Metagenome Family F076858

Overview

Basic Information

• Family ID: F076858
• Family Type: Metagenome
• Number of Sequences: 117
• Average Sequence Length: 37 residues
• Representative Sequence: MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGGDK
• Number of Associated Samples: 62
• Number of Associated Scaffolds: 117

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 88.89 %
• % of genes near scaffold ends (potentially truncated): 12.82 %
• % of genes from short scaffolds (< 2000 bps): 63.25 %
• Associated GOLD sequencing projects: 58
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (56.410 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.205 % of family members)
• Environment Ontology (ENVO): Unclassified (64.103 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (64.103 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 49.23%
  β-sheet: 0.00%
  Coil/Unstructured: 50.77%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 117 Family Scaffolds
PF13203	DUF2201_N	5.98
PF11775	CobT_C	5.13
PF07728	AAA_5	4.27
PF03237	Terminase_6N	3.42
PF00004	AAA	2.56
PF01612	DNA_pol_A_exo1	1.71
PF00092	VWA	1.71
PF13384	HTH_23	1.71
PF10765	Phage_P22_NinX	1.71
PF13481	AAA_25	0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 117 Family Scaffolds
COG1734	RNA polymerase-binding transcription factor DksA	Transcription [K]	0.85

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	43.59 %
Unclassified	root	N/A	56.41 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	1.71 %
Unclassified	root	N/A	56.41 %
Viruses	superkingdom	All Organisms → Viruses	41.88 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.71 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	6.84 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Unclassified	root	N/A	56.41 %
unclassified viruses	clade	All Organisms → Viruses → unclassified viruses	1.71 %

Level 4

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.85 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	6.84 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.85 %
Unclassified	root	N/A	56.41 %
unclassified DNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses	1.71 %

Level 5

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.85 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.85 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Unclassified	root	N/A	56.41 %
unclassified dsDNA viruses	no rank	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses	1.71 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	6.84 %

Level 6

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.85 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6.84 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.85 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Unclassified	root	N/A	56.41 %

Level 7

Name	Rank	Taxonomy	Distribution
Ectothiorhodospiraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae	0.85 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	6.84 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.85 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Unclassified	root	N/A	56.41 %

Level 8

Name	Rank	Taxonomy	Distribution
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.85 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Spiribacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter	0.85 %
Unclassified	root	N/A	56.41 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %

Level 9

Name	Rank	Taxonomy	Distribution
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.85 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Unclassified	root	N/A	56.41 %
unclassified Spiribacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter	0.85 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %

Level 10

Name	Rank	Taxonomy	Distribution
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Spiribacter sp. C176	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176	0.85 %
Unclassified	root	N/A	56.41 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.85 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %

Level 11

Name	Rank	Taxonomy	Distribution
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	0.85 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	32.48 %
Prokaryotic dsDNA virus sp.	species	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	1.71 %
Spiribacter sp. C176	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Spiribacter → unclassified Spiribacter → Spiribacter sp. C176	0.85 %
Unclassified	root	N/A	56.41 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	6.84 %

Associated Scaffolds

Scaffold	Taxonomy	Length
(restricted) 3300013126|Ga0172367_10012903	All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.	8642
(restricted) 3300013126|Ga0172367_10020584	Not Available	6235
(restricted) 3300013126|Ga0172367_10694327	Not Available	537
(restricted) 3300013132|Ga0172372_10180304	Not Available	1626
(restricted) 3300027728|Ga0247836_1280463	Not Available	606
(restricted) 3300027730|Ga0247833_1049316	All Organisms → Viruses → Predicted Viral	2295
(restricted) 3300027730|Ga0247833_1117654	All Organisms → Viruses → Predicted Viral	1133
(restricted) 3300027970|Ga0247837_1138309	All Organisms → Viruses → Predicted Viral	1105
(restricted) 3300028553|Ga0247839_1126741	All Organisms → Viruses → Predicted Viral	1156
(restricted) 3300028569|Ga0247843_1047584	All Organisms → Viruses → Predicted Viral	2464

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	98.29%
Terrestrial	Environmental → Terrestrial	1.71%

Category

Habitat	Taxonomy	Distribution
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.85%
Freshwater	Environmental → Aquatic → Freshwater	91.45%
Marine	Environmental → Aquatic → Marine	6.84%
Soil	Environmental → Terrestrial → Soil	0.85%

Type

Habitat	Taxonomy	Distribution
Coastal	Environmental → Aquatic → Marine → Coastal	4.27%
Lake	Environmental → Aquatic → Freshwater → Lake	39.32%
Lentic	Environmental → Aquatic → Freshwater → Lentic	34.19%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.42%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	14.53%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.56%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.85%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	39.32%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	34.19%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	14.53%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	4.27%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.42%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.85%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.85%

Habitat

Habitat	Taxonomy	Distribution
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.85%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.56%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	18.80%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	14.53%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	28.21%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	1.71%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	5.98%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.42%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	4.27%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	17.09%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.71%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.85%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068876_100136165	3300005527	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDK*
Ga0049081_100265713	3300005581	Freshwater Lentic	MTEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDK*
Ga0049081_100300132	3300005581	Freshwater Lentic	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK*
Ga0049080_100160588	3300005582	Freshwater Lentic	EIAEFLRALNGALGLIVVAICVYFLACMIIGRGDK*
Ga0049080_100817225	3300005582	Freshwater Lentic	MTEIAEFLRALNGALGLIAIAFCVYFLASMFMGKGDK*
Ga0078894_1001076611	3300005662	Freshwater Lake	MSVIAEVLKGLNAALGLICIAFCVYFLACIISGGDDK*
Ga0078894_100340026	3300005662	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0078894_107485571	3300005662	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACILTSKGDKE*
Ga0079957_10132896	3300005805	Lake	MDEIAEFLRALNGALGLIAIAFCVYFLACMFIGRNDK*
Ga0079957_10695304	3300005805	Lake	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGDKE*
Ga0114340_100049536	3300008107	Freshwater, Plankton	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGDGE*
Ga0114340_10234032	3300008107	Freshwater, Plankton	MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGDDK*
Ga0114344_12037903	3300008111	Freshwater, Plankton	GKMAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0114350_100446112	3300008116	Freshwater, Plankton	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKE*
Ga0114350_10076424	3300008116	Freshwater, Plankton	MAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0114350_10077925	3300008116	Freshwater, Plankton	MREFAEFLRMFNDALGLILIAFCVYFLACLFMGRSNDNE*
Ga0114350_10856363	3300008116	Freshwater, Plankton	MNEIAEFLRALNGALGLICIAIAVYFLACIVMGKGGDK*
Ga0114350_10952933	3300008116	Freshwater, Plankton	MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK*
Ga0114350_11160723	3300008116	Freshwater, Plankton	MDEIAEFLRSLNGALGLIVVAICVYFLACMIMVRGDK*
Ga0114350_11656254	3300008116	Freshwater, Plankton	MEEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE*
Ga0114355_12183404	3300008120	Freshwater, Plankton	MSEIVEILRALNGALGVICIAFCVYFLACIISGGDK*
Ga0114841_10267198	3300008259	Freshwater, Plankton	MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDDK*
Ga0114363_100198522	3300008266	Freshwater, Plankton	MREFAEFLRMLNDALGLIAIAFCVYFLACILTSKGDKE*
Ga0114363_100541814	3300008266	Freshwater, Plankton	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDDK*
Ga0114363_10126427	3300008266	Freshwater, Plankton	MSEIAEALRMLNGALGLICIAFCVYFLACMLMGRGDDE*
Ga0114363_10137975	3300008266	Freshwater, Plankton	MSEIAEFLRALNGALGLICIAFCVYFLACIISGGDDK*
Ga0114363_10393408	3300008266	Freshwater, Plankton	MSEIAEFLRALNGALGLICIAFCVYFLACLISGGDDK*
Ga0114363_10463687	3300008266	Freshwater, Plankton	MDEIAEFLRALNGALGLIVVAICVYFLACIIIGRGDDK*
Ga0114363_11700174	3300008266	Freshwater, Plankton	MSEIAEILRALNGALGLICIAFCVYFLACIISGGDK*
Ga0114364_11877192	3300008267	Freshwater, Plankton	MNEIAEFLRALNGALGLICIAVAVYFLACIVMGKGDDK*
Ga0114876_10909842	3300008448	Freshwater Lake	MSEIAEFLRALNGALGLICIAFCVYFLACLISGGGDE*
Ga0114880_12432391	3300008450	Freshwater Lake	MDEIAEFLRALNGALGLIAIAFCVYFLACIIIGRGDDK*
Ga0105103_100704106	3300009085	Freshwater Sediment	MSEIAEFLRALNGALGLICIAFCVYFLACIVMGRGDKE*
Ga0105104_100155197	3300009168	Freshwater Sediment	MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGGDK*
Ga0105104_100297853	3300009168	Freshwater Sediment	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDKE*
Ga0129333_106486244	3300010354	Freshwater To Marine Saline Gradient	MREFAELLRMFNDALGLILIAFCVYFLACIVMGRGDKE*
Ga0129333_106967723	3300010354	Freshwater To Marine Saline Gradient	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDKE*
Ga0129333_107000272	3300010354	Freshwater To Marine Saline Gradient	MNEVAEFLRALNGALGLIAIAFCVYFLACMFIGRGDK*
Ga0129333_110871273	3300010354	Freshwater To Marine Saline Gradient	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGEDK*
Ga0129336_1000491913	3300010370	Freshwater To Marine Saline Gradient	MAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK*
Ga0164292_103681622	3300013005	Freshwater	MREFAEFLRMLNEALGLIAIAFCVYFLACMFIGRGDKE*
(restricted) Ga0172367_100129039	3300013126	Freshwater	MNEIAEVLKGLNAALGLICIAFCVYLIACILSGGDDK*
(restricted) Ga0172367_100205842	3300013126	Freshwater	MVEIAEFLRALNGALGLICIAIAVYFLACIVIGKGGDK*
(restricted) Ga0172367_106943272	3300013126	Freshwater	MVEIAEFLRALNGALGLICIAFCVYLLACILSGGKDK*
(restricted) Ga0172372_101803041	3300013132	Freshwater	MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGKDK*
Ga0181338_10345244	3300015050	Freshwater Lake	MDEIAEFLRSLNGALGLIVVAICVYFLACMIIGRGEK*
Ga0181363_10712103	3300017707	Freshwater Lake	MDEIAEFLRLLNGALGLIVVAICVYFLACIIIGRGDDK
Ga0181352_10268405	3300017747	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDKE
Ga0181352_10351052	3300017747	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDK
Ga0181352_10578563	3300017747	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIVMGRGDKE
Ga0181352_11750712	3300017747	Freshwater Lake	MSEIAEFLRMFNDALGLILIAFCVYFLACIVMGRGGDE
Ga0181352_12062341	3300017747	Freshwater Lake	MREFAEFLRMLNDALGLIAIAFCVYFLACILTSRGDKE
Ga0181344_10122085	3300017754	Freshwater Lake	MSEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDKE
Ga0181344_11049521	3300017754	Freshwater Lake	GPVSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDDK
Ga0181344_11602081	3300017754	Freshwater Lake	LYRCPCDRRGRRTMREFAEFLQMLNSALGLIAIAFCVYFLACILTSKGDKE
Ga0181344_12084333	3300017754	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE
Ga0181356_10872767	3300017761	Freshwater Lake	NEVAEFLQKLNGALGLIVVAICVYFLACMVIGRGDK
Ga0181358_10552651	3300017774	Freshwater Lake	MDDIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK
Ga0181357_10595502	3300017777	Freshwater Lake	MSEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDKK
Ga0181346_10712105	3300017780	Freshwater Lake	MDEIAEFLRALNGALGLIAVAFCVYFLACMIIGRGDK
Ga0181355_10137924	3300017785	Freshwater Lake	MSEIAEILRALNGALGLICIAFCVYFLACIISGGDDK
Ga0181355_10995902	3300017785	Freshwater Lake	MSAIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK
Ga0181355_13231452	3300017785	Freshwater Lake	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDKE
Ga0181359_10322133	3300019784	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0222714_100688965	3300021961	Estuarine Water	MSEIAEFLRALNGALGLICIAFCVYFLACILSGGDDK
Ga0222714_101108443	3300021961	Estuarine Water	MSEIVEILRALNGALGLICIAFCVYFLACIISGGDK
Ga0222712_101063188	3300021963	Estuarine Water	MSEIAEFLRALNGALGLICIAFCVYFLACLLTGGDDK
Ga0181353_10476733	3300022179	Freshwater Lake	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKK
Ga0181353_10623393	3300022179	Freshwater Lake	MNEIAEFLRSLNGALGLICIAIAVYFLACIVMGKGGDK
Ga0181353_10776952	3300022179	Freshwater Lake	MNEVAEFLQKLNGALGLIVVAICVYFLACMIIGRGDK
Ga0181353_11180001	3300022179	Freshwater Lake	MVDIAEFLRALNGALGLICIAFCVYFLACILSGGDDK
Ga0181354_11496672	3300022190	Freshwater Lake	MSAIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDKE
Ga0181351_10851875	3300022407	Freshwater Lake	MDEIAEFLRALNGALGLIAIAFCVYFLACMIIGRGDK
Ga0208974_10364761	3300027608	Freshwater Lentic	MDEIAEFLRALNGALGLIVVAICVYFLACMIIGRGDK
Ga0208974_10378754	3300027608	Freshwater Lentic	MDEIAEFLRLLNSALGLIAIAFCVYFLACMIIGRGDDK
Ga0208975_11310663	3300027659	Freshwater Lentic	MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGDK
Ga0209033_12192272	3300027697	Freshwater Lake	MVEIAEFLRALNGALGLICIAFCVYFLACILSGGDDK
(restricted) Ga0247836_12804633	3300027728	Freshwater	PMSEIAEVLRALNGALGLICIAICVYFLACIVIGRGDKE
(restricted) Ga0247833_10493164	3300027730	Freshwater	MSEIAEILRALNGALGLICIAFCVYFLACIVIGRGDK
(restricted) Ga0247833_11176543	3300027730	Freshwater	MSEIAEVLRALNGALGLICIAICVYFLACIVIGRGDKE
Ga0209593_101566911	3300027743	Freshwater Sediment	MSEIAEFLRALNGALGLIAIAFCVYFLACIISGGG
Ga0209358_102710004	3300027804	Freshwater Lake	YRRGMRMAEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE
Ga0209990_1000129334	3300027816	Freshwater Lake	MAEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0209990_100056066	3300027816	Freshwater Lake	MSEIAEVLRALNGALGLICIAFCVYFLACIISGGDK
(restricted) Ga0247837_11383092	3300027970	Freshwater	MSEIAEILRALNGALGLICIAICVYFLACIVIGRGDKE
Ga0247723_10549682	3300028025	Deep Subsurface Sediment	MSEVAEVLRALNGALGLICIAFCVYFLACIISGGDK
(restricted) Ga0247839_11267413	3300028553	Freshwater	MSEIAEILRALNGALGLICIAFCVYFLACIISGGGK
(restricted) Ga0247843_10475847	3300028569	Freshwater	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGEDK
Ga0315907_1000744210	3300031758	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDDK
Ga0315907_100124856	3300031758	Freshwater	MSEIAEFLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0315909_100064505	3300031857	Freshwater	MEEIAEFLRALNGALGLIAIAFCVYFLACMFMGRGDE
Ga0315909_100566249	3300031857	Freshwater	MREFAEFLRMFNDALGLILIAFCVYFLACLFMGRSNDNE
Ga0315909_101091624	3300031857	Freshwater	MVEIAEFLRALNGALGLICIAFCVYFLACLLSGGDDK
Ga0315909_101142294	3300031857	Freshwater	MSEIVEILRALNGALGVICIAFCVYFLACIISGGDK
Ga0315909_102423044	3300031857	Freshwater	MSEIAEFLRALNGALGLICIAFCVYFLACLISGGDDK
Ga0315909_103032075	3300031857	Freshwater	MSEIAEALRMLNGALGLICIAFCVYFLACMLMGRGDDE
Ga0315909_104643343	3300031857	Freshwater	MREIAEFLRMFNDALGLILIAFCVYFLACIVMGRGDKE
Ga0315909_104676201	3300031857	Freshwater	MREFAEFLRMLNEALGLIAIAFCVYFLACIVMGRGDKE
Ga0315909_105406364	3300031857	Freshwater	VSEIAEFLRALNGALGLIAIAFCVYFLACMFMGRG
Ga0315909_105779833	3300031857	Freshwater	MSEIAEALRMLNGALGLICIAVAVYFLACIVMGKGDDE
Ga0315904_108838462	3300031951	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACMFIGRGDKE
Ga0315904_109011133	3300031951	Freshwater	MDEIAEFLRALNGALGLIVVAICVYFLACIIIGRGDK
Ga0315904_109353582	3300031951	Freshwater	MDEIAEFLRALNGALGLIAIAFCVYFLACIIIGRGDDK
Ga0315901_106565743	3300031963	Freshwater	MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGDDK
Ga0315903_104075394	3300032116	Freshwater	MREFAEFLRMLNDALGLIAIAFCVYFLACIVMGRGDKE
Ga0316621_101224093	3300033488	Soil	MSVIAEVLKGLNAALGLICIAFCVYFLACIISGGDDK
Ga0334982_0033611_1662_1778	3300033981	Freshwater	MREFAEFLRMLNEALGLIAIAFCVYFLACIIIGRGDKE
Ga0334986_0056197_432_548	3300034012	Freshwater	MSEVAEFLRALNGALGLIAIAFCVYFLACMIIGRGDKE
Ga0335021_0161554_588_701	3300034023	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACILSGGDDK
Ga0334987_0636824_3_110	3300034061	Freshwater	MDEIAEFLRSLNGALGLIVVAICVYFLACIIIGRGD
Ga0334995_0037727_1102_1218	3300034062	Freshwater	MNWIAEALQTLNGALGLIVIAFCVYFLACMIIGKGDKK
Ga0335010_0056162_3_131	3300034092	Freshwater	HGESMNWIAEALQTLNGALGLIVIAFCVYFLACMIIGKGDKK
Ga0335036_0002476_6253_6369	3300034106	Freshwater	MSEIAEFLRMLNEALGLIAIAFCVYFLACIVMGRGDKE
Ga0335036_0078973_1760_1873	3300034106	Freshwater	MSVIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0335036_0321910_208_324	3300034106	Freshwater	MSEIAEFLRALNGALGLIAIAFCVYFLACILTSKGDKE
Ga0335036_0429116_2_112	3300034106	Freshwater	AEIAEVLRALNGALGLICIAFCVYFLACIISGGDDK
Ga0335068_0194573_2_109	3300034116	Freshwater	MREFAEFLRMFNDALGLILIAFCVYFLACIVMGRGD