Basic Information | |
---|---|
Family ID | F075859 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 118 |
Average Sequence Length | 40 residues |
Representative Sequence | MRPSRGMGIINPSKMPKAKTITRKDDPNEVKMYAKGGES |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 80.34 % |
% of genes near scaffold ends (potentially truncated) | 87.29 % |
% of genes from short scaffolds (< 2000 bps) | 83.05 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.23 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (52.542 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.271 % of family members) |
Environment Ontology (ENVO) | Unclassified (59.322 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.254 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.96% β-sheet: 0.00% Coil/Unstructured: 91.04% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF13884 | Peptidase_S74 | 1.69 |
PF13414 | TPR_11 | 0.85 |
PF10765 | Phage_P22_NinX | 0.85 |
PF00166 | Cpn10 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.80 % |
Unclassified | root | N/A | 32.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000558|Draft_11619766 | Not Available | 533 | Open in IMG/M |
3300002092|JGI24218J26658_1037219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300002220|MLSBCLC_10099016 | Not Available | 4976 | Open in IMG/M |
3300002408|B570J29032_108964167 | Not Available | 552 | Open in IMG/M |
3300003787|Ga0007811_1001389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3487 | Open in IMG/M |
3300005585|Ga0049084_10033546 | Not Available | 1987 | Open in IMG/M |
3300006030|Ga0075470_10135641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300006086|Ga0075019_10000510 | Not Available | 22339 | Open in IMG/M |
3300006109|Ga0007870_1056401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
3300006121|Ga0007824_1103851 | Not Available | 534 | Open in IMG/M |
3300006802|Ga0070749_10480163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 679 | Open in IMG/M |
3300006803|Ga0075467_10147580 | All Organisms → Viruses → Predicted Viral | 1353 | Open in IMG/M |
3300006920|Ga0070748_1112641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300007171|Ga0102977_1160452 | Not Available | 1084 | Open in IMG/M |
3300007346|Ga0070753_1243617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
3300008113|Ga0114346_1214248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300008117|Ga0114351_1270554 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 827 | Open in IMG/M |
3300008266|Ga0114363_1080770 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
3300008266|Ga0114363_1193755 | Not Available | 631 | Open in IMG/M |
3300008266|Ga0114363_1225486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
3300008339|Ga0114878_1104520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
3300009037|Ga0105093_10573094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300009154|Ga0114963_10260617 | Not Available | 979 | Open in IMG/M |
3300009155|Ga0114968_10314883 | Not Available | 871 | Open in IMG/M |
3300009155|Ga0114968_10530309 | Not Available | 629 | Open in IMG/M |
3300009158|Ga0114977_10121167 | All Organisms → Viruses → Predicted Viral | 1576 | Open in IMG/M |
3300009158|Ga0114977_10620528 | Not Available | 581 | Open in IMG/M |
3300009180|Ga0114979_10264703 | Not Available | 1028 | Open in IMG/M |
3300009183|Ga0114974_10357561 | Not Available | 845 | Open in IMG/M |
3300009183|Ga0114974_10482817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300009684|Ga0114958_10530623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300010354|Ga0129333_10142490 | All Organisms → Viruses → Predicted Viral | 2202 | Open in IMG/M |
3300010370|Ga0129336_10687870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300010885|Ga0133913_10854319 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
3300010885|Ga0133913_11018471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2140 | Open in IMG/M |
3300010885|Ga0133913_11215286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1932 | Open in IMG/M |
3300012348|Ga0157140_10012866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300012970|Ga0129338_1022252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300013372|Ga0177922_10147060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300014960|Ga0134316_1017214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
3300015050|Ga0181338_1028603 | Not Available | 853 | Open in IMG/M |
3300015050|Ga0181338_1052484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 593 | Open in IMG/M |
3300017700|Ga0181339_1031913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300017716|Ga0181350_1044830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1188 | Open in IMG/M |
3300017723|Ga0181362_1042506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
3300017736|Ga0181365_1006843 | All Organisms → Viruses → Predicted Viral | 2823 | Open in IMG/M |
3300017747|Ga0181352_1008369 | All Organisms → Viruses → Predicted Viral | 3396 | Open in IMG/M |
3300017747|Ga0181352_1120295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300017754|Ga0181344_1133819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300017761|Ga0181356_1044662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1545 | Open in IMG/M |
3300017761|Ga0181356_1053772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1382 | Open in IMG/M |
3300017761|Ga0181356_1087569 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
3300017761|Ga0181356_1212847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300017766|Ga0181343_1043093 | All Organisms → Viruses → Predicted Viral | 1341 | Open in IMG/M |
3300017774|Ga0181358_1085266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1149 | Open in IMG/M |
3300017774|Ga0181358_1231840 | Not Available | 589 | Open in IMG/M |
3300017774|Ga0181358_1249634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300017778|Ga0181349_1245791 | Not Available | 599 | Open in IMG/M |
3300017780|Ga0181346_1064931 | Not Available | 1458 | Open in IMG/M |
3300017780|Ga0181346_1313670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300017785|Ga0181355_1046540 | Not Available | 1850 | Open in IMG/M |
3300017785|Ga0181355_1190619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
3300017785|Ga0181355_1316725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300017971|Ga0180438_10393656 | Not Available | 1050 | Open in IMG/M |
3300019784|Ga0181359_1148141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300020688|Ga0214239_114961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300021856|Ga0213850_1500387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2417 | Open in IMG/M |
3300021962|Ga0222713_10224845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
3300021962|Ga0222713_10324440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300022061|Ga0212023_1047100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300022179|Ga0181353_1084325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300022179|Ga0181353_1088794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300022179|Ga0181353_1165565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300022200|Ga0196901_1004152 | Not Available | 6595 | Open in IMG/M |
3300022407|Ga0181351_1016138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3120 | Open in IMG/M |
3300022407|Ga0181351_1081725 | Not Available | 1286 | Open in IMG/M |
3300022407|Ga0181351_1176472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300022747|Ga0228703_1056385 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
3300025357|Ga0208383_1032467 | Not Available | 598 | Open in IMG/M |
3300025417|Ga0208616_1005130 | All Organisms → Viruses | 2310 | Open in IMG/M |
3300025435|Ga0208618_1044920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300025467|Ga0208260_1089077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300025585|Ga0208546_1080464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300025645|Ga0208643_1033121 | All Organisms → Viruses → Predicted Viral | 1695 | Open in IMG/M |
3300025683|Ga0208564_1078411 | Not Available | 1137 | Open in IMG/M |
3300025773|Ga0208104_1010638 | Not Available | 1235 | Open in IMG/M |
3300025887|Ga0208544_10083398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
3300027499|Ga0208788_1046800 | All Organisms → Viruses → Predicted Viral | 1175 | Open in IMG/M |
3300027499|Ga0208788_1124855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300027659|Ga0208975_1017267 | Not Available | 2403 | Open in IMG/M |
3300027708|Ga0209188_1023345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3105 | Open in IMG/M |
3300027732|Ga0209442_1122777 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
3300027733|Ga0209297_1299581 | Not Available | 600 | Open in IMG/M |
3300027734|Ga0209087_1250915 | Not Available | 653 | Open in IMG/M |
3300027747|Ga0209189_1170628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300027763|Ga0209088_10183534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300027896|Ga0209777_10059099 | All Organisms → Viruses → Predicted Viral | 3421 | Open in IMG/M |
3300027896|Ga0209777_10123258 | Not Available | 2173 | Open in IMG/M |
3300028393|Ga0304728_1099859 | Not Available | 1112 | Open in IMG/M |
3300031565|Ga0307379_11352593 | Not Available | 578 | Open in IMG/M |
3300031578|Ga0307376_10674858 | Not Available | 650 | Open in IMG/M |
3300031758|Ga0315907_10075301 | All Organisms → Viruses → Predicted Viral | 2917 | Open in IMG/M |
3300031857|Ga0315909_10648478 | Not Available | 695 | Open in IMG/M |
3300031857|Ga0315909_10844805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
3300031963|Ga0315901_10376134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
3300031997|Ga0315278_10004615 | Not Available | 12444 | Open in IMG/M |
3300032053|Ga0315284_11638612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300032118|Ga0315277_10285541 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
3300032118|Ga0315277_11328049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300032562|Ga0316226_1072485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1695 | Open in IMG/M |
3300032579|Ga0316228_1268946 | Not Available | 534 | Open in IMG/M |
3300032605|Ga0316232_1023307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3553 | Open in IMG/M |
3300032783|Ga0335079_11845114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300034062|Ga0334995_0610900 | Not Available | 631 | Open in IMG/M |
3300034105|Ga0335035_0248341 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
3300034119|Ga0335054_0321663 | Not Available | 903 | Open in IMG/M |
3300034283|Ga0335007_0802918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.27% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.25% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.32% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 7.63% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.24% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 3.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.39% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.39% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.39% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.54% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.69% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.69% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.69% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.69% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.69% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.69% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.85% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.85% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.85% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.85% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.85% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.85% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.85% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.85% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.85% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003787 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09 | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012348 | Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44 | Environmental | Open in IMG/M |
3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017700 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020688 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 hypolimnion | Environmental | Open in IMG/M |
3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025417 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes) | Environmental | Open in IMG/M |
3300025435 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025467 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025683 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032579 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_116197661 | 3300000558 | Hydrocarbon Resource Environments | MMPSRGMGAVKSSKMPKAKTIKRKDNPDEVTMYAEGGKVESRVNEA |
JGI24218J26658_10372193 | 3300002092 | Lentic | MMACRGMGAIAPSKMPKGKRIERKDDPNTVDMYAEGGG |
MLSBCLC_100990169 | 3300002220 | Hydrocarbon Resource Environments | MRASRGMGAIAPSKMPKAKTIKRKDDPNDVTYYAKGG |
B570J29032_1089641672 | 3300002408 | Freshwater | MRPSRGMGAMNPSKMPEPKTVTRKDDPDEVEMYAKGGESKVNEAGN |
Ga0007811_10013891 | 3300003787 | Freshwater | MKASRGMGDINPSKMPKAKTIVRKDNPNDVTMYKKGGEVWDKPR |
Ga0049084_100335465 | 3300005585 | Freshwater Lentic | MMSSRGMGAMNPKKMPGKKTITRKDDPNKVKAYKEGGETKSKV |
Ga0075470_101356411 | 3300006030 | Aqueous | MASRGMGAISPSKMPKGKTIARKDDPNKVSMYAKG |
Ga0075019_1000051011 | 3300006086 | Watersheds | MMPSRGMGAVNPNKLPKRVKRKDDPNEVDMYAKGGKAKVRKKERK* |
Ga0007870_10564011 | 3300006109 | Freshwater | MRASRGMGAIAPSKMPKGKTIIRKDDPNEVTMYKKGGE |
Ga0007824_11038513 | 3300006121 | Freshwater | MMASRGMGAIRPSKMPKAKTIVRSDNPNDVEVYKSGGKVK |
Ga0070749_104801632 | 3300006802 | Aqueous | MGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKPCACAPKK* |
Ga0075467_101475803 | 3300006803 | Aqueous | MRPSRGMGDINPAKMPKGKKITRKDDPNKVSVYKRGGAVKPKARK* |
Ga0070748_11126413 | 3300006920 | Aqueous | MIASRGMGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKP* |
Ga0102977_11604524 | 3300007171 | Freshwater Lake | MMASRGMGDINPSKMPKAKTVTRKDNPNKVKVFKK |
Ga0070753_12436171 | 3300007346 | Aqueous | MGIISPSKMPKAKTIRRKDNPDDVTVYAKGGESKVNEAGNYTK |
Ga0114346_12142481 | 3300008113 | Freshwater, Plankton | MGAIAPSKMPKAKTVVRKDNPNDVTMYAKGGEVWNKP |
Ga0114351_12705544 | 3300008117 | Freshwater, Plankton | MRPSRGMGIINPSKMPKAKTITRKDDPNKVKMFAKG |
Ga0114363_10807701 | 3300008266 | Freshwater, Plankton | MRASRGMGIINPSKMPKAKTITRKDDPNKVKMFAEGGESKVNEAGN |
Ga0114363_11937551 | 3300008266 | Freshwater, Plankton | MRPSRGMGIINPSKMPKAKTIIRKDDPNKVKMYAK |
Ga0114363_12254862 | 3300008266 | Freshwater, Plankton | MRPSRGMGIINPSKMPKAKTIHRKDDPNEVTMYADGGKVS |
Ga0114878_11045204 | 3300008339 | Freshwater Lake | MRPSRGMGIINPSKMPKAKTITRKDDPNKVTMYAKG |
Ga0105093_105730943 | 3300009037 | Freshwater Sediment | MMGSRGMGAISPSKMPKGKKITRKDDPNEVEMFAEGGKVKSPAWQ |
Ga0114963_102606173 | 3300009154 | Freshwater Lake | MMSSRGMGDINPSKMPKAKTVTRKDDPNKVEMYKE |
Ga0114968_103148833 | 3300009155 | Freshwater Lake | MMSSRGMGAINPKKMPKKKEITRKDDPNKVAMYKEGGQLKEVPED |
Ga0114968_105303091 | 3300009155 | Freshwater Lake | MGCINPSKMPKAKTVRRKDNPNVVTQYKEGGLSKVNEAANYTKPSMRKS |
Ga0114977_101211671 | 3300009158 | Freshwater Lake | MRASRGMGDIAPSKMPKAKTVVRKDNPNDVTMYAE |
Ga0114977_106205283 | 3300009158 | Freshwater Lake | MGCINPSKMPKAKTVRRKDNPNEVTEYKKGGLSKVNEAGNYT |
Ga0114979_102647033 | 3300009180 | Freshwater Lake | MGAIAPSKMPKKRTIKRKDDPNEVSMYAEGGEVSRVNEAGN |
Ga0114974_103575614 | 3300009183 | Freshwater Lake | MGCINPSKMPKAKTVRRKDNPNEVTEYKKGGLSKV |
Ga0114974_104828171 | 3300009183 | Freshwater Lake | MGAIAPSKMPKAKTIKRKDNPQDVTMYAKGGEVSRVN |
Ga0114958_105306232 | 3300009684 | Freshwater Lake | MRASRGMGAIAPSKMPKKEIIHRTDNPNDVEMYAKGGSIHHGP |
Ga0129333_101424907 | 3300010354 | Freshwater To Marine Saline Gradient | MMASRGMGAIRPSKMPKAKTVTRKDDPNKVTVFKKG |
Ga0129333_109565353 | 3300010354 | Freshwater To Marine Saline Gradient | MMGSRGMGVISPSKMPKAKTIERKDDPNEVDVYKDGGKVKSRVNEAGVYTKPGLR |
Ga0129336_106878701 | 3300010370 | Freshwater To Marine Saline Gradient | MIASRGMGAIRASKMPKAKTIRRKDDPDEVTMYAKGG |
Ga0133913_108543191 | 3300010885 | Freshwater Lake | MGIMSPSKMPKAKTITRKDDPNEVSMYAKGGKVKKF |
Ga0133913_110184711 | 3300010885 | Freshwater Lake | MKPSRGMGVMSPSKMPKAKTITRKDKPGKVEMYAKG |
Ga0133913_112152866 | 3300010885 | Freshwater Lake | MMSSRGMGAISPSKMPKAKTITRKDDPNKVEVYKEGG |
Ga0157140_100128662 | 3300012348 | Freshwater | MIASRGMGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKPCACAPKK* |
Ga0129338_10222521 | 3300012970 | Aqueous | MRPSRGMGAINPSKMPKAKTITRKDDPNEVKMYAKGGESKVNE |
Ga0177922_101470603 | 3300013372 | Freshwater | MGAIAASKMPKAKTIRRKDNPGEVTMYAKGGKVKA |
Ga0134316_10172141 | 3300014960 | Surface Water | MRASRGMGAIAPSKMPKAKTITRKDDPNDVTMYAKGGWIKDAIKK |
Ga0181338_10286031 | 3300015050 | Freshwater Lake | MRSSRGMGAISSSKMPKKRTITRTDNPDEVSMYKKG |
Ga0181338_10524842 | 3300015050 | Freshwater Lake | MMSSRGMGDIAPSKMPKAKTITRKEDPNKVKAYKEGGE |
Ga0181339_10319133 | 3300017700 | Freshwater Lake | MLASRGMGNINPSKMPKGKTITRKDDPNKVKMYAKGGESKV |
Ga0181350_10448301 | 3300017716 | Freshwater Lake | MMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVN |
Ga0181362_10425062 | 3300017723 | Freshwater Lake | MRPSRGMGAIAPSKMPKKRTIKRKDDPNEVSMYAEGGEVSR |
Ga0181365_10068438 | 3300017736 | Freshwater Lake | MMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVNEAGNY |
Ga0181352_10083695 | 3300017747 | Freshwater Lake | MGAIRASKMPKAKTIRRKDNPDEVTMYAKGGKVRKGK |
Ga0181352_11202953 | 3300017747 | Freshwater Lake | MGAISPSKMPKAKTITRKDDPNKVEVYKEGGETKSKVNE |
Ga0181344_11338193 | 3300017754 | Freshwater Lake | MKASRGMGDINPSKMPKGKKIIRKDDPNSVDEYKKGGVIK |
Ga0181356_10446622 | 3300017761 | Freshwater Lake | MRPSRGMGAIAPSKMPKKRTIKRKDDPNEVAMYAEGGKA |
Ga0181356_10537721 | 3300017761 | Freshwater Lake | MMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVNE |
Ga0181356_10875694 | 3300017761 | Freshwater Lake | MRASRGMGDINPSKMPKAKTITRKDNPNKVEVFAEGGKVKS |
Ga0181356_12128471 | 3300017761 | Freshwater Lake | MRASRGMGDINPSKMPKAKTIVRKDKPNDVAMYAKGGQ |
Ga0181343_10430931 | 3300017766 | Freshwater Lake | MRPSRGMGIINPSKMPKVKTITRKDDPNEVKMYAKGGESKVNEAG |
Ga0181358_10852663 | 3300017774 | Freshwater Lake | MMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETK |
Ga0181358_12318402 | 3300017774 | Freshwater Lake | MRACRSMGAINPSKMPGAKTIRRKDNPDKVQMFAAGGKSKVNEAGNYTKPG |
Ga0181358_12496343 | 3300017774 | Freshwater Lake | MRASRGMGDINPSKMPKAKTIVRKDKPNDVAMYAKG |
Ga0181349_12457912 | 3300017778 | Freshwater Lake | MMSSRDMGAISSSNMPKAKTITRKDDPNKDEAYKE |
Ga0181346_10649315 | 3300017780 | Freshwater Lake | MMSSRGMGDIAPSKMPKAKTITRKDDPNKVKAYKEGGETK |
Ga0181346_13136702 | 3300017780 | Freshwater Lake | MRPSRGMGAINPSKMPKPTTVERKDDPDEVEMYAEGGESKVNEAGN |
Ga0181355_10465405 | 3300017785 | Freshwater Lake | MRASRGMGIINPSKMPKAKTITRKDDPNQVTMYAEGGKVSKVN |
Ga0181355_11906191 | 3300017785 | Freshwater Lake | MGAIAASKMPKAKTIRRKDNPGEVTMYAKGGKVKANLL |
Ga0181355_13167252 | 3300017785 | Freshwater Lake | MMASRGMGAISPSKMPKAKTIERKDDPNKVTMYAEGGKVNAAG |
Ga0180438_103936561 | 3300017971 | Hypersaline Lake Sediment | MMPSRGMGDIRASKMPTAKTITRKDDPNKVTMFKSG |
Ga0181359_11481411 | 3300019784 | Freshwater Lake | MRPSRGMGIINPSKMPKAKTITRKDDPNEVKMYAKGGES |
Ga0214239_1149614 | 3300020688 | Freshwater | MASRGMGAVAPSKMPKAKTIVRKDNPDDVTMYKKGGEVW |
Ga0213850_15003872 | 3300021856 | Watersheds | MMPSRGMGAVNPNKLPKRVKRKDDPNEVDMYAKGGKAKVRKKERK |
Ga0222713_102248451 | 3300021962 | Estuarine Water | MMASRGMGAISPSKMPKAKTIERKDDPNKVTMYAEGGKVN |
Ga0222713_103244401 | 3300021962 | Estuarine Water | MMASRGMGDINPSKMPKAKTITRKDDPNKVEMYKD |
Ga0212023_10471002 | 3300022061 | Aqueous | MGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKPCACAPKK |
Ga0181353_10843252 | 3300022179 | Freshwater Lake | MRPSRGMGAIRASKMPKAKTIRRKDNPDEVTMYAKGGKVRKGK |
Ga0181353_10887941 | 3300022179 | Freshwater Lake | MRPSRGMGIINPSKMPKAKTITRKDDPNEVKMYAKG |
Ga0181353_11655651 | 3300022179 | Freshwater Lake | MGAIAPSKMPKKRTIKRKDDPNEVSMYAEGGEVSRVNE |
Ga0196901_10041522 | 3300022200 | Aqueous | MGAVAPSKMPKKKTIIRKDDPNKVEYFKKGGKVNLPALAQRK |
Ga0181351_10161386 | 3300022407 | Freshwater Lake | MRPSRGMGAIAPSKMPKKRTIKRKDDPNEVAMYAEGGKAKSKVNE |
Ga0181351_10817251 | 3300022407 | Freshwater Lake | MMSSRGMGDIAPSKMPKAKTITRKDDPNKVKAYKEGGETKS |
Ga0181351_11764723 | 3300022407 | Freshwater Lake | MGIMSPSKMSKAKTITRKDNPDKVKMYAKGGESKVNEAGNYTKP |
Ga0228703_10563851 | 3300022747 | Freshwater | MMASRGMGAISPNKMPKGKTIIRKDDPNKVEMYAKGGMA |
Ga0208383_10324671 | 3300025357 | Freshwater | MMASRGMGAVNPSKMPKAKTVVRKDNPDDVTMYKKGG |
Ga0208616_10051308 | 3300025417 | Freshwater | MRASRGMGDIKPSKMPTRPKTIIRKDDPNKVYEYKKGGKTG |
Ga0208618_10449201 | 3300025435 | Freshwater | MKASRGMGDINPSKMPKAKTIVRKDNPNDVTMYKKGG |
Ga0208260_10890774 | 3300025467 | Freshwater | MRASRGMGDINPSKMPKAKTIVRKDNPDDVTMYKKGG |
Ga0208546_10804641 | 3300025585 | Aqueous | MMASRGMGAISPSKMPKGKTIARKDDPNKVSMYAKG |
Ga0208643_10331213 | 3300025645 | Aqueous | MRPSRGMGDINPAKMPKGKKITRKDDPNKVSVYKRGGAVKPKARK |
Ga0208564_10784114 | 3300025683 | Anaerobic Digestor Sludge | MRASRGMGSINPSKMPKAKTIRRKDNPDDVKVFAKGGPTIPKKKRP |
Ga0208104_10106381 | 3300025773 | Freshwater | MRASRGMGDINPSKMPKAKTIVRKDNPDDVTMYKK |
Ga0208544_100833983 | 3300025887 | Aqueous | MGDINPAKMPKGKKITRKDDPNKVSVYKRGGAVKPKARK |
Ga0208788_10468005 | 3300027499 | Deep Subsurface | MGIISPSKMPKAKTITRKDDPNKVTMYKDGGSVSRVNEAGNY |
Ga0208788_11248551 | 3300027499 | Deep Subsurface | MRPSRGMGIISPSKMPKAKTITRKDDPNKVTMYKDGGSVSR |
Ga0208975_10172671 | 3300027659 | Freshwater Lentic | MRPSRGMGIINPSKMPNAKTIKRKDDPNEITMYDEGGRV |
Ga0209188_10233455 | 3300027708 | Freshwater Lake | MGDIRPSKMPKAKTVVRKDNPNDVEVYKAGGGLYDNIN |
Ga0209442_11227771 | 3300027732 | Freshwater Lake | MMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEG |
Ga0209297_12995811 | 3300027733 | Freshwater Lake | MRASRGMGCINPSKMPKAKTVRRKDNPNEVTEYKKGGLSKVNEAGNYT |
Ga0209087_12509153 | 3300027734 | Freshwater Lake | MMASRGMGAINPSKMPKKREITRKDDPNTVDMYAAGGHVNAAGN |
Ga0209189_11706283 | 3300027747 | Freshwater Lake | MRPSRGMGCIKPSKMPKAKTIQRKDNPNEVTQYKKGGLYENI |
Ga0209088_101835343 | 3300027763 | Freshwater Lake | MRPSRGMGAIAPSKMPKKHTIKRKDDPNEVSMYAEGGEVSRVN |
Ga0209777_100590999 | 3300027896 | Freshwater Lake Sediment | MRASRGMGAVAPSKMPKAKTIVRKDDPNDVTMIKKG |
Ga0209777_101232586 | 3300027896 | Freshwater Lake Sediment | MRASRGMGAIAPSKMPKGKTIIRKDDPNEVTMKKKAE |
Ga0304728_10998594 | 3300028393 | Freshwater Lake | MMPSRGMGAIAPSKMPKKREITRKDDPNTVDMYAAGGHVNAAGN |
Ga0307379_113525931 | 3300031565 | Soil | MMPSRGMGDINSSKMPKAKTITRKDDPNKVKVFKAGGK |
Ga0307376_106748581 | 3300031578 | Soil | MGDINSSKMPKARTITRKDDPNKVKVFKAGGKSRVNEAGNYTKPSMRKAI |
Ga0315907_1007530110 | 3300031758 | Freshwater | MRPSRGMGAMNPSKMPKAKTIKRKDKPQDVEMFAEGGESRVNEAG |
Ga0315909_106484783 | 3300031857 | Freshwater | MRASRGMGIINPSKMSKTITRKDDPNKVKMYAKGGESKVNEAGNYTKP |
Ga0315909_108448053 | 3300031857 | Freshwater | MRPSRGMGIINPSKMPKVKTIKRKDDPNEVKMYAKGGESKVNEAG |
Ga0315901_103761341 | 3300031963 | Freshwater | MMPSRGMGAIRPSKMPKAKTITRKDDPNKVTMYAEGGKVSKVNEAGNY |
Ga0315278_1000461518 | 3300031997 | Sediment | LIASRGMGAISKSKMPKAKKIVRKDHPQDVTMYEQGGNV |
Ga0315284_116386123 | 3300032053 | Sediment | MMSSRGMGAISPSKMPKAKTITRKDDPNKVKAYKEGGETKSKV |
Ga0315277_102855411 | 3300032118 | Sediment | MRSSRGMGAISSSKMPKKRTITRTDNPDEVSMYKKGGSVK |
Ga0315277_113280491 | 3300032118 | Sediment | MRASRGMGDINPSKMPKGKKIIRKDDPNAVEMYKKG |
Ga0316226_10724851 | 3300032562 | Freshwater | MRASRGMGAIAPSKMPKAKTIVRKDDPNDVTMIKKGGKVGL |
Ga0316228_12689461 | 3300032579 | Freshwater | MRASRGMGAMNPSKMPSKPRVITRKDDPNKVYEYAKGGE |
Ga0316232_10233071 | 3300032605 | Freshwater | MRASRGMGAISPSKMPKAKTIVRKDNPDDITMYKKGGP |
Ga0335079_118451141 | 3300032783 | Soil | MMPSRGMGAISPSKMPKKKIIERKDDPNQVEMYADGGNVWS |
Ga0334995_0610900_505_630 | 3300034062 | Freshwater | MRPSRGMGAINPSKMPKAKTITRKDNPNEVEMFAKGGESKVN |
Ga0335035_0248341_961_1071 | 3300034105 | Freshwater | MRPSRGMGAMNPSKMPEPKTVTRKDDPDEVEMYAKGG |
Ga0335054_0321663_789_902 | 3300034119 | Freshwater | MRPSRGMGAMNPSKMPEPKTVTRKDDPDEVEMYAKGGE |
Ga0335007_0802918_373_510 | 3300034283 | Freshwater | MRASRGMGCISPSKMPKGKTIHRTDNPDNVEMYADGGQVKPGLYAN |
⦗Top⦘ |