NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075859

Metagenome / Metatranscriptome Family F075859

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075859
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 40 residues
Representative Sequence MRPSRGMGIINPSKMPKAKTITRKDDPNEVKMYAKGGES
Number of Associated Samples 91
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 80.34 %
% of genes near scaffold ends (potentially truncated) 87.29 %
% of genes from short scaffolds (< 2000 bps) 83.05 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.23

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (52.542 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(26.271 % of family members)
Environment Ontology (ENVO) Unclassified
(59.322 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(65.254 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.96%    β-sheet: 0.00%    Coil/Unstructured: 91.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.23
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF13884Peptidase_S74 1.69
PF13414TPR_11 0.85
PF10765Phage_P22_NinX 0.85
PF00166Cpn10 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.80 %
UnclassifiedrootN/A32.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000558|Draft_11619766Not Available533Open in IMG/M
3300002092|JGI24218J26658_1037219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage571Open in IMG/M
3300002220|MLSBCLC_10099016Not Available4976Open in IMG/M
3300002408|B570J29032_108964167Not Available552Open in IMG/M
3300003787|Ga0007811_1001389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3487Open in IMG/M
3300005585|Ga0049084_10033546Not Available1987Open in IMG/M
3300006030|Ga0075470_10135641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300006086|Ga0075019_10000510Not Available22339Open in IMG/M
3300006109|Ga0007870_1056401All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300006121|Ga0007824_1103851Not Available534Open in IMG/M
3300006802|Ga0070749_10480163All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300006803|Ga0075467_10147580All Organisms → Viruses → Predicted Viral1353Open in IMG/M
3300006920|Ga0070748_1112641All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1031Open in IMG/M
3300007171|Ga0102977_1160452Not Available1084Open in IMG/M
3300007346|Ga0070753_1243617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage654Open in IMG/M
3300008113|Ga0114346_1214248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage754Open in IMG/M
3300008117|Ga0114351_1270554All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage827Open in IMG/M
3300008266|Ga0114363_1080770All Organisms → Viruses → Predicted Viral1213Open in IMG/M
3300008266|Ga0114363_1193755Not Available631Open in IMG/M
3300008266|Ga0114363_1225486All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage551Open in IMG/M
3300008339|Ga0114878_1104520All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1087Open in IMG/M
3300009037|Ga0105093_10573094All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage636Open in IMG/M
3300009154|Ga0114963_10260617Not Available979Open in IMG/M
3300009155|Ga0114968_10314883Not Available871Open in IMG/M
3300009155|Ga0114968_10530309Not Available629Open in IMG/M
3300009158|Ga0114977_10121167All Organisms → Viruses → Predicted Viral1576Open in IMG/M
3300009158|Ga0114977_10620528Not Available581Open in IMG/M
3300009180|Ga0114979_10264703Not Available1028Open in IMG/M
3300009183|Ga0114974_10357561Not Available845Open in IMG/M
3300009183|Ga0114974_10482817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300009684|Ga0114958_10530623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage564Open in IMG/M
3300010354|Ga0129333_10142490All Organisms → Viruses → Predicted Viral2202Open in IMG/M
3300010370|Ga0129336_10687870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300010885|Ga0133913_10854319All Organisms → Viruses → Predicted Viral2367Open in IMG/M
3300010885|Ga0133913_11018471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2140Open in IMG/M
3300010885|Ga0133913_11215286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1932Open in IMG/M
3300012348|Ga0157140_10012866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage868Open in IMG/M
3300012970|Ga0129338_1022252All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage527Open in IMG/M
3300013372|Ga0177922_10147060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
3300014960|Ga0134316_1017214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300015050|Ga0181338_1028603Not Available853Open in IMG/M
3300015050|Ga0181338_1052484All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300017700|Ga0181339_1031913All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage577Open in IMG/M
3300017716|Ga0181350_1044830All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1188Open in IMG/M
3300017723|Ga0181362_1042506All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M
3300017736|Ga0181365_1006843All Organisms → Viruses → Predicted Viral2823Open in IMG/M
3300017747|Ga0181352_1008369All Organisms → Viruses → Predicted Viral3396Open in IMG/M
3300017747|Ga0181352_1120295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage708Open in IMG/M
3300017754|Ga0181344_1133819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage711Open in IMG/M
3300017761|Ga0181356_1044662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1545Open in IMG/M
3300017761|Ga0181356_1053772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1382Open in IMG/M
3300017761|Ga0181356_1087569All Organisms → Viruses → Predicted Viral1026Open in IMG/M
3300017761|Ga0181356_1212847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300017766|Ga0181343_1043093All Organisms → Viruses → Predicted Viral1341Open in IMG/M
3300017774|Ga0181358_1085266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1149Open in IMG/M
3300017774|Ga0181358_1231840Not Available589Open in IMG/M
3300017774|Ga0181358_1249634All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300017778|Ga0181349_1245791Not Available599Open in IMG/M
3300017780|Ga0181346_1064931Not Available1458Open in IMG/M
3300017780|Ga0181346_1313670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage529Open in IMG/M
3300017785|Ga0181355_1046540Not Available1850Open in IMG/M
3300017785|Ga0181355_1190619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage810Open in IMG/M
3300017785|Ga0181355_1316725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300017971|Ga0180438_10393656Not Available1050Open in IMG/M
3300019784|Ga0181359_1148141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300020688|Ga0214239_114961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage738Open in IMG/M
3300021856|Ga0213850_1500387All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2417Open in IMG/M
3300021962|Ga0222713_10224845All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1239Open in IMG/M
3300021962|Ga0222713_10324440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage972Open in IMG/M
3300022061|Ga0212023_1047100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300022179|Ga0181353_1084325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300022179|Ga0181353_1088794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage772Open in IMG/M
3300022179|Ga0181353_1165565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage501Open in IMG/M
3300022200|Ga0196901_1004152Not Available6595Open in IMG/M
3300022407|Ga0181351_1016138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3120Open in IMG/M
3300022407|Ga0181351_1081725Not Available1286Open in IMG/M
3300022407|Ga0181351_1176472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage740Open in IMG/M
3300022747|Ga0228703_1056385All Organisms → Viruses → Predicted Viral1035Open in IMG/M
3300025357|Ga0208383_1032467Not Available598Open in IMG/M
3300025417|Ga0208616_1005130All Organisms → Viruses2310Open in IMG/M
3300025435|Ga0208618_1044920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage750Open in IMG/M
3300025467|Ga0208260_1089077All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300025585|Ga0208546_1080464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300025645|Ga0208643_1033121All Organisms → Viruses → Predicted Viral1695Open in IMG/M
3300025683|Ga0208564_1078411Not Available1137Open in IMG/M
3300025773|Ga0208104_1010638Not Available1235Open in IMG/M
3300025887|Ga0208544_10083398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1470Open in IMG/M
3300027499|Ga0208788_1046800All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300027499|Ga0208788_1124855All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage586Open in IMG/M
3300027659|Ga0208975_1017267Not Available2403Open in IMG/M
3300027708|Ga0209188_1023345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3105Open in IMG/M
3300027732|Ga0209442_1122777All Organisms → Viruses → Predicted Viral1025Open in IMG/M
3300027733|Ga0209297_1299581Not Available600Open in IMG/M
3300027734|Ga0209087_1250915Not Available653Open in IMG/M
3300027747|Ga0209189_1170628All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage917Open in IMG/M
3300027763|Ga0209088_10183534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage904Open in IMG/M
3300027896|Ga0209777_10059099All Organisms → Viruses → Predicted Viral3421Open in IMG/M
3300027896|Ga0209777_10123258Not Available2173Open in IMG/M
3300028393|Ga0304728_1099859Not Available1112Open in IMG/M
3300031565|Ga0307379_11352593Not Available578Open in IMG/M
3300031578|Ga0307376_10674858Not Available650Open in IMG/M
3300031758|Ga0315907_10075301All Organisms → Viruses → Predicted Viral2917Open in IMG/M
3300031857|Ga0315909_10648478Not Available695Open in IMG/M
3300031857|Ga0315909_10844805All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300031963|Ga0315901_10376134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1147Open in IMG/M
3300031997|Ga0315278_10004615Not Available12444Open in IMG/M
3300032053|Ga0315284_11638612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage674Open in IMG/M
3300032118|Ga0315277_10285541All Organisms → Viruses → Predicted Viral1745Open in IMG/M
3300032118|Ga0315277_11328049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300032562|Ga0316226_1072485All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1695Open in IMG/M
3300032579|Ga0316228_1268946Not Available534Open in IMG/M
3300032605|Ga0316232_1023307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3553Open in IMG/M
3300032783|Ga0335079_11845114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage587Open in IMG/M
3300034062|Ga0334995_0610900Not Available631Open in IMG/M
3300034105|Ga0335035_0248341All Organisms → Viruses → Predicted Viral1072Open in IMG/M
3300034119|Ga0335054_0321663Not Available903Open in IMG/M
3300034283|Ga0335007_0802918All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake26.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake15.25%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous9.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater7.63%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton4.24%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater3.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.39%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.39%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.39%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.54%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.69%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.69%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.69%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.69%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.69%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments1.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.85%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.85%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic0.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.85%
Surface WaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.85%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000558Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002220Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011EngineeredOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300003787Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE21Jul09EnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006109Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08EnvironmentalOpen in IMG/M
3300006121Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300009037Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009154Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009684Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012348Freshwater microbial communities from Coldwater Creek, Ontario, Canada - S44EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014960Surface water microbial communities from Bangladesh - BaraHaldiaSW0709EnvironmentalOpen in IMG/M
3300015050Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017700Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.D.DEnvironmentalOpen in IMG/M
3300017716Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.DEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017971Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaGEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020688Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 hypolimnionEnvironmentalOpen in IMG/M
3300021856Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022747Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MGEnvironmentalOpen in IMG/M
3300025357Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes)EnvironmentalOpen in IMG/M
3300025417Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 (SPAdes)EnvironmentalOpen in IMG/M
3300025435Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025467Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025683Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025773Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027499Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027732Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027747Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027763Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032579Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18021EnvironmentalOpen in IMG/M
3300032605Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Draft_1161976613300000558Hydrocarbon Resource EnvironmentsMMPSRGMGAVKSSKMPKAKTIKRKDNPDEVTMYAEGGKVESRVNEA
JGI24218J26658_103721933300002092LenticMMACRGMGAIAPSKMPKGKRIERKDDPNTVDMYAEGGG
MLSBCLC_1009901693300002220Hydrocarbon Resource EnvironmentsMRASRGMGAIAPSKMPKAKTIKRKDDPNDVTYYAKGG
B570J29032_10896416723300002408FreshwaterMRPSRGMGAMNPSKMPEPKTVTRKDDPDEVEMYAKGGESKVNEAGN
Ga0007811_100138913300003787FreshwaterMKASRGMGDINPSKMPKAKTIVRKDNPNDVTMYKKGGEVWDKPR
Ga0049084_1003354653300005585Freshwater LenticMMSSRGMGAMNPKKMPGKKTITRKDDPNKVKAYKEGGETKSKV
Ga0075470_1013564113300006030AqueousMASRGMGAISPSKMPKGKTIARKDDPNKVSMYAKG
Ga0075019_10000510113300006086WatershedsMMPSRGMGAVNPNKLPKRVKRKDDPNEVDMYAKGGKAKVRKKERK*
Ga0007870_105640113300006109FreshwaterMRASRGMGAIAPSKMPKGKTIIRKDDPNEVTMYKKGGE
Ga0007824_110385133300006121FreshwaterMMASRGMGAIRPSKMPKAKTIVRSDNPNDVEVYKSGGKVK
Ga0070749_1048016323300006802AqueousMGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKPCACAPKK*
Ga0075467_1014758033300006803AqueousMRPSRGMGDINPAKMPKGKKITRKDDPNKVSVYKRGGAVKPKARK*
Ga0070748_111264133300006920AqueousMIASRGMGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKP*
Ga0102977_116045243300007171Freshwater LakeMMASRGMGDINPSKMPKAKTVTRKDNPNKVKVFKK
Ga0070753_124361713300007346AqueousMGIISPSKMPKAKTIRRKDNPDDVTVYAKGGESKVNEAGNYTK
Ga0114346_121424813300008113Freshwater, PlanktonMGAIAPSKMPKAKTVVRKDNPNDVTMYAKGGEVWNKP
Ga0114351_127055443300008117Freshwater, PlanktonMRPSRGMGIINPSKMPKAKTITRKDDPNKVKMFAKG
Ga0114363_108077013300008266Freshwater, PlanktonMRASRGMGIINPSKMPKAKTITRKDDPNKVKMFAEGGESKVNEAGN
Ga0114363_119375513300008266Freshwater, PlanktonMRPSRGMGIINPSKMPKAKTIIRKDDPNKVKMYAK
Ga0114363_122548623300008266Freshwater, PlanktonMRPSRGMGIINPSKMPKAKTIHRKDDPNEVTMYADGGKVS
Ga0114878_110452043300008339Freshwater LakeMRPSRGMGIINPSKMPKAKTITRKDDPNKVTMYAKG
Ga0105093_1057309433300009037Freshwater SedimentMMGSRGMGAISPSKMPKGKKITRKDDPNEVEMFAEGGKVKSPAWQ
Ga0114963_1026061733300009154Freshwater LakeMMSSRGMGDINPSKMPKAKTVTRKDDPNKVEMYKE
Ga0114968_1031488333300009155Freshwater LakeMMSSRGMGAINPKKMPKKKEITRKDDPNKVAMYKEGGQLKEVPED
Ga0114968_1053030913300009155Freshwater LakeMGCINPSKMPKAKTVRRKDNPNVVTQYKEGGLSKVNEAANYTKPSMRKS
Ga0114977_1012116713300009158Freshwater LakeMRASRGMGDIAPSKMPKAKTVVRKDNPNDVTMYAE
Ga0114977_1062052833300009158Freshwater LakeMGCINPSKMPKAKTVRRKDNPNEVTEYKKGGLSKVNEAGNYT
Ga0114979_1026470333300009180Freshwater LakeMGAIAPSKMPKKRTIKRKDDPNEVSMYAEGGEVSRVNEAGN
Ga0114974_1035756143300009183Freshwater LakeMGCINPSKMPKAKTVRRKDNPNEVTEYKKGGLSKV
Ga0114974_1048281713300009183Freshwater LakeMGAIAPSKMPKAKTIKRKDNPQDVTMYAKGGEVSRVN
Ga0114958_1053062323300009684Freshwater LakeMRASRGMGAIAPSKMPKKEIIHRTDNPNDVEMYAKGGSIHHGP
Ga0129333_1014249073300010354Freshwater To Marine Saline GradientMMASRGMGAIRPSKMPKAKTVTRKDDPNKVTVFKKG
Ga0129333_1095653533300010354Freshwater To Marine Saline GradientMMGSRGMGVISPSKMPKAKTIERKDDPNEVDVYKDGGKVKSRVNEAGVYTKPGLR
Ga0129336_1068787013300010370Freshwater To Marine Saline GradientMIASRGMGAIRASKMPKAKTIRRKDDPDEVTMYAKGG
Ga0133913_1085431913300010885Freshwater LakeMGIMSPSKMPKAKTITRKDDPNEVSMYAKGGKVKKF
Ga0133913_1101847113300010885Freshwater LakeMKPSRGMGVMSPSKMPKAKTITRKDKPGKVEMYAKG
Ga0133913_1121528663300010885Freshwater LakeMMSSRGMGAISPSKMPKAKTITRKDDPNKVEVYKEGG
Ga0157140_1001286623300012348FreshwaterMIASRGMGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKPCACAPKK*
Ga0129338_102225213300012970AqueousMRPSRGMGAINPSKMPKAKTITRKDDPNEVKMYAKGGESKVNE
Ga0177922_1014706033300013372FreshwaterMGAIAASKMPKAKTIRRKDNPGEVTMYAKGGKVKA
Ga0134316_101721413300014960Surface WaterMRASRGMGAIAPSKMPKAKTITRKDDPNDVTMYAKGGWIKDAIKK
Ga0181338_102860313300015050Freshwater LakeMRSSRGMGAISSSKMPKKRTITRTDNPDEVSMYKKG
Ga0181338_105248423300015050Freshwater LakeMMSSRGMGDIAPSKMPKAKTITRKEDPNKVKAYKEGGE
Ga0181339_103191333300017700Freshwater LakeMLASRGMGNINPSKMPKGKTITRKDDPNKVKMYAKGGESKV
Ga0181350_104483013300017716Freshwater LakeMMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVN
Ga0181362_104250623300017723Freshwater LakeMRPSRGMGAIAPSKMPKKRTIKRKDDPNEVSMYAEGGEVSR
Ga0181365_100684383300017736Freshwater LakeMMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVNEAGNY
Ga0181352_100836953300017747Freshwater LakeMGAIRASKMPKAKTIRRKDNPDEVTMYAKGGKVRKGK
Ga0181352_112029533300017747Freshwater LakeMGAISPSKMPKAKTITRKDDPNKVEVYKEGGETKSKVNE
Ga0181344_113381933300017754Freshwater LakeMKASRGMGDINPSKMPKGKKIIRKDDPNSVDEYKKGGVIK
Ga0181356_104466223300017761Freshwater LakeMRPSRGMGAIAPSKMPKKRTIKRKDDPNEVAMYAEGGKA
Ga0181356_105377213300017761Freshwater LakeMMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETKSKVNE
Ga0181356_108756943300017761Freshwater LakeMRASRGMGDINPSKMPKAKTITRKDNPNKVEVFAEGGKVKS
Ga0181356_121284713300017761Freshwater LakeMRASRGMGDINPSKMPKAKTIVRKDKPNDVAMYAKGGQ
Ga0181343_104309313300017766Freshwater LakeMRPSRGMGIINPSKMPKVKTITRKDDPNEVKMYAKGGESKVNEAG
Ga0181358_108526633300017774Freshwater LakeMMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEGGETK
Ga0181358_123184023300017774Freshwater LakeMRACRSMGAINPSKMPGAKTIRRKDNPDKVQMFAAGGKSKVNEAGNYTKPG
Ga0181358_124963433300017774Freshwater LakeMRASRGMGDINPSKMPKAKTIVRKDKPNDVAMYAKG
Ga0181349_124579123300017778Freshwater LakeMMSSRDMGAISSSNMPKAKTITRKDDPNKDEAYKE
Ga0181346_106493153300017780Freshwater LakeMMSSRGMGDIAPSKMPKAKTITRKDDPNKVKAYKEGGETK
Ga0181346_131367023300017780Freshwater LakeMRPSRGMGAINPSKMPKPTTVERKDDPDEVEMYAEGGESKVNEAGN
Ga0181355_104654053300017785Freshwater LakeMRASRGMGIINPSKMPKAKTITRKDDPNQVTMYAEGGKVSKVN
Ga0181355_119061913300017785Freshwater LakeMGAIAASKMPKAKTIRRKDNPGEVTMYAKGGKVKANLL
Ga0181355_131672523300017785Freshwater LakeMMASRGMGAISPSKMPKAKTIERKDDPNKVTMYAEGGKVNAAG
Ga0180438_1039365613300017971Hypersaline Lake SedimentMMPSRGMGDIRASKMPTAKTITRKDDPNKVTMFKSG
Ga0181359_114814113300019784Freshwater LakeMRPSRGMGIINPSKMPKAKTITRKDDPNEVKMYAKGGES
Ga0214239_11496143300020688FreshwaterMASRGMGAVAPSKMPKAKTIVRKDNPDDVTMYKKGGEVW
Ga0213850_150038723300021856WatershedsMMPSRGMGAVNPNKLPKRVKRKDDPNEVDMYAKGGKAKVRKKERK
Ga0222713_1022484513300021962Estuarine WaterMMASRGMGAISPSKMPKAKTIERKDDPNKVTMYAEGGKVN
Ga0222713_1032444013300021962Estuarine WaterMMASRGMGDINPSKMPKAKTITRKDDPNKVEMYKD
Ga0212023_104710023300022061AqueousMGAIAPSKMPKAKTITRKDDPNKVTVYKRGGAVKPCACAPKK
Ga0181353_108432523300022179Freshwater LakeMRPSRGMGAIRASKMPKAKTIRRKDNPDEVTMYAKGGKVRKGK
Ga0181353_108879413300022179Freshwater LakeMRPSRGMGIINPSKMPKAKTITRKDDPNEVKMYAKG
Ga0181353_116556513300022179Freshwater LakeMGAIAPSKMPKKRTIKRKDDPNEVSMYAEGGEVSRVNE
Ga0196901_100415223300022200AqueousMGAVAPSKMPKKKTIIRKDDPNKVEYFKKGGKVNLPALAQRK
Ga0181351_101613863300022407Freshwater LakeMRPSRGMGAIAPSKMPKKRTIKRKDDPNEVAMYAEGGKAKSKVNE
Ga0181351_108172513300022407Freshwater LakeMMSSRGMGDIAPSKMPKAKTITRKDDPNKVKAYKEGGETKS
Ga0181351_117647233300022407Freshwater LakeMGIMSPSKMSKAKTITRKDNPDKVKMYAKGGESKVNEAGNYTKP
Ga0228703_105638513300022747FreshwaterMMASRGMGAISPNKMPKGKTIIRKDDPNKVEMYAKGGMA
Ga0208383_103246713300025357FreshwaterMMASRGMGAVNPSKMPKAKTVVRKDNPDDVTMYKKGG
Ga0208616_100513083300025417FreshwaterMRASRGMGDIKPSKMPTRPKTIIRKDDPNKVYEYKKGGKTG
Ga0208618_104492013300025435FreshwaterMKASRGMGDINPSKMPKAKTIVRKDNPNDVTMYKKGG
Ga0208260_108907743300025467FreshwaterMRASRGMGDINPSKMPKAKTIVRKDNPDDVTMYKKGG
Ga0208546_108046413300025585AqueousMMASRGMGAISPSKMPKGKTIARKDDPNKVSMYAKG
Ga0208643_103312133300025645AqueousMRPSRGMGDINPAKMPKGKKITRKDDPNKVSVYKRGGAVKPKARK
Ga0208564_107841143300025683Anaerobic Digestor SludgeMRASRGMGSINPSKMPKAKTIRRKDNPDDVKVFAKGGPTIPKKKRP
Ga0208104_101063813300025773FreshwaterMRASRGMGDINPSKMPKAKTIVRKDNPDDVTMYKK
Ga0208544_1008339833300025887AqueousMGDINPAKMPKGKKITRKDDPNKVSVYKRGGAVKPKARK
Ga0208788_104680053300027499Deep SubsurfaceMGIISPSKMPKAKTITRKDDPNKVTMYKDGGSVSRVNEAGNY
Ga0208788_112485513300027499Deep SubsurfaceMRPSRGMGIISPSKMPKAKTITRKDDPNKVTMYKDGGSVSR
Ga0208975_101726713300027659Freshwater LenticMRPSRGMGIINPSKMPNAKTIKRKDDPNEITMYDEGGRV
Ga0209188_102334553300027708Freshwater LakeMGDIRPSKMPKAKTVVRKDNPNDVEVYKAGGGLYDNIN
Ga0209442_112277713300027732Freshwater LakeMMSSRGMGAISPSKMPKDKTITRKDDPNKVKVYKEG
Ga0209297_129958113300027733Freshwater LakeMRASRGMGCINPSKMPKAKTVRRKDNPNEVTEYKKGGLSKVNEAGNYT
Ga0209087_125091533300027734Freshwater LakeMMASRGMGAINPSKMPKKREITRKDDPNTVDMYAAGGHVNAAGN
Ga0209189_117062833300027747Freshwater LakeMRPSRGMGCIKPSKMPKAKTIQRKDNPNEVTQYKKGGLYENI
Ga0209088_1018353433300027763Freshwater LakeMRPSRGMGAIAPSKMPKKHTIKRKDDPNEVSMYAEGGEVSRVN
Ga0209777_1005909993300027896Freshwater Lake SedimentMRASRGMGAVAPSKMPKAKTIVRKDDPNDVTMIKKG
Ga0209777_1012325863300027896Freshwater Lake SedimentMRASRGMGAIAPSKMPKGKTIIRKDDPNEVTMKKKAE
Ga0304728_109985943300028393Freshwater LakeMMPSRGMGAIAPSKMPKKREITRKDDPNTVDMYAAGGHVNAAGN
Ga0307379_1135259313300031565SoilMMPSRGMGDINSSKMPKAKTITRKDDPNKVKVFKAGGK
Ga0307376_1067485813300031578SoilMGDINSSKMPKARTITRKDDPNKVKVFKAGGKSRVNEAGNYTKPSMRKAI
Ga0315907_10075301103300031758FreshwaterMRPSRGMGAMNPSKMPKAKTIKRKDKPQDVEMFAEGGESRVNEAG
Ga0315909_1064847833300031857FreshwaterMRASRGMGIINPSKMSKTITRKDDPNKVKMYAKGGESKVNEAGNYTKP
Ga0315909_1084480533300031857FreshwaterMRPSRGMGIINPSKMPKVKTIKRKDDPNEVKMYAKGGESKVNEAG
Ga0315901_1037613413300031963FreshwaterMMPSRGMGAIRPSKMPKAKTITRKDDPNKVTMYAEGGKVSKVNEAGNY
Ga0315278_10004615183300031997SedimentLIASRGMGAISKSKMPKAKKIVRKDHPQDVTMYEQGGNV
Ga0315284_1163861233300032053SedimentMMSSRGMGAISPSKMPKAKTITRKDDPNKVKAYKEGGETKSKV
Ga0315277_1028554113300032118SedimentMRSSRGMGAISSSKMPKKRTITRTDNPDEVSMYKKGGSVK
Ga0315277_1132804913300032118SedimentMRASRGMGDINPSKMPKGKKIIRKDDPNAVEMYKKG
Ga0316226_107248513300032562FreshwaterMRASRGMGAIAPSKMPKAKTIVRKDDPNDVTMIKKGGKVGL
Ga0316228_126894613300032579FreshwaterMRASRGMGAMNPSKMPSKPRVITRKDDPNKVYEYAKGGE
Ga0316232_102330713300032605FreshwaterMRASRGMGAISPSKMPKAKTIVRKDNPDDITMYKKGGP
Ga0335079_1184511413300032783SoilMMPSRGMGAISPSKMPKKKIIERKDDPNQVEMYADGGNVWS
Ga0334995_0610900_505_6303300034062FreshwaterMRPSRGMGAINPSKMPKAKTITRKDNPNEVEMFAKGGESKVN
Ga0335035_0248341_961_10713300034105FreshwaterMRPSRGMGAMNPSKMPEPKTVTRKDDPDEVEMYAKGG
Ga0335054_0321663_789_9023300034119FreshwaterMRPSRGMGAMNPSKMPEPKTVTRKDDPDEVEMYAKGGE
Ga0335007_0802918_373_5103300034283FreshwaterMRASRGMGCISPSKMPKGKTIHRTDNPDNVEMYADGGQVKPGLYAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.