NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F077379

Metagenome Family F077379

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077379
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 81 residues
Representative Sequence MLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Number of Associated Samples 102
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 62.39 %
% of genes near scaffold ends (potentially truncated) 36.75 %
% of genes from short scaffolds (< 2000 bps) 82.05 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (43.590 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(20.513 % of family members)
Environment Ontology (ENVO) Unclassified
(64.103 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 76.25%    β-sheet: 0.00%    Coil/Unstructured: 23.75%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms59.83 %
UnclassifiedrootN/A40.17 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000149|LPaug09P1610mDRAFT_c1015995All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon956Open in IMG/M
3300000223|LPjun09P410mDRAFT_1003429All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1553Open in IMG/M
3300000223|LPjun09P410mDRAFT_1017724All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon601Open in IMG/M
3300001589|JGI24005J15628_10002048Not Available10451Open in IMG/M
3300003216|JGI26079J46598_1083365All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon595Open in IMG/M
3300003592|JGI26246J51724_1079246All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon608Open in IMG/M
3300003620|JGI26273J51734_10084548All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon909Open in IMG/M
3300004457|Ga0066224_1041089All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon891Open in IMG/M
3300004460|Ga0066222_1110771Not Available648Open in IMG/M
3300004460|Ga0066222_1155098Not Available647Open in IMG/M
3300005606|Ga0066835_10011240Not Available2283Open in IMG/M
3300005838|Ga0008649_10296855Not Available605Open in IMG/M
3300005941|Ga0070743_10022039Not Available2215Open in IMG/M
3300005942|Ga0070742_10006526All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon3038Open in IMG/M
3300006337|Ga0068495_1122737Not Available1162Open in IMG/M
3300006752|Ga0098048_1188790Not Available609Open in IMG/M
3300007554|Ga0102820_1005758All Organisms → Viruses → Predicted Viral3299Open in IMG/M
3300007620|Ga0102871_1118139All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon757Open in IMG/M
3300007642|Ga0102876_1122505Not Available700Open in IMG/M
3300007647|Ga0102855_1210670Not Available518Open in IMG/M
3300007862|Ga0105737_1178065All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon558Open in IMG/M
3300007956|Ga0105741_1132715Not Available610Open in IMG/M
3300008950|Ga0102891_1229100All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon536Open in IMG/M
3300009052|Ga0102886_1023772All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2043Open in IMG/M
3300009071|Ga0115566_10463141Not Available723Open in IMG/M
3300009079|Ga0102814_10173962All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300009141|Ga0102884_1152788All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon585Open in IMG/M
3300009172|Ga0114995_10384157All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon770Open in IMG/M
3300009173|Ga0114996_10545012Not Available869Open in IMG/M
3300009425|Ga0114997_10063664All Organisms → Viruses → Predicted Viral2331Open in IMG/M
3300009436|Ga0115008_10077450All Organisms → Viruses → Predicted Viral2509Open in IMG/M
3300009436|Ga0115008_10614484All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon783Open in IMG/M
3300009436|Ga0115008_10651129All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon762Open in IMG/M
3300009512|Ga0115003_10148065All Organisms → Viruses → Predicted Viral1427Open in IMG/M
3300010936|Ga0137784_1365393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1811Open in IMG/M
3300012953|Ga0163179_10017247All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales4758Open in IMG/M
3300012953|Ga0163179_10700578Not Available859Open in IMG/M
3300012953|Ga0163179_10929366Not Available754Open in IMG/M
3300012954|Ga0163111_10281341Not Available1470Open in IMG/M
3300014030|Ga0116816_1015528Not Available812Open in IMG/M
3300017713|Ga0181391_1059898All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon887Open in IMG/M
3300017720|Ga0181383_1008075Not Available2824Open in IMG/M
3300017720|Ga0181383_1183104All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon558Open in IMG/M
3300017725|Ga0181398_1048730Not Available1027Open in IMG/M
3300017737|Ga0187218_1079930All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon794Open in IMG/M
3300017741|Ga0181421_1031878All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1424Open in IMG/M
3300017743|Ga0181402_1093305Not Available781Open in IMG/M
3300017745|Ga0181427_1051704All Organisms → Viruses → Predicted Viral1016Open in IMG/M
3300017748|Ga0181393_1031553All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1502Open in IMG/M
3300017748|Ga0181393_1097568All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon759Open in IMG/M
3300017750|Ga0181405_1149190All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon578Open in IMG/M
3300017751|Ga0187219_1129050All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon743Open in IMG/M
3300017755|Ga0181411_1233324Not Available510Open in IMG/M
3300017758|Ga0181409_1089898Not Available920Open in IMG/M
3300017759|Ga0181414_1001802Not Available6414Open in IMG/M
3300017764|Ga0181385_1151112Not Available705Open in IMG/M
3300017768|Ga0187220_1007222Not Available3364Open in IMG/M
3300017769|Ga0187221_1137263All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon730Open in IMG/M
3300017770|Ga0187217_1080739All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1116Open in IMG/M
3300017770|Ga0187217_1250987All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon577Open in IMG/M
3300017770|Ga0187217_1299305Not Available518Open in IMG/M
3300018416|Ga0181553_10623243Not Available568Open in IMG/M
3300018417|Ga0181558_10241993All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1011Open in IMG/M
3300020269|Ga0211484_1058026Not Available703Open in IMG/M
3300020305|Ga0211513_1001062All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon4338Open in IMG/M
3300020305|Ga0211513_1002097All Organisms → Viruses → Predicted Viral3118Open in IMG/M
3300020306|Ga0211616_1010313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1436Open in IMG/M
3300020310|Ga0211515_1033528Not Available1002Open in IMG/M
3300020347|Ga0211504_1012591All Organisms → Viruses → Predicted Viral2473Open in IMG/M
3300020374|Ga0211477_10096494All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1095Open in IMG/M
3300020380|Ga0211498_10002419All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon6746Open in IMG/M
3300020385|Ga0211677_10218338Not Available785Open in IMG/M
3300020388|Ga0211678_10070617Not Available1591Open in IMG/M
3300020400|Ga0211636_10072900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1421Open in IMG/M
3300020413|Ga0211516_10502922Not Available529Open in IMG/M
3300020419|Ga0211512_10063565All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1755Open in IMG/M
3300020428|Ga0211521_10143697All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1120Open in IMG/M
3300020433|Ga0211565_10186124Not Available902Open in IMG/M
3300020438|Ga0211576_10061260All Organisms → Viruses → Predicted Viral2129Open in IMG/M
3300020438|Ga0211576_10516781Not Available602Open in IMG/M
3300020446|Ga0211574_10115941Not Available1174Open in IMG/M
3300020462|Ga0211546_10167869All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1086Open in IMG/M
3300020463|Ga0211676_10316541All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon884Open in IMG/M
3300020463|Ga0211676_10317068Not Available883Open in IMG/M
3300020469|Ga0211577_10479609Not Available757Open in IMG/M
3300021185|Ga0206682_10016894Not Available4806Open in IMG/M
3300021957|Ga0222717_10073712All Organisms → Viruses → Predicted Viral2170Open in IMG/M
3300024185|Ga0228669_1034301Not Available1100Open in IMG/M
3300024231|Ga0233399_1024652All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1790Open in IMG/M
3300024236|Ga0228655_1015703All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1939Open in IMG/M
3300024244|Ga0228678_1026998Not Available1068Open in IMG/M
(restricted) 3300024264|Ga0233444_10232219All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon831Open in IMG/M
3300024294|Ga0228664_1044138Not Available1110Open in IMG/M
3300024322|Ga0228656_1019961All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1543Open in IMG/M
3300024413|Ga0233393_1077257All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon746Open in IMG/M
3300024417|Ga0228650_1140856All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon633Open in IMG/M
3300025120|Ga0209535_1221856Not Available507Open in IMG/M
3300025636|Ga0209136_1100907All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon833Open in IMG/M
3300025696|Ga0209532_1132857All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon796Open in IMG/M
3300025722|Ga0209660_1239005All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon561Open in IMG/M
3300025770|Ga0209362_1160895All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon782Open in IMG/M
3300026203|Ga0207985_1099768Not Available684Open in IMG/M
3300026491|Ga0228641_1125844All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon527Open in IMG/M
3300027197|Ga0208922_1069984All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon580Open in IMG/M
3300027687|Ga0209710_1049752Not Available1906Open in IMG/M
3300027810|Ga0209302_10437679Not Available586Open in IMG/M
3300027833|Ga0209092_10093681All Organisms → Viruses → Predicted Viral1789Open in IMG/M
3300027833|Ga0209092_10180401All Organisms → Viruses → Predicted Viral1200Open in IMG/M
3300027833|Ga0209092_10365607Not Available764Open in IMG/M
3300028127|Ga0233401_1018072All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon1860Open in IMG/M
3300028196|Ga0257114_1071562All Organisms → Viruses → Predicted Viral1474Open in IMG/M
3300028391|Ga0233394_1013706All Organisms → cellular organisms → Bacteria2319Open in IMG/M
3300031625|Ga0302135_10140421All Organisms → Viruses → Predicted Viral1111Open in IMG/M
3300031675|Ga0302122_10155226All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon901Open in IMG/M
3300031766|Ga0315322_10278277Not Available1150Open in IMG/M
3300031785|Ga0310343_10047456All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon2585Open in IMG/M
3300031851|Ga0315320_10902128All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon543Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine20.51%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater17.95%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.38%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.40%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine7.69%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine5.98%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine3.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.56%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.56%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.56%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.71%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.71%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.71%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.85%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.85%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.85%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.85%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.85%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000149Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10mEnvironmentalOpen in IMG/M
3300000223Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P4 10mEnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003592Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNAEnvironmentalOpen in IMG/M
3300003620Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNAEnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004460Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005606Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006337Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025mEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300007647Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300008950Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02EnvironmentalOpen in IMG/M
3300009052Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009141Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300010936Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15mEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300014030Marine hypoxic microbial communities from the Gulf of Mexico, USA - 11m_Station1_GOM_MetagenomeEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020269Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041)EnvironmentalOpen in IMG/M
3300020305Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX556024-ERR599003)EnvironmentalOpen in IMG/M
3300020306Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX556014-ERR599098)EnvironmentalOpen in IMG/M
3300020310Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX556067-ERR598950)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020374Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618)EnvironmentalOpen in IMG/M
3300020380Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058)EnvironmentalOpen in IMG/M
3300020385Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020400Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020433Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020446Marine microbial communities from Tara Oceans - TARA_B100001287 (ERX556031-ERR598989)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300024185Seawater microbial communities from Monterey Bay, California, United States - 84DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024236Seawater microbial communities from Monterey Bay, California, United States - 67DEnvironmentalOpen in IMG/M
3300024244Seawater microbial communities from Monterey Bay, California, United States - 125D_rEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024322Seawater microbial communities from Monterey Bay, California, United States - 68DEnvironmentalOpen in IMG/M
3300024413Seawater microbial communities from Monterey Bay, California, United States - 21DEnvironmentalOpen in IMG/M
3300024417Seawater microbial communities from Monterey Bay, California, United States - 62DEnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025722Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025770Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026203Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes)EnvironmentalOpen in IMG/M
3300026491Seawater microbial communities from Monterey Bay, California, United States - 52DEnvironmentalOpen in IMG/M
3300027197Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028127Seawater microbial communities from Monterey Bay, California, United States - 49DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028391Seawater microbial communities from Monterey Bay, California, United States - 24DEnvironmentalOpen in IMG/M
3300031625Marine microbial communities from Western Arctic Ocean, Canada - CBN3_surfaceEnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
LPaug09P1610mDRAFT_101599523300000149MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKIIRNANAQQLQAFNSLQSTVMQKTKNFIVNNALVKQLLNN*
LPjun09P410mDRAFT_100342933300000223MarineMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN*
LPjun09P410mDRAFT_101772413300000223MarineYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
JGI24005J15628_10002048203300001589MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN*
JGI26079J46598_108336523300003216MarineNNNLAGQNMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
JGI26246J51724_107924613300003592MarineFTCILENSVLYYKNNNNLAGQNMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
JGI26273J51734_1008454823300003620MarineMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
Ga0066224_104108913300004457MarineTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKTKNFVVNNALVKQLLNN*
Ga0066222_111077113300004460MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTANSIEIIRNANTQQLQAFNMLPAVFMQKVKNFNKLINTSVLKNLFTTH*
Ga0066222_115509823300004460MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKTKNFVVNNALVKQLLNN*
Ga0066835_1001124073300005606MarineLLTQKALTKKLVATYCSATNTCFIHKKNKAHNVYTVNSEKIIRNLSAQQLSAFNMLQNTMFANCKNFVQNNALIKMLYNK*
Ga0008649_1029685513300005838MarineMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKL
Ga0070743_1002203913300005941EstuarineMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNAL
Ga0070742_1000652673300005942EstuarineATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTP*
Ga0068495_112273723300006337MarineLLTQKALTKKLVATYCSATNTCFIHKKNKAHKVYTVNSEKVIRNLNAQQKSAFNMLQNTMFANCKNFVQDNALIKMLYNK*
Ga0098048_118879013300006752MarineMLTQKALNKQLTATLCTTTNTIFIHKNNKAHLQYTVNSKQVIHNANAQQLQAFYKLPSTLLQKCKNFNKLINTNTLKQLLVR*
Ga0102820_100575873300007554EstuarineLENSVLYYKNNNNLAGQNMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
Ga0102871_111813923300007620EstuarineLHMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN*
Ga0102876_112250523300007642EstuarineMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLIN*
Ga0102855_121067013300007647EstuarineVLHMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN*
Ga0105737_117806513300007862Estuary WaterMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN*
Ga0105741_113271513300007956Estuary WaterLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
Ga0102891_122910013300008950EstuarineLVNNNKTEVLHMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN*
Ga0102886_102377243300009052EstuarineLEKSVLHYKNNNNLAGQNMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
Ga0115566_1046314123300009071Pelagic MarineMLTQKALTKTLTATLCTTTNTIFVHKNNKAHLQYTVNSNKVLRNANAQQLNAFNNLQSTLMQKTKNFVVNNALVKQLLNN*
Ga0102814_1017396223300009079EstuarineLEKSVLHYKNNNNLAGQYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH*
Ga0102884_115278813300009141EstuarineTLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN*
Ga0114995_1038415723300009172MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANTQQLQAFNNLQNTLMQKTKNFVVNNALVKQLLNN*
Ga0114996_1054501233300009173MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKT
Ga0114997_1006366433300009425MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQTTLMQKTKNFVVNNALVKQLLNN*
Ga0115008_1007745073300009436MarineVLHYKNNNNLAGQNMLTQKALNKKLTATLCTTTNTIFIHKNNKAHLQYTVNSSKVIHNANAQQLQAFYKLPSTLMQKTKNFNKLINTNLLKQLFTTH*
Ga0115008_1061448413300009436MarineMLTQKALTRNLTATLCTTSNTIFIHKHKKAHKTYTLNSTKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALIKQLLNN*
Ga0115008_1065112913300009436MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKIIRNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN*
Ga0115003_1014806543300009512MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKTKNFVVNNALVKQ
Ga0137784_136539343300010936MarineLLTQKALTKKLVATYCSATNTCFIHKKNKAHNVYTVNSEKIIRNLSAQQLSAFNMLQNTMFANCKNFVQDNALIKMLYNK*
Ga0163179_1001724723300012953SeawaterMLTQKALTRNTTATLCNTTNTLFVHKNNKPHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQSAKNFVANTLAIKTLLNK*
Ga0163179_1070057813300012953SeawaterTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSSKVIRNLSKQQLSAFNMLQNTCMQKTKNFIVNNALVKQLLNN*
Ga0163179_1092936623300012953SeawaterMRAIMLQQKALTRTLTATLCTTTNTLFVHKNNKAHLQYTVNSKKVIRNLSNAQLNAFAQLQNTCMQKAKNFVTNNALIKILYNN*
Ga0163111_1028134123300012954Surface SeawaterLLTQKALTKKLVATYCSATNTCFIHKKNKAHNVYTVNSEKIIRNLNAKQLSAFNMLQNTMFANCKNFVQNNALIKMLYNK*
Ga0116816_101552813300014030MarineTYCSATNTCFVHKKNKAHKVYTVNSEKVIRNLNAQQKSAFNALQNTMFANCKNFVQDNALIKMLYNK*
Ga0181391_105989813300017713SeawaterYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTDLLKQLFTTH
Ga0181383_100807553300017720SeawaterLLTQKALTKKLVATYCSTSNTCFIHKNDKAHLAYTVNSSKVIRNLSKQQLSAFNMLQNTCMQKTKNFVTNNALIKMLYNN
Ga0181383_118310413300017720SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTANSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0181398_104873033300017725SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVLRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0187218_107993013300017737SeawaterYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0181421_103187823300017741SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKEHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0181402_109330523300017743SeawaterVLHYKNNNNLAGQYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0181427_105170423300017745SeawaterMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFT
Ga0181393_103155323300017748SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSTKVLRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0181393_109756813300017748SeawaterQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0181405_114919023300017750SeawaterCILEKSVLHYKNNNNIAGQNMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0187219_112905013300017751SeawaterSLYMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0181411_123332413300017755SeawaterMLTQKALTKNLTATLCNTTNTLFVHKNNKAHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQKAKNFVVNNALV
Ga0181409_108989813300017758SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLNAFNMLPATYMQKAKNFNKLINTSVLKNLFTTH
Ga0181414_100180283300017759SeawaterMLTQKALTKNLTATLCNTTNTLFVHKNNKAHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQKAKNFVVNNALVKQLLNN
Ga0181385_115111223300017764SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTANSSKVIRNANAQQLNAFNMLPATYMQKAKNFNKLINTSVLKNLFTTH
Ga0187220_100722253300017768SeawaterMLTQKALTKKLVATYCSTSNTCFIHKNDKAHLAYTVNSSKVIRNLSKQQLSAFNMLQNTCMQKTKNFVTNNALIKMLYNN
Ga0187221_113726313300017769SeawaterMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0187217_108073913300017770SeawaterTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0187217_125098723300017770SeawaterEVLHMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN
Ga0187217_129930523300017770SeawaterTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTDLLKQLFTTH
Ga0181553_1062324313300018416Salt MarshMLKQKALTRTLTATLCTTTNTCFIHKHKKAHKTYTQNSVKIIRNLNAQQQAAFNALPQTYMQSAKHFFINALANKTLLKS
Ga0181558_1024199333300018417Salt MarshKQKALTRTLTATLCTTTNTCFIHKHKKAHKTYTQNSVKIIRNLNAQQQAAFNALPQTYMQSAKHFFINALANKTLLKS
Ga0211484_105802623300020269MarineMLTQKALTKNLVATYCSATNTCFVHKKNKAHKVYTVNSEKVIRNLNAQQKSAFNMLQNTMFANCKNFVQNNVLIKQLYNK
Ga0211513_100106223300020305MarineMLTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSSKVIRNLSKQQLSAFNMLQNTCMQKTKNFVTNNALIKMLYNN
Ga0211513_100209763300020305MarineMLTQKALTRNTTATLCKTTNTLFVHKNNKPHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQSAKNFVANTLAIKTLLNK
Ga0211616_101031343300020306MarineLLTQKALTKKLVATYCSATNTCFIHKKNKAHNVYTVNSEKIIRNLNAKQLSAFNALQNTMFANCKNFVQNNALIKMLYNK
Ga0211515_103352833300020310MarineMLTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSSKVIRNLSKQQLNAFNMLQNTCMQKTKNFVTNNALIKMLYNN
Ga0211504_101259143300020347MarineMLTQKALNKKLTATLCTTTNTIFIHKNNKAHLQYTVNSSKVIHNANAQQLQAFYKLPSTLLQKCKNFNKHINTNTLKQLLT
Ga0211477_1009649423300020374MarineMLTQKALTRNTTATLCNTTNTLFVHKNNKPHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQSAKNFVANTLAIKTLLNK
Ga0211498_1000241993300020380MarineLLTQKALTKKLVATYCSATNTCFIHKKNKAHNVYTVNSEKIIRNLNAKQLSAFNMLQNTMFANCKNFVQNNALIKMLYNK
Ga0211677_1021833813300020385MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSNKIIRNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0211678_1007061723300020388MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKIIRNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0211636_1007290023300020400MarineMLTQKALTKTLVATYCSATNTCYVHKKTKAHKVYTVNSIKVIRNLNAQQKSAFNMLQNTMFANCKNFVQNNALIKMLYNK
Ga0211516_1050292213300020413MarineTLCNTTNTLFVHKNNKPHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQSAKNFVANTLAIKTLLNK
Ga0211512_1006356533300020419MarineMLTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSNKVIRNLTQQQLNAFNMLPATCMQKAKNFVVNNALIKMLYNN
Ga0211521_1014369733300020428MarineMLTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSSKVIRNLSKQQLNAFNMLQSTCMQKTKNFVTNNALIKMLYNN
Ga0211565_1018612423300020433MarineMLTQKALTKNLVATYCSTTNTCYVHKKNKAHNVYTVNSLKVIRNLNAQQKSAFNMLQNTMFANTKNFVQNNALIKKLYNN
Ga0211576_1006126013300020438MarineMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0211576_1051678113300020438MarineMLTQKALTRNLTATLCTTSNTIFIHKHKKAHLTYTLNSAKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALVKQLLNN
Ga0211574_1011594113300020446MarineMLTQKALTKNLVATYCSATNTCFVHKKNKAHKVYTVNSEKVIRNLNAQQKSAFNMLQNTMFANCKNFVQDNALIKMLYNK
Ga0211546_1016786923300020462MarineMLTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSSKVIRNLSKQQLNAFNMLQNTCMQKTKNFIVNNALVKQLLNN
Ga0211676_1031654123300020463MarineMLTQKALTKNLTATLCNTTNTLFVHKNNKAHLQYTVNSNKVIRNLTQQQLNAFNMLPATFMQKAKNFVVNNATVKQLLNN
Ga0211676_1031706823300020463MarineMLTQKALTKKLVATYCSTSNTCFIHKNNKAHLAYTVNSSKVIRNLSKQQLNAFNMLQNTCMQKAKNFVVNNALIKMLYNN
Ga0211577_1047960923300020469MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0206682_10016894133300021185SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0222717_1007371253300021957Estuarine WaterMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0228669_103430133300024185SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVN
Ga0233399_102465223300024231SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN
Ga0228655_101570313300024236SeawaterKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0228678_102699833300024244SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLINN
(restricted) Ga0233444_1023221923300024264SeawaterLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0228664_104413833300024294SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKT
Ga0228656_101996123300024322SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSTKVLRNANAQQLQAFNSLQSTVMQKTKNFIVNNALVKQLLNN
Ga0233393_107725713300024413SeawaterMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0228650_114085613300024417SeawaterTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0209535_122185613300025120MarineMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKIIRNANAQQLQAFNSLQSTVMQKTKNFIVNNALVKQLLNN
Ga0209136_110090713300025636MarineYFTCILEKSVLHYKNNNNLAGQYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0209532_113285713300025696Pelagic MarineMLTQKALTKTLTATLCTTTNTIFVHKNNKAHLQYTVNSNKVLRNANAQQLNAFNNLQSTLMQKTKNFVVNNALVKQLLNN
Ga0209660_123900513300025722MarineKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0209362_116089513300025770MarineKNNNNLAGQYMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0207985_109976823300026203MarineLLTQKALTKKLVATYCSATNTCFIHKKNKAHNVYTVNSEKIIRNLSAQQLSAFNMLQNTMFANCKNFVQNNALIKMLYNK
Ga0228641_112584413300026491SeawaterGSLYMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0208922_106998423300027197EstuarineALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0209710_104975243300027687MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTANSIEIIRNANTQQLQAFNMLPAVFMQKVKNFNKLINTSVLKNLFTTH
Ga0209302_1043767923300027810MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKTKNFVVNNALVKQLLNN
Ga0209092_1009368123300027833MarineVLHYKNNNNLAGQNMLTQKALNKKLTATLCTTTNTIFIHKNNKAHLQYTVNSSKVIHNANAQQLQAFYKLPSTLMQKTKNFNKLINTNLLKQLFTTH
Ga0209092_1018040123300027833MarineMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKTKNFVVNNALVKQLLNTKNKTCIIAQVVL
Ga0209092_1036560713300027833MarineMLTQKALTRNLTATLCTTSNTIFIHKHKKAHKTYTLNSTKVLRNVNAQQLQAFNNLQSTFMQNAKNFVVNNALIKQLLNN
Ga0233401_101807213300028127SeawaterTATLCTTTNTIFVHKNNKAHLQYTVNSSKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0257114_107156233300028196MarineNNNLAGQNMLTQKALNKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFYKLPSTVMQKTKNFNKLINTNLLKQLFTTH
Ga0233394_101370613300028391SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0302135_1014042133300031625MarineFMCYINLYNNKTEVVHMLKQKALTKNLIATLCTTTNTIFVHKNNKAHLQYTVNSNKVIRNANAQQLQAFNNLQNTLMQKTKNFVVNNALVKQLLNN
Ga0302122_1015522613300031675MarineKALTKNLIATLCTTTNTIFVHKNNKAHLQYTANSIEIIRNANTQQLQAFNMLPAVFMQKVKNFNKLINTSVLKNLFTTH
Ga0315322_1027827733300031766SeawaterMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSTKVIRNANAQQLQAFNSLQSTAMQKTKNFIVNNALVKQLLNN
Ga0310343_1004745623300031785SeawaterLLTQKALTKNLVATYCSATNTCFVHKKNKAHKVYTVNSEKVIRNLNAQQKSAFNMLQNTMFANCKNFVQDNALIKMLYNK
Ga0315320_1090212823300031851SeawaterGSLYMLTQKALTKKLTATLCTTTNTIFVHKNNKAHLQYTVNSEKVIHNANAQQLQAFNSLQSTLMQKTKNFIVNNALVKQLLNN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.