Metagenome / Metatranscriptome Family F076021

Basic Information
Family ID	F076021
Family Type	Metagenome / Metatranscriptome
Number of Sequences	118
Average Sequence Length	37 residues
Representative Sequence	VMQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK
Number of Associated Samples	97
Number of Associated Scaffolds	118

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	93.22 %
% of genes near scaffold ends (potentially truncated)	5.93 %
% of genes from short scaffolds (< 2000 bps)	76.27 %
Associated GOLD sequencing projects	93
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.50

Hidden Markov Model
Column number x ScaleMaximum Observed Maximum Theoretical Color SchemeDefault Consensus Colors CoordinatesModel Alignment

Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (55.085 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (16.102 % of family members)
Environment Ontology (ENVO)	Unclassified (52.542 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (61.017 % of family members)

Multiple Sequence Alignments

Select alignment to view:

Full Alignment
Alignment of all the sequences in the family.
ID â†‘ ID â†“ Label â†‘ Label â†“ Seq â†‘ Seq â†“ Identity â†‘ Identity â†“ Gaps â†‘ Gaps â†“ Consensus to top Sorting Hide columns by threshold Hide columns by selection Hide columns by gaps Hide seqs by identity Hide seqs by selection Hide seqs by gaps Reset Filter Find Motif (supports RegEx) Invert columns Invert rows Reset Selection Hide residues indices Hide ID/Label Show meta info (Gaps/Ident) Show overview panel Show sequence logo Show gap weights Show conservation weights Show scale slider Hide Label Hide ID Hide gaps % Hide identity score Reset Vis.elements Taylor Buried Cinema Clustal Clustal2 Helix Hydrophobicity Lesk MAE Nucleotide Purine PID Strand Turn Zappo No color Color scheme Add consensus seq Jump to a column Extras Share view (URL)â†ª View in Jalview Export alignment (FASTA) Export alignment (URL) Export selected sequences (FASTA) Export features (GFF) Export MSA image (PNG) Export About the project Report issues User manual Help IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38.40. 1none_0916012 2B570J14230_101299232 3B570J14230_102227012 4GOS2228_10407262 5JGI24766J26685_100076562 6Ga0070374_105584451 7Ga0070374_106882442 8Ga0068877_103152761 9Ga0068877_103355752 10Ga0068877_104839851 11Ga0068877_104851302 12Ga0068877_105668551 13Ga0068876_107890242 14Ga0049085_103008712 15Ga0049084_100789832 16Ga0049084_101499812 17Ga0079957_10423881 18Ga0079957_10483013 19Ga0079301_10127612 20Ga0079301_11721922 21Ga0102875_11448252 22Ga0102916_12273052 23Ga0102863_10575503 24Ga0102903_10619742 25Ga0102865_10206074 26Ga0102902_11482282 27Ga0114340_12124052 28Ga0114341_100766893 29Ga0114341_101861472 30Ga0114341_103548792 31Ga0114344_10538632 32Ga0114347_11157953 33Ga0114351_10987822 34Ga0114351_12259763 35Ga0114351_13772431 36Ga0114337_13010391 37Ga0102891_10240254 38Ga0102909_11132332 39Ga0068873_10086643 40Ga0116204_11862311 41Ga0129324_100324823 42Ga0151620_10000943 43Ga0129338_10769851 44Ga0164293_101609785 45Ga0172368_101177993 46Ga0172367_102284562 47Ga0172370_101883332 48Ga0172375_100928832 49Ga0172376_106119631 50Ga0119946_10053502 51Ga0188839_10011553 52Ga0194113_1000771412 53Ga0194110_106692752 54Ga0211734_101546102 55Ga0211733_103746042 56Ga0194118_105048921 57Ga0194131_100128523 58Ga0194121_103584232 59Ga0208326_1033992 60Ga0208084_10021123 61Ga0208202_10116923 62Ga0208089_10193211 63Ga0208465_10002649 64Ga0194133_102542922 65Ga0222716_102183302 66Ga0222714_100027656 67Ga0222714_100925522 68Ga0222714_101278751 69Ga0222713_100611116 70Ga0222713_100902902 71Ga0222713_107131001 72Ga0212121_100742513 73Ga0247724_10013303 74Ga0255205_10464002 75Ga0255207_10049292 76Ga0255219_10133312 77Ga0255219_10353232 78Ga0244775_100483535 79Ga0244776_104853312 80Ga0255189_10489992 81Ga0255186_10287121 82Ga0255246_10226474 83Ga0209835_10186732 84Ga0256355_11044832 85Ga0208926_10176213 86Ga0208307_10445472 87Ga0208173_10280001 88Ga0255084_10093252 89Ga0208788_10522043 90Ga0208788_11184021 91Ga0208787_11356132 92Ga0255120_10236914 93Ga0209033_10423913 94Ga0209443_10294005 95Ga0247833_11015842 96Ga0209972_104385822 97Ga0209358_100450804 98Ga0209985_104846812 99Ga0247838_10837333 100Ga0255192_10279842 101Ga0255201_10615391 102Ga0247835_12001402 103Ga0247831_10779242 104Ga0247840_101849432 105Ga0315907_101769622 106Ga0315904_111220702 107Ga0315904_113395822 108Ga0315902_108077372 109Ga0315903_103565783 110Ga0334978_0214111_784_894 111Ga0334979_0003052_6038_6154 112Ga0335001_0084250_1720_1824 113Ga0310130_0053992_4_117 114Ga0335025_0087402_1824_1931 115Ga0335025_0138042_2_112 116Ga0335027_0174322_1405_1518 117Ga0335066_0228879_233_346 118Ga0335068_0066663_250_363
Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.
ID â†‘ ID â†“ Label â†‘ Label â†“ Seq â†‘ Seq â†“ Identity â†‘ Identity â†“ Gaps â†‘ Gaps â†“ Consensus to top Sorting Hide columns by threshold Hide columns by selection Hide columns by gaps Hide seqs by identity Hide seqs by selection Hide seqs by gaps Reset Filter Find Motif (supports RegEx) Invert columns Invert rows Reset Selection Hide residues indices Hide ID/Label Show meta info (Gaps/Ident) Show overview panel Show sequence logo Show gap weights Show conservation weights Show scale slider Hide Label Hide ID Hide gaps % Hide identity score Reset Vis.elements Taylor Buried Cinema Clustal Clustal2 Helix Hydrophobicity Lesk MAE Nucleotide Purine PID Strand Turn Zappo No color Color scheme Add consensus seq Jump to a column Extras Share view (URL)â†ª View in Jalview Export alignment (FASTA) Export alignment (URL) Export selected sequences (FASTA) Export features (GFF) Export MSA image (PNG) Export About the project Report issues User manual Help IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38.40. 1none_0916012 2Ga0068877_103152761 3Ga0049084_100789832
Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.
ID â†‘ ID â†“ Label â†‘ Label â†“ Seq â†‘ Seq â†“ Identity â†‘ Identity â†“ Gaps â†‘ Gaps â†“ Consensus to top Sorting Hide columns by threshold Hide columns by selection Hide columns by gaps Hide seqs by identity Hide seqs by selection Hide seqs by gaps Reset Filter Find Motif (supports RegEx) Invert columns Invert rows Reset Selection Hide residues indices Hide ID/Label Show meta info (Gaps/Ident) Show overview panel Show sequence logo Show gap weights Show conservation weights Show scale slider Hide Label Hide ID Hide gaps % Hide identity score Reset Vis.elements Taylor Buried Cinema Clustal Clustal2 Helix Hydrophobicity Lesk MAE Nucleotide Purine PID Strand Turn Zappo No color Color scheme Add consensus seq Jump to a column Extras Share view (URL)â†ª View in Jalview Export alignment (FASTA) Export alignment (URL) Export selected sequences (FASTA) Export features (GFF) Export MSA image (PNG) Export About the project Report issues User manual Help IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38 1Ga0188839_10011553 2Ga0068877_103355752 3Ga0068877_104851302 4Ga0068876_107890242 5Ga0079957_10483013 6Ga0079301_10127612 7Ga0079301_11721922 8Ga0102903_10619742 9Ga0102865_10206074 10Ga0114341_101861472 11Ga0102909_11132332 12Ga0129338_10769851 13Ga0172375_100928832 14Ga0211734_101546102 15Ga0194131_100128523 16Ga0208084_10021123 17Ga0194133_102542922 18Ga0222716_102183302 19Ga0222714_100027656 20Ga0222713_100611116 21Ga0255219_10133312 22Ga0334978_0214111_784_894 23Ga0334979_0003052_6038_6154 24Ga0335066_0228879_233_346
Powered by MSAViewer

Neighboring Clusters of Orthologous Genes (COGs)

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45%
Feature Viewer
Position : 0 Zoom : x 1 + Add Multiple Variants Enter the variants Position Original Variant Get Predictions Get Predictions Enter the variants Position Original Variant A / Ala R / Arg N / Asn D / Asp C / Cys E / Glu Q / Gln G / Gly H / His I / Ile L / Leu K / Lys M / Met F / Phe P / Pro S / Ser T / Thr W / Trp Y / Tyr V / Val
Powered by Feature Viewer

Structure Viewer
WebGL does not seem to be available. This can be caused by an outdated browser, graphics card driver issue, or bad weather. Sometimes, just restarting the browser helps. Also, make sure hardware acceleration is enabled in your browser. For a list of supported browsers, refer to http://caniuse.com/#feat=webgl. Load File(s)

Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.50
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.50
Powered by PDBe Molstar

Pfam ID	Name	% Frequency in 118 Family Scaffolds
PF14117	DUF4287	45.76
PF00173	Cyt-b5	11.02
PF00578	AhpC-TSA	8.47
PF00106	adh_short	4.24
PF11253	DUF3052	4.24
PF13527	Acetyltransf_9	2.54
PF10996	Beta-Casp	1.69
PF04229	GrpB	1.69
PF01523	PmbA_TldD	1.69
PF00005	ABC_tran	1.69

COG ID	Name	Functional Category	% Frequency in 118 Family Scaffolds
COG0312	Zn-dependent protease PmbA/TldA or its inactivated homolog	General function prediction only [R]	1.69
COG2320	GrpB domain, predicted nucleotidyltransferase, UPF0157 family	General function prediction only [R]	1.69
COG1579	Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain	General function prediction only [R]	0.85

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	44.92 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	44.92 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	44.92 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	36.44 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	31.36 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	16.95 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
Candidatus Nanopelagicales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales	5.93 %
Unclassified	root	N/A	55.08 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	5.93 %

Name	Rank	Taxonomy	Distribution
actinobacterium acAMD-5	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	0.85 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.08 %
Candidatus Nanopelagicaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae	5.93 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
actinobacterium acAMD-5	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	0.85 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.08 %
Candidatus Nanopelagicus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus	5.08 %
Candidatus Planktophila	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila	0.85 %
Unclassified	root	N/A	55.08 %

Name	Rank	Taxonomy	Distribution
actinobacterium acAMD-5	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5	0.85 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	5.08 %
Candidatus Nanopelagicus abundans	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus → Candidatus Nanopelagicus abundans	5.08 %
Candidatus Planktophila	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila	0.85 %
Unclassified	root	N/A	55.08 %

Visualization
Download SVG Download PNG Download CSV
Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
(restricted) 3300013123\|Ga0172368_10117799	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1504	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10228456	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1147	Open in IMG/M
(restricted) 3300013136\|Ga0172370_10188333	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1305	Open in IMG/M
(restricted) 3300013137\|Ga0172375_10092883	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2652	Open in IMG/M
(restricted) 3300014720\|Ga0172376_10611963	Not Available	596	Open in IMG/M
(restricted) 3300027730\|Ga0247833_1101584	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1272	Open in IMG/M
(restricted) 3300028044\|Ga0247838_1083733	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1401	Open in IMG/M
(restricted) 3300028114\|Ga0247835_1200140	Not Available	682	Open in IMG/M
(restricted) 3300028559\|Ga0247831_1077924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1535	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10184943	Not Available	1196	Open in IMG/M

Showing 1 to 10 of 118 entries

Previous1 2 3 4 5…12Next

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.07%
Terrestrial	Environmental → Terrestrial	5.93%

Habitat	Taxonomy	Distribution
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	5.93%
Freshwater	Environmental → Aquatic → Freshwater	73.73%
Marine	Environmental → Aquatic → Marine	20.34%

Habitat	Taxonomy	Distribution
Coastal	Environmental → Aquatic → Marine → Coastal	1.69%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.85%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	11.86%
Lake	Environmental → Aquatic → Freshwater → Lake	35.59%
Lentic	Environmental → Aquatic → Freshwater → Lentic	22.03%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.85%
River	Environmental → Aquatic → Freshwater → River	10.17%
Unclassified	Environmental → Aquatic → Marine → Unclassified	6.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	5.93%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	4.24%

Habitat	Taxonomy	Distribution
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	5.08%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	11.02%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	35.59%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	16.95%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	10.17%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	6.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	5.93%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	4.24%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.69%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.85%
Unclassified	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified	0.85%

Habitat	Taxonomy	Distribution
Anoxic Lake Water	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water	2.54%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.85%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.85%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	4.24%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.85%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	10.17%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	0.85%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	5.93%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.85%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	16.10%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	10.17%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	5.08%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	4.24%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	1.69%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.85%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.85%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.85%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	12.71%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.08%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.54%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.85%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	8.47%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.69%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine	0.85%
Marine Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine	0.85%

Visualization
Download SVG Download PNG Download CSV
Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2236876005	Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-3LG-ETM-15m	Environmental	Open in IMG/M
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001948	Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005585	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M

Showing 1 to 10 of 97 entries

Previous1 2 3 4 5…10Next

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
none_0916012	2236876005	Marine Estuarine	MQAKISNVLVAAQKVIAPAAVVNLKAAVIELQGPAKK
B570J14230_101299232	3300001282	Freshwater	VIQAKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK*
B570J14230_102227012	3300001282	Freshwater	MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDLAKK*
GOS2228_10407262	3300001948	Marine	MQAKISNALVAAQKVIAPAAVVILKAVVIELQGPAKK*
JGI24766J26685_100076562	3300002161	Freshwater And Sediment	VIQAKILNALVAARKAIAPAAAVSLKAAVIELQGLAKK*
Ga0070374_105584451	3300005517	Freshwater Lake	VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK*
Ga0070374_106882442	3300005517	Freshwater Lake	MQAKISNALVAAQKVIAPAAVVILKAAVIELQDLAKK*
Ga0068877_103152761	3300005525	Freshwater Lake	VIQAKILNALVAARKAIAPAAAVSLKAAVIELQDLAKK*
Ga0068877_103355752	3300005525	Freshwater Lake	VIQAKISNALVVARKAIAPAAAVSLKAAVIELQGLAKK*
Ga0068877_104839851	3300005525	Freshwater Lake	VIQAKILNALVVARKAIAPAAAVILKAAVIELQGLAKK*
Ga0068877_104851302	3300005525	Freshwater Lake	VIQAKILNALVVARKAIAPAAAVTLKVVVIELQDPAKK*
Ga0068877_105668551	3300005525	Freshwater Lake	VIQAKILNALVVARKAIAPAAVVILKAAVIELQGLAKK*
Ga0068876_107890242	3300005527	Freshwater Lake	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQDPAKK*
Ga0049085_103008712	3300005583	Freshwater Lentic	KISNALVAAQKVIAPAAVVILKAAVIELQDLAKK*
Ga0049084_100789832	3300005585	Freshwater Lentic	VVQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK*
Ga0049084_101499812	3300005585	Freshwater Lentic	MQAKISNVLVAAQKVIAPAAVVNLKAAVIELQDLAKK*
Ga0079957_10423881	3300005805	Lake	MQAKISNAPVAAQKAIALAAVVTRKAAVIELQGLAKK*
Ga0079957_10483013	3300005805	Lake	VIQAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK*
Ga0079301_10127612	3300006639	Deep Subsurface	VMQAKISNAPVAAQKVIALAAAVSLKAAVIELQGLAKKLWQ*
Ga0079301_11721922	3300006639	Deep Subsurface	MQAKILNAPVAVQKVIAPAAVVMLKAAVIELQGLAKK*
Ga0102875_11448252	3300007547	Estuarine	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK*
Ga0102916_12273052	3300007585	Estuarine	MQAKISNVLVAAQKVIAPAAVVILKAAVIELQDLAKK*
Ga0102863_10575503	3300007622	Estuarine	VIQAKISNALVAARKAIAPAAAVILKAAVIELQGLAKK*
Ga0102903_10619742	3300007630	Estuarine	VIQAKSLSVLADALKVIAPAAVVILKAAVIELQDLAKK*
Ga0102865_10206074	3300007639	Estuarine	VIQAKISNALVAARKAIAPAAAVILKAAVIELQDPAKK*
Ga0102902_11482282	3300007644	Estuarine	VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQDLAKK*
Ga0114340_12124052	3300008107	Freshwater, Plankton	VIQAKILNALVVARKAIAPAAAVTLTVVVIELQDPAKK*
Ga0114341_100766893	3300008108	Freshwater, Plankton	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQGLAKK*
Ga0114341_101861472	3300008108	Freshwater, Plankton	VIQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK*
Ga0114341_103548792	3300008108	Freshwater, Plankton	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQGLAKK*
Ga0114344_10538632	3300008111	Freshwater, Plankton	MQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK*
Ga0114347_11157953	3300008114	Freshwater, Plankton	MQAKISNALVAAQKAIALAAVVILKVVVIELQDPAKK*
Ga0114351_10987822	3300008117	Freshwater, Plankton	VIQAKILNALVVARKAIAPAAAVILKAAVIELQDPAKK*
Ga0114351_12259763	3300008117	Freshwater, Plankton	MQAKISNALVAAQKVIALAAVVILKAVVIELQGPAKK*
Ga0114351_13772431	3300008117	Freshwater, Plankton	VIQAKILNALVAVQKAIAPAAVVILKAAVIELQDLAKK*
Ga0114337_13010391	3300008262	Freshwater, Plankton	VIQAKILNALVAVQKVIAPAAVVSLKAAVIELQGLAKK*
Ga0102891_10240254	3300008950	Estuarine	MQAKISNALVAAQKVIAPAAAVILKAAVIELQGPAKK*
Ga0102909_11132332	3300009050	Estuarine	MQAKISNALVAAQKVIAPAAVVILKVVAIESQDLAKK*
Ga0068873_10086643	3300010156	Freshwater Lake	VIQAKILNALVVARKAIAPAAAVSLKAAVIELQDPAKK*
Ga0116204_11862311	3300010293	Anoxic Lake Water	MQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK*
Ga0129324_100324823	3300010368	Freshwater To Marine Saline Gradient	MQAKILNAPVAAQKVIAPAAVVILKAAVIELQGLAKK*
Ga0151620_10000943	3300011268	Freshwater	VIQAKISNALVAARKVIAPAAVVSRKAVVIELQGLAKK*
Ga0129338_10769851	3300012970	Aqueous	VIQAKILNALVVVRKVIAPAAAVILKAAVIELQGPAKK*
Ga0164293_101609785	3300013004	Freshwater	VIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK*
(restricted) Ga0172368_101177993	3300013123	Freshwater	MQAKISNAPVAAQKVIAPAAVVILKAAVIELQDPAKK*
(restricted) Ga0172367_102284562	3300013126	Freshwater	MQAKISNAPVAAQKVIAPAAVVILKAAVIELQDHAKK*
(restricted) Ga0172370_101883332	3300013136	Freshwater	MQAKISNAPVAAQKVIAFAAVVILKAAVIELQDPAKK*
(restricted) Ga0172375_100928832	3300013137	Freshwater	MQAKISNAPVAAQKAIAPAAVVILKAVVIELQGPAKK*
(restricted) Ga0172376_106119631	3300014720	Freshwater	MQAKISNAPVAAQKVIEPAAVVILKAAVIELQDPAKK*
Ga0119946_10053502	3300014801	Aquatic	MQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK*
Ga0188839_10011553	3300019122	Freshwater Lake	VMQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK
Ga0194113_1000771412	3300020074	Freshwater Lake	MQAKFSNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0194110_106692752	3300020084	Freshwater Lake	MQAKICNALVAAQKVIAPAAVVNLKAAVIELQDPAKK
Ga0211734_101546102	3300020159	Freshwater	VVQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK
Ga0211733_103746042	3300020160	Freshwater	VVQAKISNALVAAQKLIALAAVVTRKVVAIGLQGPARK
Ga0194118_105048921	3300020190	Freshwater Lake	MQAKLSNAPVAAQKVIALSAVVILKAAVIELQDPAKK
Ga0194131_100128523	3300020193	Freshwater Lake	VMQAKFSNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0194121_103584232	3300020200	Freshwater Lake	MQAKFSNAPVAAHKVIALAAVVILKAAVIELQDPAKK
Ga0208326_1033992	3300020494	Freshwater	VIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK
Ga0208084_10021123	3300020499	Freshwater	VIQSKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0208202_10116923	3300020514	Freshwater	MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDLAKK
Ga0208089_10193211	3300020543	Freshwater	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQGPAKK
Ga0208465_10002649	3300020570	Freshwater	VIQAKSLNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0194133_102542922	3300021091	Freshwater Lake	MQAKICNALVAAQKVIAPAAVVNLKPAVIELQDPAKK
Ga0222716_102183302	3300021959	Estuarine Water	VIQAKSLNALVAVQKVAAPAAVVILKAAVIELQGLAKE
Ga0222714_100027656	3300021961	Estuarine Water	VIQAKISNALVAARKVIAPAAVVSRKAVVIELQGLAKK
Ga0222714_100925522	3300021961	Estuarine Water	VIQAKISNAPVAARKVIAPAAVVILKAAVIELQGLAKK
Ga0222714_101278751	3300021961	Estuarine Water	VIQAKISNALVAARKAIAPAAAVILKAAVIELQGPAKK
Ga0222713_100611116	3300021962	Estuarine Water	VIQAKISNALVVARKAFAPAAVVMLKAAVIELQGPAKK
Ga0222713_100902902	3300021962	Estuarine Water	VIQAKILNALVVARKAIAPAAAVILKAAVIELQGLAKK
Ga0222713_107131001	3300021962	Estuarine Water	MQAKISNAPVAAQKAIALAAVVTRKAAVIELQGLAKK
Ga0212121_100742513	3300022556	Anoxic Lake Water	MQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0247724_10013303	3300024239	Deep Subsurface Sediment	MQAKILNAPVAVQKVIAPAAVVMLKAAVIELQGLAKK
Ga0255205_10464002	3300024276	Freshwater	MQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK
Ga0255207_10049292	3300024277	Freshwater	VIQAKILNALVVARKAIAPAAAVSLKAAVIELQDPAKK
Ga0255219_10133312	3300024312	Freshwater	VMQAKISNAPVAAQKAIALAAVVIRKAAVIELQGLAKK
Ga0255219_10353232	3300024312	Freshwater	VIQAKILNALVVARKAIAPAAAVSLKAAVIELQGLAKK
Ga0244775_100483535	3300024346	Estuarine	VMQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK
Ga0244776_104853312	3300024348	Estuarine	MQAKISNALVAAQKVIAPAAVVILKVVAIESQDLAKK
Ga0255189_10489992	3300024492	Freshwater	VIQAKISNALVAARKVIAPAAAVSLKAAVIELQDLAKK
Ga0255186_10287121	3300024512	Freshwater	VIQAKILNALVVARKAIAPAAVVILKAAVIELQGLAKK
Ga0255246_10226474	3300024863	Freshwater	MQAKISNALVAAQKVIAPAAVVNLKAAVIELQDLAKK
Ga0209835_10186732	3300025115	Anoxic Lake Water	VMQAKISNAPVAAQKVIALAAVVILKAAVIELQDPAKK
Ga0256355_11044832	3300026563	Freshwater	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQGPAKK
Ga0208926_10176213	3300027205	Estuarine	MQAKISNALVAAQKVAAPAAVVILKAAVIELQGLAKK
Ga0208307_10445472	3300027211	Estuarine	VIQAKISNALVAARKAIAPAAAVILKAAVIELQGLAKK
Ga0208173_10280001	3300027244	Estuarine	AKISNALVAAQKVIAPAAVVILKAAVIELQDLAKK
Ga0255084_10093252	3300027488	Freshwater	MQAKISNVLVAAQKVIAPAAVVILKAAVIELQDLAKK
Ga0208788_10522043	3300027499	Deep Subsurface	VIQAKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK
Ga0208788_11184021	3300027499	Deep Subsurface	MQAKILNAPVAVQKVIALAAAVSLKAAVIELQGLAKK
Ga0208787_11356132	3300027518	Deep Subsurface	MQAKISNAPVAAQKVIALAAAVSLKAAVIELQGLAKK
Ga0255120_10236914	3300027594	Freshwater	VMQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK
Ga0209033_10423913	3300027697	Freshwater Lake	MQAKISNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0209443_10294005	3300027707	Freshwater Lake	VMQAKISNALVAAQKVIAPAAAVILKAAVIELQDLAKK
(restricted) Ga0247833_11015842	3300027730	Freshwater	MQAKISNALVAAQKVIAPAAVVILKAAVIELQGLAKK
Ga0209972_104385822	3300027793	Freshwater Lake	VIQAKISNALVVARKAIAPAAAVSLKAAVIELQGLAKK
Ga0209358_100450804	3300027804	Freshwater Lake	VMQAKISNALVAVQKVIAPAAVVNLKAAVIELQDLAKK
Ga0209985_104846812	3300027806	Freshwater Lake	VIQAKILNALVAVQKAIAPAAAVSLKAAVIELQDPAKK
(restricted) Ga0247838_10837333	3300028044	Freshwater	VQAKISNALVAAQKLIALAAVVTRKVVAIELQGPARK
Ga0255192_10279842	3300028067	Freshwater	VIQAKISNALVVARKAIAPAAAVTLKVVVIELQDPAKK
Ga0255201_10615391	3300028086	Freshwater	MQAKISNALVAAQKVIALAAAVSLKAAVIELQGLAKK
(restricted) Ga0247835_12001402	3300028114	Freshwater	MQAKISNALVATQKVIAPAAVVILKAAVIELQGLAKK
(restricted) Ga0247831_10779242	3300028559	Freshwater	MQAKILNAPVAAQKVIAPAAVVILKAAVIELQGLAKK
(restricted) Ga0247840_101849432	3300028581	Freshwater	MQAKISNAPVAAQKVIAPAAVVILKAAVIELQGLAKK
Ga0315907_101769622	3300031758	Freshwater	VIQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK
Ga0315904_111220702	3300031951	Freshwater	VQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK
Ga0315904_113395822	3300031951	Freshwater	VIQAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK
Ga0315902_108077372	3300032093	Freshwater	QAKILNALVAVQKAIAPAAVVILKAAVIELQGLAKK
Ga0315903_103565783	3300032116	Freshwater	VVQAKILNALVAARKAIALAAVVILKVVVIELQDPAKK
Ga0334978_0214111_784_894	3300033979	Freshwater	MGELSNALVAAQKVIAPAAVVILKAAVIELQDLAKK
Ga0334979_0003052_6038_6154	3300033996	Freshwater	MIQSKSLNALVAVQKVIAPAAVVILKAAVIELQGPAKK
Ga0335001_0084250_1720_1824	3300034064	Freshwater	MQAKISNALVAAQKVIAPAAVVILKAAVIELQGPA
Ga0310130_0053992_4_117	3300034073	Fracking Water	MQAKILNAPVAVQKVIAPAAVVILKAAVIELQGLAKK
Ga0335025_0087402_1824_1931	3300034096	Freshwater	AKISNALVAAQKVIAPAAVVILKAAVIELQGPARK
Ga0335025_0138042_2_112	3300034096	Freshwater	MMQAKISNALVAAQKVIAPAAVVILKAAVIELQGPAR
Ga0335027_0174322_1405_1518	3300034101	Freshwater	MQAKSLNVLADALKVIAPAAVVILKAAVIELQGPAKK
Ga0335066_0228879_233_346	3300034112	Freshwater	MQAKSLNVLADALKVIAPAAVVNLKAAVIELQDPAKK
Ga0335068_0066663_250_363	3300034116	Freshwater	MQAKISNALVAAQKVIAPAALVILKAAVIELQGAAKK

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters