335069_10228849 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
3300032954|Ga0335083_10108436 | All Organisms → cellular organisms → Bacteria | 2714 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.55% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.27% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.42% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.42% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.42% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.56% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.71% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.71% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.71% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.71% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.71% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.71% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.85% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.85% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.85% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.85% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.85% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.85% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.85% |
Speleothem And Rock Wall Surfaces | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352031 | Cave microbial community (Speleothem B) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030814 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2207963899 | 2199352031 | Speleothem And Rock Wall Surfaces | MSSTRNTYLRFGAAISIIVVSLAYLAYTGVEQSKSY |
INPhiseqgaiiFebDRAFT_1012130411 | 3300000364 | Soil | MPSETTKYLKFGAATVAILVMLGYLAYTGVQDSKSYYV |
JGIcombinedJ26739_1004876861 | 3300002245 | Forest Soil | MSSQAKTYLKFGAATVVILLLLGYLAYTGVQDSKS |
Ga0062389_1028410442 | 3300004092 | Bog Forest Soil | MSSQGKTYLKFGGATLLILFLLGYLAYTGVQDSKSYYVTIS |
Ga0070730_104197112 | 3300005537 | Surface Soil | MSGTSSTYLKFGGATVVILLSLGYLAYTGVQESKSYYV |
Ga0070731_107872252 | 3300005538 | Surface Soil | VSNETSKYLKFGGATLVILLVLGYLAYTGVQESKSYY |
Ga0070731_109704391 | 3300005538 | Surface Soil | MSTQTSKYMKFGAATVIILLSLGYLAYTGVQESKSY |
Ga0070732_100976994 | 3300005542 | Surface Soil | MSDQSKTYLKFGAATAVVIMLLGYLAYTGVQDSKSYYV |
Ga0066701_101484801 | 3300005552 | Soil | MLVMSSETSKYLKFGGAILVILISLGFLAYTGVQESKSYY |
Ga0066661_102977112 | 3300005554 | Soil | MSSQLKTYLKFGGATVAILFLLAYLAYTGVQDSKSY |
Ga0066703_104340532 | 3300005568 | Soil | MSSQTSKFLKFGSAMLAILLALGYLAYTGVQESKSYYV |
Ga0070761_101167261 | 3300005591 | Soil | MSSEASKYLKFGAVTVLILFSLGYLAYTGVQDSKSYYV |
Ga0070761_101974361 | 3300005591 | Soil | MASQFNTYLKFGGVTAVILLLLGYLAYTGVQDSKS |
Ga0070763_101058432 | 3300005610 | Soil | MSSQAKTYLKFGAASVVIVLLLGYLAYTGVQDSKSYYV |
Ga0070763_106487321 | 3300005610 | Soil | MSSEAGKYLKFGSVTVLIIVSLGYLAYTGVQDSKSYYV |
Ga0066903_1043693951 | 3300005764 | Tropical Forest Soil | MSSQFKTYLKFGGATVFILLLLGYLPYTGVQDSKSYYVTI |
Ga0074479_101375231 | 3300005829 | Sediment (Intertidal) | MSTQTAKIFKFGAVMAIILVSLAYLAYTGVQESKSYY |
Ga0068860_1016576572 | 3300005843 | Switchgrass Rhizosphere | MSQQSKKYLQFGGAIAIIVVALGYLAFSGVQESKSYYK |
Ga0075300_10018383 | 3300005876 | Rice Paddy Soil | MSKSGSTYLKFGAATVVILVSLAFLAYTGVQESKS |
Ga0070766_102243601 | 3300005921 | Soil | MSSQGNTYLKFGAVTAVIVVLLGYLAYTGVQDSKSYYV |
Ga0075030_1013183361 | 3300006162 | Watersheds | MSSQAKTYLKFGGATVVIFLLLGYLAYTGVQDSKSYYVT |
Ga0070765_1020135092 | 3300006176 | Soil | MSSEANKYLKFGSVTVLILVSLAYLAYTGVQDSKSYYV |
Ga0075527_102165252 | 3300006640 | Arctic Peat Soil | MSSQGNTYLKFGGATAVILLLLGYLAYTGVQDSKSYYV |
Ga0073928_108132381 | 3300006893 | Iron-Sulfur Acid Spring | MSSQTGKFIKFGGSIVIIVLALGYLAYTGVQESKSY |
Ga0075424_1017654311 | 3300006904 | Populus Rhizosphere | MSSETSKYLKFGGVTVVILLALGYLAYTGVQDSKSY |
Ga0099828_104803821 | 3300009089 | Vadose Zone Soil | MSSETSRYVKFSSAVAVILVSLGFLAYTGVQESKS |
Ga0116220_102374871 | 3300009525 | Peatlands Soil | MSSQSKTYLKFGAATLLILFLLGYLGYTGVQDSKSYYVT |
Ga0116125_12556551 | 3300009628 | Peatland | MSHEATKYLKFGAATMAILLSLAYLAYTGVQQSKSY |
Ga0116102_11911712 | 3300009632 | Peatland | MSSEKRSSEASKYLKFGSVTVLILLSLGYLAYTGVQDSKS |
Ga0116101_10003696 | 3300009759 | Peatland | MSSQFKTYLTFGGVTAIIFLLLGYLAYTGVQDSKSYYVTIK |
Ga0116101_10381012 | 3300009759 | Peatland | MSSEASKYLKFGSVTVLIMLSLGYLAYTGVQDSKSYYV |
Ga0116134_11609551 | 3300009764 | Peatland | MSSQGKTYLKFGGATVLILFLLGYLAYTGVQDSKSYY |
Ga0134063_104410902 | 3300010335 | Grasslands Soil | MSSERSKYLKFGGATAVILISLGLLAYTGVQESKIYYVTI |
Ga0126370_125144692 | 3300010358 | Tropical Forest Soil | MSPQASKFLKFGIAMVVILLALGYLAYTGVQQSKR |
Ga0126372_115972481 | 3300010360 | Tropical Forest Soil | MSSQSSKFLKFGSAMVAILLALGYLAYTGVQESKSY |
Ga0126377_106708641 | 3300010362 | Tropical Forest Soil | MFMSSETSKYLKFGGATVLILVMLGYLAYTGVQESKSYY |
Ga0134128_100305125 | 3300010373 | Terrestrial Soil | MASDARKYFKFGGAVVLILLSLGYLAYTGVQESKSY |
Ga0126381_1035766732 | 3300010376 | Tropical Forest Soil | MSSERSKYLKFGGATVLILMMLGYLAYTGVQESKSYYV |
Ga0134126_103548614 | 3300010396 | Terrestrial Soil | MSKEVNKYLKFGSAVVLILLSMGYLAYTGVQESKS |
Ga0105246_113959702 | 3300011119 | Miscanthus Rhizosphere | MSSEINKYLKFGGVTVVILVALGYLAYTGVQDSKSYY |
Ga0137391_100346401 | 3300011270 | Vadose Zone Soil | MSSETSRYVKFGSAVAVILVSLGFLAYTGVQESKSYY |
Ga0137391_113722142 | 3300011270 | Vadose Zone Soil | MSSEGRSREAAKYLKFGSVTVLILVSLGYLAYTGVQDSKS |
Ga0137381_116269361 | 3300012207 | Vadose Zone Soil | MSSETGKYLRFGAATAIILLMLGYLAYTGVQDSKSY |
Ga0137376_109299272 | 3300012208 | Vadose Zone Soil | MSSERSKYLKFGGATAVILISLGFLAYTGVQESKS |
Ga0137360_114738272 | 3300012361 | Vadose Zone Soil | MSSQGKTYLKFGTATVVILFLLGYLAYTGVQDSKSYYVT |
Ga0137361_103962792 | 3300012362 | Vadose Zone Soil | MSSQGKTYLKFGTATVAILFLLGYLAYTGVQDSKSYYVTV |
Ga0137358_103085653 | 3300012582 | Vadose Zone Soil | MSSEANKYLKFGAVTIVILLSLGYLAYTGVQDSKSYY |
Ga0137398_111820321 | 3300012683 | Vadose Zone Soil | MSSQANRYLKFGAVTVVILLSLAYLAYTGVQDSKS |
Ga0137396_110410401 | 3300012918 | Vadose Zone Soil | MSSQVKTYLKFGTARLLIFFLLGYLAYTGVQDSKS* |
Ga0164301_103340172 | 3300012960 | Soil | MAGETGKYLKFGGAVALILLSMGYLAYTGVQESKS |
Ga0164304_116224932 | 3300012986 | Soil | MSQSSSKYLKFGFAITIIVLALSYLAYTGVKESQS |
Ga0181523_100644931 | 3300014165 | Bog | MSSQFKTYLRFGGATAVILLLLGYLAYTGLQDSKSYYV |
Ga0182010_103234911 | 3300014490 | Fen | MSNEASKFLKFGAVTVVILISLGYLAYTGVQDSSTSYYVTIKELND |
Ga0182015_102880932 | 3300014495 | Palsa | MSSQGKTYLKFGAATFVILLLLGYLAYTGVQDSKS |
Ga0181522_100380541 | 3300014657 | Bog | MSSQTSRYFKFGGATVIILLALGYLAYTGVQESKSY |
Ga0187807_12122372 | 3300017926 | Freshwater Sediment | MSSQANIYLKFGGATAVIFLLLGYLAYTGVQDSKS |
Ga0187814_103821101 | 3300017932 | Freshwater Sediment | MSSETSKYVKFGAVTVLILVSLGYLAYTGVQDSKSYY |
Ga0187801_100201814 | 3300017933 | Freshwater Sediment | MSSQAKTYLKFGGATAVILLLLAYLAYTGVQDSKSY |
Ga0187847_102269081 | 3300017948 | Peatland | MSSEISKYLKFGGATLAILLTLGYLAYTGVQESKSY |
Ga0187778_113102881 | 3300017961 | Tropical Peatland | MSSQVKTYLKFGGATVFILLLLGYLAYTGVQDSKSYYV |
Ga0187816_103050552 | 3300017995 | Freshwater Sediment | MSSQANIYLKFGGATAVIFLLLGYLAYTGVQDSKSYYV |
Ga0187804_103331901 | 3300018006 | Freshwater Sediment | MSSQTSRYLKFGGATVVILLALGYLAYTGVQESKS |
Ga0187886_12567052 | 3300018018 | Peatland | MSSQGKTYLKFGSAVVVILLLLGYLAYTGVQDSKSYYV |
Ga0187889_101887421 | 3300018023 | Peatland | MSSQAKTYFKFGGATLVILFLLGYLAYTGVQESKS |
Ga0187857_105128201 | 3300018026 | Peatland | MSSETSKYLKFGSVTVVILMSLAYLAYTGVQDSKSY |
Ga0187863_101265921 | 3300018034 | Peatland | MSSQGKTYLKFGGATVVILLLLGYLAYTGVQDSKSYY |
Ga0187863_102957601 | 3300018034 | Peatland | MSSQVKTYLKFGGATVVIFLLLGYLAYTGVQDSKSYY |
Ga0187863_104904672 | 3300018034 | Peatland | MSNETSKYLKFGSVTVLILCSLGYLAYTGVQDSKSYYVT |
Ga0187875_104399562 | 3300018035 | Peatland | MLTEGSKYLKFGSVTVLILLSLGYLAYTGVQDSKSY |
Ga0187862_100903774 | 3300018040 | Peatland | MSNEASKYLKFGSVTVLILVSLGYLAYTGVQDSKSYYVT |
Ga0187862_102284563 | 3300018040 | Peatland | MSSETSKYLKFGSVTALILMSLAYLAYTGVQDSKSY |
Ga0187772_100624455 | 3300018085 | Tropical Peatland | MSNQAKTYLKFGGATAFILLLLGYLAYTGVQDSKSYYV |
Ga0187771_112494362 | 3300018088 | Tropical Peatland | MSTQGKTYLKFGGATVFILLLLGYLAYTGVQDSKSYYVTI |
Ga0187770_109143212 | 3300018090 | Tropical Peatland | MSSQVKTYLKFGGATAFILLLLGYLAYTGVQDSKSYY |
Ga0182031_13317131 | 3300019787 | Bog | MSSEASKYLKFGSVTVLIMLSLGYLAYTGVQDSKS |
Ga0182031_15077692 | 3300019787 | Bog | MSSETSRFFKFGSVIVLIVVSLGFLAYTGVQDSKSY |
Ga0193716_10887862 | 3300020061 | Soil | VKHRPGDMSKETSKYLKFGGATALIVASLGYLAYTGVQESKSY |
Ga0210403_108779442 | 3300020580 | Soil | MSSQAKIYLKFGGATAVILLLLGYLAYTGVEDSKS |
Ga0210401_100604931 | 3300020583 | Soil | MSSETSKYLKFGGATVVILLMLGYLAYTGVQESKS |
Ga0215015_107775044 | 3300021046 | Soil | MSSQGKTYLKFGSATVVILLLLGYLEYTGVQDSKSYYLSLIH |
Ga0210396_102101671 | 3300021180 | Soil | MGCDMSSQLKTYMKFGGATVAILFLLAYLAYTGVQDSKSYYV |
Ga0210394_100204475 | 3300021420 | Soil | MSSETSRYLKFGGATVVILLALGYLAYTGVQESKSY |
Ga0210384_117746891 | 3300021432 | Soil | MSSESSKYLKFGGATVLILMMLGYLAYTGVQESKS |
Ga0224558_10651711 | 3300023090 | Soil | MSNQAKTYLKFGTATVVILLLLGYLAYTGVQDSKS |
Ga0208034_10638372 | 3300025442 | Peatland | MSSETRSSEASKYLKFGSVTVLILLSLGYLAYTGVQ |
Ga0208686_10736242 | 3300025500 | Peatland | MSSETSKYLKFGSVTVLILFSLAYLAYTGVQDSKS |
Ga0207654_103652542 | 3300025911 | Corn Rhizosphere | MAERNITFWKFGAATVLIVGSLGFLAYTGVQESKSYYVTI |
Ga0207646_106167762 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSSERSKYLKFGGATVVILISLGFLAYTGVQESKSYYV |
Ga0207702_118319431 | 3300026078 | Corn Rhizosphere | MSSQSSKFLKFGIAMVLILLALGYLAYTGVQESKS |
Ga0209039_100980541 | 3300027825 | Bog Forest Soil | MSSEIRKYLKFGSVTVLILVSLGYLAYTGVQDSKSYYVT |
Ga0209166_100235591 | 3300027857 | Surface Soil | MSSQAKVYLKFGGATLVILLLLGYLAYTGVQDSKSYYV |
Ga0209169_105946491 | 3300027879 | Soil | MSSQANTYLKFGAVTVIIFVLLGYLAYSGVQDSKSYYVT |
Ga0209067_104588002 | 3300027898 | Watersheds | MSNQAKTYLKFGGATVFILLLLAYLAYTGVQDSKSYY |
Ga0307307_101659031 | 3300028718 | Soil | MAERNITFWKFGAATVLIVGSLGFLAYTGVQESKSYY |
Ga0302228_100580331 | 3300028808 | Palsa | MSSQFKTYLTFGGVTAVIFLLLGYLAYTGVQDSKSY |
Ga0302278_104730401 | 3300028866 | Bog | MSAEVSRFLKFGGATLAILLSLGYLAYTGVQQSKSY |
Ga0308309_107997201 | 3300028906 | Soil | MSSQAKTYLKFGGATTLILLLLGYLAYTGVQDSKSY |
Ga0311328_103653581 | 3300029939 | Bog | MSSQGKTYLKFGAATVAIFFLLGYLAYTGVQDSKSY |
Ga0311340_108580212 | 3300029943 | Palsa | MSNQAKTYAKFGAAVVVILLLLGYLAYTGVQDSKSY |
Ga0311343_111585211 | 3300029953 | Bog | MSTETSRFLKFGSVIVLIVVSLGFLAYTGVQDSKSYYVTI |
Ga0302176_100046251 | 3300030057 | Palsa | MSSQGKTYLKFGTATVVILLLLGYLAYTGVQDSKSYYVT |
Ga0310037_100632821 | 3300030494 | Peatlands Soil | MSSETRSTEASKYLKFGSVTVLILLSLGYLAYTGVQDSKS |
Ga0265750_10887042 | 3300030813 | Soil | MSSQGKTYLKFGGATLLILFLLGYLAYTGVQDTKSYY |
Ga0265741_1037443 | 3300030814 | Soil | MSSQGNTYLKFGAVTALIVVLLGYLAYTGVQDSKSYYVT |
Ga0302325_103954931 | 3300031234 | Palsa | MSSQNRSSEAGKYLKFGSVTVLILCSLGYLAYTGVQDSK |
Ga0302318_102263843 | 3300031258 | Bog | MSSQGKTYLKFGAATVAIFFLLGYLAYTGVQDSKSYYVTNGELH |
Ga0170818_1154306241 | 3300031474 | Forest Soil | MSSQSGKIVKFGGALVVILLALGYLAYTGVQESKS |
Ga0318560_107011031 | 3300031682 | Soil | MSSQLKTYVKFGGATVAILLLLAYLAYTGVQDSKSY |
Ga0310686_1183745081 | 3300031708 | Soil | MSSEASKYLKFGGVTVLILCSLGYLAYTGVQDSKS |
Ga0307477_107042592 | 3300031753 | Hardwood Forest Soil | MSSQLKTYMKFGGATVAILFLLAYLAYTGVQDSKSYYVTIK |
Ga0318540_103695432 | 3300032094 | Soil | MSRESNTYLKFGGATVLILVMLGYLAYTGVQDSKSYYVTIK |
Ga0311301_105574613 | 3300032160 | Peatlands Soil | MSSEAGRYVKFGSVTVLILLSLGYLAYTGVQDSKSCYVT |
Ga0307470_100611741 | 3300032174 | Hardwood Forest Soil | MSSQLKTYLKFGGATVAILFLLAYLAYTGVQDSKSYYVTIK |
Ga0307471_1017688012 | 3300032180 | Hardwood Forest Soil | MSSQVSTYLKFGGATAVILLLLGYLAYTGVQDSKSYY |
Ga0307471_1032841521 | 3300032180 | Hardwood Forest Soil | MSSERSKYLKFGGATLVILVMLGYLAYTGVQESKSYYV |
Ga0335069_102288491 | 3300032893 | Soil | MSSQAKTYLKFGGATVVILMLLAYLAYTGVQDSKSY |
Ga0335083_101084365 | 3300032954 | Soil | MSAETSKYLKFGAVTVVILLSLGYLAYTGVQDSKSY |
⦗Top⦘ |