NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F077340

Metagenome / Metatranscriptome Family F077340

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F077340
Family Type Metagenome / Metatranscriptome
Number of Sequences 117
Average Sequence Length 60 residues
Representative Sequence VFHITNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Number of Associated Samples 100
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 6.03 %
% of genes near scaffold ends (potentially truncated) 69.23 %
% of genes from short scaffolds (< 2000 bps) 97.44 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.145 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(21.367 % of family members)
Environment Ontology (ENVO) Unclassified
(51.282 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(45.299 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 56.82%    β-sheet: 0.00%    Coil/Unstructured: 43.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.15 %
UnclassifiedrootN/A0.85 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001355|JGI20158J14315_10172614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300002408|B570J29032_109873418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1844Open in IMG/M
3300004112|Ga0065166_10025596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1786Open in IMG/M
3300004112|Ga0065166_10183816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae815Open in IMG/M
3300004687|Ga0065174_1079452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii613Open in IMG/M
3300004692|Ga0065171_1070740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii551Open in IMG/M
3300006383|Ga0075504_1366742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae542Open in IMG/M
3300006415|Ga0099654_11083423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii607Open in IMG/M
3300006805|Ga0075464_10079369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1861Open in IMG/M
3300007600|Ga0102920_1217897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii613Open in IMG/M
3300007860|Ga0105735_1006112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1820Open in IMG/M
3300008113|Ga0114346_1233864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii700Open in IMG/M
3300008116|Ga0114350_1189651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii519Open in IMG/M
3300008120|Ga0114355_1209554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii617Open in IMG/M
3300008510|Ga0110928_1208178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii562Open in IMG/M
3300008932|Ga0103735_1044305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea652Open in IMG/M
3300008938|Ga0103741_1035560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea924Open in IMG/M
3300009055|Ga0102905_1060277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii760Open in IMG/M
3300009059|Ga0102830_1171308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii636Open in IMG/M
3300009151|Ga0114962_10419707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii720Open in IMG/M
3300009155|Ga0114968_10280163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea938Open in IMG/M
3300009155|Ga0114968_10411222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii737Open in IMG/M
3300009433|Ga0115545_1300611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii533Open in IMG/M
3300009434|Ga0115562_1178660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea773Open in IMG/M
3300009436|Ga0115008_10612252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii785Open in IMG/M
3300009436|Ga0115008_11025180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii617Open in IMG/M
3300009593|Ga0115011_11910431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii539Open in IMG/M
3300009599|Ga0115103_1088003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea552Open in IMG/M
3300009608|Ga0115100_10201888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii584Open in IMG/M
3300009677|Ga0115104_10339331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea838Open in IMG/M
3300012419|Ga0138260_10384924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea527Open in IMG/M
3300012709|Ga0157608_1127154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae617Open in IMG/M
3300012720|Ga0157613_1097713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae569Open in IMG/M
3300012782|Ga0138268_1327739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300012953|Ga0163179_12259955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300013004|Ga0164293_10473121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae831Open in IMG/M
3300013295|Ga0170791_11379695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300013295|Ga0170791_12812040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii601Open in IMG/M
3300017262|Ga0186220_117069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae599Open in IMG/M
3300018684|Ga0192983_1021990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea852Open in IMG/M
3300018684|Ga0192983_1045246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea609Open in IMG/M
3300018720|Ga0192866_1068493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea536Open in IMG/M
3300018739|Ga0192974_1061894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii622Open in IMG/M
3300018739|Ga0192974_1068033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii583Open in IMG/M
3300018739|Ga0192974_1069007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea578Open in IMG/M
3300018848|Ga0192970_1078955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii602Open in IMG/M
3300018871|Ga0192978_1081395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea593Open in IMG/M
3300018968|Ga0192894_10151873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii746Open in IMG/M
3300018974|Ga0192873_10362034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea597Open in IMG/M
3300018980|Ga0192961_10164166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii674Open in IMG/M
3300018980|Ga0192961_10164576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii673Open in IMG/M
3300018981|Ga0192968_10117238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii703Open in IMG/M
3300019021|Ga0192982_10012522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1840Open in IMG/M
3300019021|Ga0192982_10274486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii605Open in IMG/M
3300019045|Ga0193336_10409031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea632Open in IMG/M
3300019048|Ga0192981_10219363All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea737Open in IMG/M
3300019048|Ga0192981_10254683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
3300019049|Ga0193082_10676892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii582Open in IMG/M
3300019149|Ga0188870_10130314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii584Open in IMG/M
3300019149|Ga0188870_10136266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea566Open in IMG/M
3300019151|Ga0192888_10211355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300019153|Ga0192975_10215674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea670Open in IMG/M
3300019153|Ga0192975_10259854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii590Open in IMG/M
3300020074|Ga0194113_10759285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii667Open in IMG/M
3300020083|Ga0194111_10947002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii508Open in IMG/M
3300020190|Ga0194118_10080760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii2036Open in IMG/M
3300020190|Ga0194118_10275931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii911Open in IMG/M
3300020205|Ga0211731_10044734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea664Open in IMG/M
3300020557|Ga0208231_1008976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1846Open in IMG/M
3300021365|Ga0206123_10258138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea754Open in IMG/M
3300021872|Ga0063132_110251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300021874|Ga0063147_119922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii568Open in IMG/M
3300024343|Ga0244777_10490830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii755Open in IMG/M
3300025640|Ga0209198_1118178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea790Open in IMG/M
3300025887|Ga0208544_10253476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii703Open in IMG/M
3300026448|Ga0247594_1087092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300027749|Ga0209084_1233629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii723Open in IMG/M
3300027760|Ga0209598_10050626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae2143Open in IMG/M
3300029955|Ga0311342_11219606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae540Open in IMG/M
3300030528|Ga0210277_10096336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii649Open in IMG/M
3300030604|Ga0247637_1139403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii585Open in IMG/M
3300030609|Ga0247634_10404617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae575Open in IMG/M
3300030670|Ga0307401_10462358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea577Open in IMG/M
3300030699|Ga0307398_10743503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300030709|Ga0307400_10999794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300030740|Ga0265460_11790746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae629Open in IMG/M
3300030741|Ga0265459_12457544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae640Open in IMG/M
3300030741|Ga0265459_12654856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae620Open in IMG/M
3300030741|Ga0265459_12959119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae592Open in IMG/M
3300030743|Ga0265461_12327907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae625Open in IMG/M
3300031231|Ga0170824_126158503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii581Open in IMG/M
3300031550|Ga0307392_1033645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea637Open in IMG/M
3300031710|Ga0307386_10515994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea626Open in IMG/M
3300031717|Ga0307396_10510816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea577Open in IMG/M
3300031729|Ga0307391_10717907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300031734|Ga0307397_10419997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea619Open in IMG/M
3300031734|Ga0307397_10530877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii551Open in IMG/M
3300031738|Ga0307384_10421229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea624Open in IMG/M
3300031786|Ga0315908_10163685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii1830Open in IMG/M
3300032518|Ga0314689_10690358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae524Open in IMG/M
3300032521|Ga0314680_10718308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii630Open in IMG/M
3300032540|Ga0314682_10611966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii595Open in IMG/M
3300032617|Ga0314683_10848959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea548Open in IMG/M
3300032650|Ga0314673_10546752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii597Open in IMG/M
3300032707|Ga0314687_10729147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea550Open in IMG/M
3300032708|Ga0314669_10674390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae567Open in IMG/M
3300032708|Ga0314669_10763141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii529Open in IMG/M
3300032711|Ga0314681_10763592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae530Open in IMG/M
3300032713|Ga0314690_10611843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300032742|Ga0314710_10435356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea545Open in IMG/M
3300032756|Ga0315742_12864546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii555Open in IMG/M
3300033572|Ga0307390_11079830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea510Open in IMG/M
3300033984|Ga0334989_0386283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii723Open in IMG/M
3300034022|Ga0335005_0563476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea623Open in IMG/M
3300034073|Ga0310130_0107842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae → Stylonychinae → Stylonychia → Stylonychia lemnae840Open in IMG/M
3300034280|Ga0334997_0825650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea556Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.37%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.13%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater3.42%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.42%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.42%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.56%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.56%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.56%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.71%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica1.71%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.71%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.85%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.85%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.85%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.85%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.85%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.85%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.85%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004687Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul08 (version 2)EnvironmentalOpen in IMG/M
3300004692Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006415Algae and Fungi communities from freshwater lake (pre-blooming) in Auvergne, France - collected by filtering lake water, a 'reference genome' of the lake communityEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007860Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372A_3umEnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008510Microbial Communities in Water bodies, Singapore - Site RAEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009151Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017262Metatranscriptome of marine eukaryotic communities from Tyrrhenian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 291 ?mol photons light - Pseudokeronopsis sp. OXSARD2 (MMETSP0211)Host-AssociatedOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027749Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027760Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030604Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031550Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033984Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Mar2001-rr0030EnvironmentalOpen in IMG/M
3300034022Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20158J14315_1017261413300001355Pelagic MarineRETNVWMIRKCRWIFWGGVMSIPIYRCTYWDYLGRRVAWRDSLGFFGTEEEKKAKAEADIG*
B570J29032_10987341843300002408FreshwaterPKTPKPQRIESNIIKMVFHITNYMRETNVWMIRKMRWIFWGLALSTPIYRNTYWDYLGKRAAWRDSLFGGTEAEKK*
Ga0065166_1002559643300004112Freshwater LakeESNIIKMVFHITNYMRETNVWMIRKMRWIFWGLALSTPIYRNTYWDYLGKRAAWRDSLFGGTEAEKK*
Ga0065166_1018381623300004112Freshwater LakeMVFHVTNYMRETNVWMIRKGRWLLWGMCGFVPMYRNFYWDFLGRRAAYKDYYSGLSEDEKRENAN*
Ga0065174_107945223300004687FreshwaterMVFHITNYMRETNVWMIRKGRWILWSLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGNEEEKKA*
Ga0065171_107074023300004692FreshwaterFHITNYMRETNVWMIRKGRWILWSLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGNEEEKKA*
Ga0075504_136674213300006383AqueousNYMRETNVWMIRKMRWIFWGLVLATPIYRNTYWDYLGRRTAWRRYLFGGTQEE*
Ga0099654_1108342313300006415LakeMVFHITNYMRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGNEEEKKA*
Ga0075464_1007936913300006805AqueousMVFHVTNYMRETNTWMIRKCRWIFWGLFFTVPIYRNVYWDYLGRRAAWRDYWLGGTE*
Ga0102920_121789713300007600EstuarineMVFHVSNYMRETNVWMIRKMRWIFWSIVAAVPVYRNTYWDYLGRRGAWRDYYFGGTEAEKMAKAEA*
Ga0105735_100611213300007860Estuary WaterLIKMVFHVTNYMRETNTWMIRKCRWIFWGLFFTVPIYRNVYWDYLGRRAAWRDYWLGGTE
Ga0105736_110384413300007861Estuary WaterNVWMIRKCRWIFWSLGASVPIYRNTYWDYLGRRVAWKDHYAGTEEEKKA*
Ga0114346_123386413300008113Freshwater, PlanktonMVFHITNYMRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKA*
Ga0114350_118965113300008116Freshwater, PlanktonKKIMVFHITNYMRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKA*
Ga0114355_120955423300008120Freshwater, PlanktonRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKA*
Ga0110928_120817833300008510Water BodiesMRETNVWMIRKMRWILWTIGFSLPIYRNTYWDYLGRRAAWRDHFSGKTEDEKRAEA
Ga0103735_104430513300008932Ice Edge, Mcmurdo Sound, AntarcticaMLDLVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT*
Ga0103741_103556013300008938Ice Edge, Mcmurdo Sound, AntarcticaKSMVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT*
Ga0102905_106027713300009055EstuarineMVFHITNYMRETNVWMIRKMRWILWGTFGFVPAYRNFYWDYLGRRVAWKDSMSGKTDAQRQ*
Ga0102830_117130813300009059EstuarineFIIIKIMVFHVTNYMRETNVWMIRKGRWMLWSFVGCVPIYRCTYWDFLGRRVAWKDKLGWYGTEEEKKARAEALRAD*
Ga0114962_1041970723300009151Freshwater LakeMRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKA*
Ga0114968_1028016323300009155Freshwater LakeMVFHVTNYMRETNVWMIRKGRWILWGLCSSVPIYRNVYWDFLGRRVAWKDYYSGLTEDEKRQ*
Ga0114968_1041122213300009155Freshwater LakeMRETNVWMIRKGRWILWSLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGNEEEKKA*
Ga0115545_130061123300009433Pelagic MarineTNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK*
Ga0115562_117866013300009434Pelagic MarineMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAE*
Ga0115008_1061225223300009436MarineMVFHVTNYMRETNVWMIRKMRWIFWGGVCATPIYRNCYWDFLGRRVAWRDYWFGGS
Ga0115008_1102518013300009436MarineMVFHVTNYMRETNVWMIRKMRWMFWGVFGGIPLYRNTYWDYAGRRIAWKQQLSRESEEDI
Ga0115011_1191043123300009593MarineMVFHITNYMRETNVWMIRKMRWILWGTFGFVPLYRAQYWDYLGRRVAWADYFSLKSEE*
Ga0115103_108800313300009599MarineELIMVFHITNYMRETNVWMIRKMRWILWSGVAAIPIFRCTYWDLLGRRVAWKDHFGYYGTEAEKKK*
Ga0115100_1020188813300009608MarineVFHITNYMRETNTWMIRKMRWIMWGTVSFVPLYRNFYWDYLGRRTAWKDYFNS*
Ga0115104_1033933113300009677MarineIKTKASMVFHIMNYMRETNVWMIRKMRWMFWGGVMTVPFYRSTYWDFLGRRTAWRRHFFGGTEQEQIEYAES*
Ga0138260_1038492413300012419Polar MarineRDKLNFDIKLKMVFHVTNYMRETNVWMIRKCRWIFWGGVMATPIYRCTYWDYLGRRVAWRDHLGFWGTEEEKKT*
Ga0157608_112715413300012709FreshwaterVFHVTNYMRETNVWMIRKGRWLLWGMCGFVPMYRNFYWDFLGRRAAYKDYYSGLSEDEKRENAN*
Ga0157613_109771313300012720FreshwaterVTNYMRETNVWMIRKGRWLLWGMCGFVPMYRNFYWDFLGRRAAYKDYYSGLSEDEKRENAN*
Ga0138268_132773923300012782Polar MarineVFHVTNYMRETNVWMIRKCRWIFWLGATSTMIYRVTYWDYLGRRVAWKDTFNWYGNEIQKKEEAEK*
Ga0163179_1225995513300012953SeawaterMVFHVTNYMRETNVWMIRKMRWIFWSIFLVTPAYRWFYFDYLGRRVAYKDDWKGTEEEKR
Ga0164293_1047312123300013004FreshwaterMVFHVTNYMRETNVWMIRKGRWILWSMCLSLPVYRNVYWDYLGRRVAWKDYFSGLTEEEKK*
Ga0170791_1137969523300013295FreshwaterYMRETNVWMIRKGRWILWGLCSSVPIYRNVYWDFLGRRVAWKDYYSGLTEDEKRQ*
Ga0170791_1281204013300013295FreshwaterMVFHISNYMRETNVWMIRKCRWIFWSMGASVPIYRNTYWDYLGRRSAWRDYYSGTEKEKKA*
Ga0186220_11706913300017262Host-AssociatedMVFHITNYMRETNVWMIRKGRWLLWGMVLSIPIYRNVYWDFLGRRVALKQWLYGGSEEEQRKRAEA
Ga0192983_102199013300018684MarineHGEYNKINKSMVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0192983_104524613300018684MarineMVFHITNYMRETNVWMIRKGRWILWGGVAATPIYRVTYWDFLGRRVAWRDTIFGGTEAEK
Ga0192866_106849323300018720MarineITNYMRETNVWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLQGTEAEK
Ga0192974_106189423300018739MarineDKDKMVFHITNFMRETNVWMIRKMRWILWCTFGFLPVYRNVYWDYLGRRVAWKDSLSGKTEDQK
Ga0192974_106803313300018739MarineKQGEMVFHITNFMRETNTWMIRKMRWILWCTFSFVPIYRNVYWDYLGRRVAWKDSYAGKSEADK
Ga0192974_106900713300018739MarineKSMVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0192970_107895513300018848MarineFDKDKMVFHITNFMRETNVWMIRKMRWILWCTFGFLPVYRNVYWDYLGRRVAWKDSLSGKTEDQK
Ga0192978_108139523300018871MarineFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0192894_1015187333300018968MarineTWGILFCIESIKMVFHVTNYMRETNVWMIRKMRWLLWGLVCTTPLYRVTHWDYLNRRVAWRDYLFGGTE
Ga0192873_1036203413300018974MarineMVFHITNYMRETNVWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDYAGTEAQK
Ga0192961_1016416613300018980MarineMGIFNINLNKKQKMVFHVTNYMRETNVWMIRKMRWILWGGVAATPIYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0192961_1016457623300018980MarineMGIFNINLNKKQKMVFHVTNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0192968_1011723823300018981MarineMVFHITNFMRETNVWMIRKMRWILWCTFGFLPVYRNVYWDYLGRRVAWKDSLSGKTEDQK
Ga0192982_1001252213300019021MarineMGNKINKSMVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0192982_1027448613300019021MarineMVFHITNFMRETNTWMIRKMRWILWCTFSFVPIYRNVYWDYLGRRVAWKDSYAGKSEADK
Ga0193336_1040903123300019045MarineMVFHITNYMRETNVWMIRKMRWILWGGVSAVPIFRCTYWDFLGRRVAWKDHFGYYGTEDEKK
Ga0192981_1021936313300019048MarineTWGYNKINKSMVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0192981_1025468313300019048MarineMVFHITNYMRETNVWMIRKCRWIFWGAVMATPIYRCTYWDYLGRRVAWRDSLGFWGTE
Ga0193082_1067689213300019049MarineMVFHITNYMRETNVWMIRKMRWIFWGVFSFVPFYRTFYWDYLGRRVAWKDDFKGTE
Ga0188870_1013031433300019149Freshwater LakeMVFHITNYMRETNVWMIRKMRWILWGMVTCIPIFRITYWDYLGRRVSWRDHLFGGSEA
Ga0188870_1013626623300019149Freshwater LakeMVFHITNYMRETNVWMIRKCRWIIWLTMGSVPIFRMTYYEYLGRRQAYWSYYMGGSEDERREYAQT
Ga0192888_1021135523300019151MarineMVFHITNYMRETNTWMIRKMRWIFWSFFLMVPMYRNFYWDYLGRRVAWKDDF
Ga0192975_1021567423300019153MarineSMVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0192975_1025985413300019153MarineLAKQGEMVFHITNFMRETNTWMIRKMRWILWCTFSFVPIYRNVYWDYLGRRVAWKDSYAGKSEADK
Ga0194113_1075928513300020074Freshwater LakeMVFHISNYMRETNVWMIRKCRWIFWSIGASVPIYRNVYWDFLGRRVAWRDHYAGTE
Ga0194111_1094700213300020083Freshwater LakeMVFHIMNYMRETNVWMIRKMRWIFWSLALGVPFYRNTYWDYLGRRVAWRDHLFGGTEAEK
Ga0194118_1008076023300020190Freshwater LakeMVFHVSNYMRETNVWMIRKMRWIFWSIVAAVPVYRNTYWDYLGRRGAWRDYYFGGTEAEKMAKAEA
Ga0194118_1027593113300020190Freshwater LakeMVFHIMNYMRETNVWMIRKMRWIFWSLALGIPFYRNTYWDYLGRRVAWRDHLFGGTEAEK
Ga0211731_1004473413300020205FreshwaterMIRKGRWFLWSMVLAVPIYRNTYWDYLGRRVAWRDSLGFWGTEDEKKIKAE
Ga0208231_100897613300020557FreshwaterMRETNVWMIRKMRWIFWGLALSTPIYRNTYWDYLGKRAAWRDSLFGGTEAEKK
Ga0206123_1025813813300021365SeawaterMVFHITNYMRETNVWMIRKCRWIFWGGVMSIPIYRCTYWDYLGRRVAWRDSLGFFGTEEEKKAKAEADIG
Ga0063132_11025113300021872MarineVFHITNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0063147_11992213300021874MarineVFHVTNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWKDTLFGGTEEEKK
Ga0244777_1049083013300024343EstuarineMVFHITNYMRETNVWMIRKMRWILWGTFGFVPAYRNFYWDYLGRRVAWKDSMSGKTDAQR
Ga0209198_111817823300025640Pelagic MarineMVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAE
Ga0208544_1025347613300025887AqueousMVFHVTNYMRETNVWMIRKMRWILWCTFGFIPAYRNFYWDYLGRRVAWKDSLSGKTDADR
Ga0247594_108709213300026448SeawaterNVWMIRKMRWILWGGFAATPFYRNTYWYFLGRRVAWRDTLFGGTEEEKK
Ga0209084_123362913300027749Freshwater LakeMVFHITNYMRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKA
Ga0209598_1005062623300027760Freshwater LakeMVFHVTNYMRETNVWMIRKGRWLLWGMCGFVPMYRNFYWDFLGRRAAYKDYYSGLSEDEKRENAN
Ga0311342_1121960613300029955BogMVFHVTNYMRETNVWMIRKMRWMLWGFVGFIPLYRNFYWDFHGRRVAFKNWLAGKSEDQQ
Ga0210277_1009633613300030528SoilKMVFHVTNYMRETNVWMIRKCRWILWGVVGFIPAYRNFYWDYLGRRVALKDWLYGGTEH
Ga0247637_113940313300030604SoilVVFHVTNYMRETNVWMIRKGRWILWGLVGFVPIYRNVYWDYLGRRVAVSNWLYGGTEKE
Ga0247634_1040461713300030609SoilFHITNYMRETNVWMIRKMRWLLWGFVGFIPIYRNVYWDYLGRRVAVGNWLSRKSD
Ga0307401_1046235813300030670MarineIIMVFHITNYMRETNTWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLGGTEEE
Ga0307398_1074350313300030699MarineLIIMVFHITNYMRETNTWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLGGTEEEK
Ga0307400_1099979423300030709MarineMVFHITNYMRETNTWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLGGTEEEK
Ga0265460_1179074613300030740SoilTKMVFHVTNYMRETNVWMIRKMRWILWGTVGFIPAYRNFYWDFLGRRVAFKDWLYGGTE
Ga0265459_1245754423300030741SoilVFHVTNYMRETNVWMIRKGRWILWGIVGFIPAYRNFYWDYLGRRVALKDWLYGGTEH
Ga0265459_1265485613300030741SoilKMVFHVTNYMRETNVWMIRKMRWILWGTVGFIPAYRNFYWDFLGRRVAFKDWLYGGTE
Ga0265459_1295911913300030741SoilNYMRETNVWMIRKMRWMLWGLVGFVPVYRNVYWDYHGRRVAVKKWFAGKTEKEQKRRS
Ga0265461_1232790713300030743SoilFHVTNYMRETNVWMIRKMRWILWGTVGFIPAYRNFYWDFLGRRVAFKDWLYGGTE
Ga0170824_12615850313300031231Forest SoilANIKMVFHVTNYMRETNVWMIRKGRWILWSIVGFIPVYRNVYWDYLGRRVALKQWLFGGSEQK
Ga0307392_103364523300031550MarineVFHIANYMRETNVWMIRKMRWMFWGIVAVVPIYRNTYWDYLGRRSAWREYYFGGT
Ga0307386_1051599423300031710MarineCIEKMVFHVTNYMRETNVWMIRKCRWFFWGAVMATPIYRCTYWDYLGRRVAWRESLGFWG
Ga0307396_1051081623300031717MarineIMVFHVTNYMRETNVWMIRKCRWIFWLSVTSIMIYRVTYWDYLGKRVMWKDHLGWYGSEKEKKKEAEG
Ga0307391_1071790723300031729MarineVFHVTNYMRETNVWMIRKCRWIFWLSVTSIMIYRVTYWDYLGKRVMWKDHLGWYGSEKEKKKEAEG
Ga0307397_1041999713300031734MarineIKIIMVFHVTNYMRETNVWMIRKCRWIFWLSVTSIMIYRVTYWDYLGKRVMWKDHLGWYGSEKEKKKEAEG
Ga0307397_1053087713300031734MarineNFMRETNVWMIRKMRWILWCTFGFLPVYRNVYWDYLGRRVAWKDSLSGKTEDQK
Ga0307384_1042122913300031738MarineMVFHVTNYMRETNVWMIRKMRWILWGGVMATPIYRCTYWDFLGKRVAWRNHLFGGTPEE
Ga0315908_1016368513300031786FreshwaterRIESNIIKMVFHITNYMRETNVWMIRKMRWIFWGLALSTPIYRNTYWDYLGKRAAWRDSLFGGTEAEKK
Ga0314689_1069035823300032518SeawaterFHITNYMRETNTWMIRKSRWILWGTFGSVPFYRNTYWDYLGRRVAWKEYFDGKTEEERIADA
Ga0314680_1071830813300032521SeawaterKKMVFHVTNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0314682_1061196623300032540SeawaterVFHVTNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0314683_1084895923300032617SeawaterVFHITNYMRETNTWMIRKMRWIMWGTVSFVPLYRNFYWDYLGRRTAWKDYFNS
Ga0314673_1054675213300032650SeawaterNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0314687_1072914723300032707SeawaterVFHVTNYMRETNVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAE
Ga0314669_1067439013300032708SeawaterTNYMRETNTWMIRKSRWILWGTFGSVPFYRNTYWDYLGRRVAWKEYFDGKTEEERIADA
Ga0314669_1076314113300032708SeawaterKKKMVFHVTNYMRETNVWMIRKMRWILWGGVAATPFYRNTYWDFLGRRVAWRDTLFGGTEEEKK
Ga0314681_1076359223300032711SeawaterITNYMRETNTWMIRKSRWILWGTFGSVPFYRNTYWDYLGRRVAWKEYFDGKTEEERIADA
Ga0314690_1061184323300032713SeawaterFHITNYMRETNTWMIRKMRWIMWGTVSFVPLYRNFYWDYLGRRTAWKDYFNS
Ga0314710_1043535613300032742SeawaterVWMIRKMRWILWGMCLSTPIYRNTYWDYLGRRVAWRDSLGFWGTEEEKKEKAE
Ga0315742_1286454613300032756Forest SoilHITNYMRETNVWMIRKMRWILWGIVLAIPVYRNTYWDYLGRRVAWRNWFDRRSEAEK
Ga0307390_1107983023300033572MarineFHITNYMRETNTWMIRKMRWIFWSFFSFVPFYRTFYWDFLGRRVAWKDDLGGTEEEK
Ga0334989_0386283_27_2513300033984FreshwaterMINNIIINKKIMVFHITNYMRETNVWMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGNEEEKKA
Ga0335005_0563476_473_6193300034022FreshwaterMIRKGRWILWGLVLSTPIYRNTYWDYLGRRVAWRDSLGFWGNEEEKKA
Ga0310130_0107842_87_2723300034073Fracking WaterMVFHVTNYMRETNVWMIRKGRWILWSMCLSLPVYRNVYWDYLGRRVAWKDYFSGLTEEEK
Ga0334997_0825650_398_5563300034280FreshwaterWMIRKMRWIFWSFGLSVPIYRNTYWDYLGRRAAWRDSLSFKTEDEKRQEAEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.