NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075786

Metagenome / Metatranscriptome Family F075786

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075786
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 62 residues
Representative Sequence EVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEVA
Number of Associated Samples 93
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 41.23 %
% of genes near scaffold ends (potentially truncated) 61.02 %
% of genes from short scaffolds (< 2000 bps) 80.51 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.441 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(23.729 % of family members)
Environment Ontology (ENVO) Unclassified
(58.475 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(45.763 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.87%    β-sheet: 19.57%    Coil/Unstructured: 44.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF01909NTP_transf_2 17.09
PF05565Sipho_Gp157 10.26
PF04255DUF433 7.69
PF05168HEPN 5.98
PF04014MazE_antitoxin 4.27
PF07927HicA_toxin 4.27
PF04365BrnT_toxin 2.56
PF15919HicB_lk_antitox 1.71
PF05015HigB-like_toxin 1.71
PF02899Phage_int_SAM_1 0.85
PF07804HipA_C 0.85
PF13683rve_3 0.85
PF13469Sulfotransfer_3 0.85
PF13358DDE_3 0.85
PF02452PemK_toxin 0.85
PF03631Virul_fac_BrkB 0.85
PF01381HTH_3 0.85
PF01850PIN 0.85
PF13744HTH_37 0.85
PF06296RelE 0.85
PF01402RHH_1 0.85
PF05598DUF772 0.85
PF05016ParE_toxin 0.85
PF13470PIN_3 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 7.69
COG1895HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 5.98
COG2250HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 5.98
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 4.27
COG2929Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin systemDefense mechanisms [V] 2.56
COG3549Plasmid maintenance system killer proteinDefense mechanisms [V] 1.71
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.85
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.85
COG3550Serine/threonine protein kinase HipA, toxin component of the HipAB toxin-antitoxin moduleSignal transduction mechanisms [T] 0.85
COG4737Uncharacterized conserved proteinFunction unknown [S] 0.85
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.85
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.44 %
UnclassifiedrootN/A13.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004470|Ga0068967_1229205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4819Open in IMG/M
3300005340|Ga0070689_101545867Not Available602Open in IMG/M
3300005456|Ga0070678_100576108All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41002Open in IMG/M
3300005938|Ga0066795_10025038All Organisms → cellular organisms → Bacteria1715Open in IMG/M
3300005993|Ga0080027_10018824All Organisms → cellular organisms → Bacteria2453Open in IMG/M
3300005993|Ga0080027_10061400All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300006864|Ga0066797_1028415All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41962Open in IMG/M
3300006949|Ga0075528_10010309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42233Open in IMG/M
3300009029|Ga0066793_10141607Not Available1403Open in IMG/M
3300009029|Ga0066793_10247723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41033Open in IMG/M
3300009029|Ga0066793_10365189All Organisms → cellular organisms → Bacteria → Proteobacteria831Open in IMG/M
3300009098|Ga0105245_10722127All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41031Open in IMG/M
3300009176|Ga0105242_10735697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076969Open in IMG/M
3300009177|Ga0105248_10116884All Organisms → cellular organisms → Bacteria3008Open in IMG/M
3300009519|Ga0116108_1121725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4782Open in IMG/M
3300009547|Ga0116136_1032545All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300009547|Ga0116136_1098545All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4762Open in IMG/M
3300009630|Ga0116114_1173998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4542Open in IMG/M
3300009636|Ga0116112_1054765Not Available1173Open in IMG/M
3300009645|Ga0116106_1046541All Organisms → cellular organisms → Bacteria → Proteobacteria1455Open in IMG/M
3300009700|Ga0116217_11011018All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4509Open in IMG/M
3300009762|Ga0116130_1008319All Organisms → cellular organisms → Bacteria → Acidobacteria3871Open in IMG/M
3300009824|Ga0116219_10066558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42119Open in IMG/M
3300010341|Ga0074045_10440105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4842Open in IMG/M
3300010379|Ga0136449_100432326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42319Open in IMG/M
3300010379|Ga0136449_101112268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41256Open in IMG/M
3300010379|Ga0136449_101986548All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4860Open in IMG/M
3300010379|Ga0136449_102546440All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4732Open in IMG/M
3300012357|Ga0137384_10715479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4813Open in IMG/M
3300013306|Ga0163162_12922309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4550Open in IMG/M
3300014152|Ga0181533_1072490All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1647Open in IMG/M
3300014153|Ga0181527_1112318All Organisms → cellular organisms → Bacteria1256Open in IMG/M
3300014161|Ga0181529_10272135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4957Open in IMG/M
3300014164|Ga0181532_10024713All Organisms → cellular organisms → Bacteria4277Open in IMG/M
3300014164|Ga0181532_10162523All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1334Open in IMG/M
3300014164|Ga0181532_10391388All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4773Open in IMG/M
3300014165|Ga0181523_10731104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4540Open in IMG/M
3300014168|Ga0181534_10021112All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae3292Open in IMG/M
3300014169|Ga0181531_10703436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4628Open in IMG/M
3300014199|Ga0181535_10095710All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300014200|Ga0181526_10200064All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1278Open in IMG/M
3300014200|Ga0181526_10425043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4843Open in IMG/M
3300014200|Ga0181526_10603326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4694Open in IMG/M
3300014200|Ga0181526_10696499All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4641Open in IMG/M
3300014326|Ga0157380_13037651All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4535Open in IMG/M
3300014492|Ga0182013_10465349All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium665Open in IMG/M
3300014492|Ga0182013_10488166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4643Open in IMG/M
3300014638|Ga0181536_10351504All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300014655|Ga0181516_10307508Not Available806Open in IMG/M
3300014658|Ga0181519_10047025All Organisms → cellular organisms → Bacteria2891Open in IMG/M
3300014838|Ga0182030_10489658All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300014839|Ga0182027_10969946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4873Open in IMG/M
3300014968|Ga0157379_11255698Not Available714Open in IMG/M
3300014969|Ga0157376_10427939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761286Open in IMG/M
3300015374|Ga0132255_101854585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4916Open in IMG/M
3300016341|Ga0182035_12108713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4512Open in IMG/M
3300016387|Ga0182040_11150750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4651Open in IMG/M
3300017925|Ga0187856_1010912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5214Open in IMG/M
3300017925|Ga0187856_1094657All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300017925|Ga0187856_1205323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4712Open in IMG/M
3300017929|Ga0187849_1097061Not Available1257Open in IMG/M
3300017929|Ga0187849_1294465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4608Open in IMG/M
3300017934|Ga0187803_10166428Not Available868Open in IMG/M
3300017935|Ga0187848_10143145All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1057Open in IMG/M
3300017935|Ga0187848_10373893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4589Open in IMG/M
3300017946|Ga0187879_10243784All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300017948|Ga0187847_10578537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4626Open in IMG/M
3300017948|Ga0187847_10871677All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4512Open in IMG/M
3300017988|Ga0181520_10388863All Organisms → cellular organisms → Bacteria1015Open in IMG/M
3300018002|Ga0187868_1142570All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300018008|Ga0187888_1091482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1308Open in IMG/M
3300018009|Ga0187884_10400102All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4552Open in IMG/M
3300018016|Ga0187880_1268975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4745Open in IMG/M
3300018017|Ga0187872_10083588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1628Open in IMG/M
3300018022|Ga0187864_10002146All Organisms → cellular organisms → Bacteria17459Open in IMG/M
3300018022|Ga0187864_10200731All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300018025|Ga0187885_10562372All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4507Open in IMG/M
3300018030|Ga0187869_10027158All Organisms → cellular organisms → Bacteria3196Open in IMG/M
3300018033|Ga0187867_10431626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4728Open in IMG/M
3300018035|Ga0187875_10765757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4505Open in IMG/M
3300018037|Ga0187883_10088409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1617Open in IMG/M
3300018038|Ga0187855_10020359All Organisms → cellular organisms → Bacteria4348Open in IMG/M
3300018038|Ga0187855_10146266All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300018038|Ga0187855_10295491Not Available948Open in IMG/M
3300018042|Ga0187871_10870385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4503Open in IMG/M
3300018043|Ga0187887_10471212All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4741Open in IMG/M
3300018057|Ga0187858_10195626All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41322Open in IMG/M
3300018062|Ga0187784_10217982Not Available1556Open in IMG/M
3300018062|Ga0187784_10253175All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300018062|Ga0187784_10511020All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300022875|Ga0224553_1013650All Organisms → cellular organisms → Bacteria → Proteobacteria2205Open in IMG/M
3300022875|Ga0224553_1096935All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4588Open in IMG/M
3300023068|Ga0224554_1019773All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300023091|Ga0224559_1100040Not Available1075Open in IMG/M
3300025460|Ga0208562_1112538All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4518Open in IMG/M
3300026502|Ga0255350_1077186Not Available748Open in IMG/M
3300028748|Ga0302156_10021377All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3809Open in IMG/M
3300028783|Ga0302279_10320541All Organisms → cellular organisms → Bacteria → Acidobacteria674Open in IMG/M
3300029908|Ga0311341_10620369All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4608Open in IMG/M
3300029986|Ga0302188_10192220All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300030688|Ga0311345_10094218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43450Open in IMG/M
3300031057|Ga0170834_105807856All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031128|Ga0170823_11670589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4755Open in IMG/M
3300031231|Ga0170824_103923775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4573Open in IMG/M
3300031446|Ga0170820_13940797All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41258Open in IMG/M
3300031474|Ga0170818_113791787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41061Open in IMG/M
3300031718|Ga0307474_11190864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4602Open in IMG/M
3300032261|Ga0306920_103125880Not Available622Open in IMG/M
3300032828|Ga0335080_10347937All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300032828|Ga0335080_10347937All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300032892|Ga0335081_11003847All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300033402|Ga0326728_10571596All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans891Open in IMG/M
3300033818|Ga0334804_011072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43546Open in IMG/M
3300033887|Ga0334790_008604All Organisms → cellular organisms → Bacteria5655Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland23.73%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog15.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.78%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.08%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.24%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil4.24%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog3.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.54%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.69%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.85%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.85%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.85%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.85%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004470Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300022875Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 10-14EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026502Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300029908II_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033818Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-MEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068967_122920513300004470Peatlands SoilGPRKFSEVHGLNIPAMVARLSAKPCIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSTIRREIQAKVA*
Ga0070689_10154586713300005340Switchgrass RhizosphereAIAARLSAKPFIKVESGSFVGRFGDQEYELGPTEAGVARAIRRMSEIRSEVQAEVANV*
Ga0070678_10057610813300005456Miscanthus RhizosphereVHQLNTSTIVARLSAKPSIRVESGNFVGFVGNQEYMLGSTKNGIARAIHKMSELRREIQAEGA*
Ga0066795_1002503813300005938SoilEVHQLNIRALATRLSAKPWIRVEAGVFVGRFGDQEYALGSTEAGVARAIRRMSELRREIQVKVA*
Ga0080027_1001882413300005993Prmafrost SoilARLSTKPFIRVESGRFVGRFGDQEYDLGSTETGLDRAIRRVSEFRREREVDAA*
Ga0080027_1006140033300005993Prmafrost SoilARLSTKPFIRVESGRFVGRFGDQEYDLGSTETGLDRAIRRMSAFRREREVDAA*
Ga0066797_102841553300006864SoilPRKFAEVHQLNIRAIVARLSAKPLTRVESGAFVGRFGDQEYALGPTEAGLARAIRRMSELRREIQAKVA*
Ga0075528_1001030913300006949Arctic Peat SoilVHELNIRAIVSRLSAKPFIRVELGSFVGRFGDQEYALGSTEAGVARAIRRMRDLRGEMQAEVA*
Ga0066793_1014160723300009029Prmafrost SoilVVEADAFLRRVRALVEATPIRLSAKPWIRVESGVFVGRVGDQEYELGSTQAGLARAIRRMSELRREIQAKVA*
Ga0066793_1024772323300009029Prmafrost SoilVHHLNLRAIVARLSEKPLIRVELSRFVGRFGDQEHALGSTEAGLARAIRRMSELRRERETEAA*
Ga0066793_1036518933300009029Prmafrost SoilKKGFKGKKPQVAFPWDIRAIVTRLSAKPLIRVESGAFVGRFGDQECALGSTEAGVARAIRRMSELRREIQAEVA*
Ga0105245_1072212723300009098Miscanthus RhizosphereVHQLNIQVIVARLSAKPRIRVASGSFVARVDNQEYVLGSTEAGVAQAIRKMSQLRQEIQTEMA*
Ga0105242_1073569713300009176Miscanthus RhizosphereIPAMVARLSAKPLIRVESGTFVGRFGDRDYVLGPSEAGLARAIRRMRELRREIQAEVA*
Ga0105248_1011688443300009177Switchgrass RhizosphereVHQLNIQVIVARLSAKPRIRVASGSFVARVDNQEYVLGSTEAGVAQAIRRMRELRREIQAEVA*
Ga0116108_112172533300009519PeatlandTVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA*
Ga0116136_103254513300009547PeatlandTVARLSARPFIRVESGACVGRFGDQEYELGPTEAGVARAIRRMSQLRREMETEDVA*
Ga0116136_109854513300009547PeatlandDCANAKAARSARVSRLSAKPFIRVESGAFVGRFGDQEYELGPTETGLARAIGRMSQLRREIEAEVA*
Ga0116114_117399813300009630PeatlandQLDIRAIVARLSARPFIRVESGIFVGRFVDQEYELGPTEAGLARAIRRMSQLRREMEAEVA*
Ga0116112_105476513300009636PeatlandVARLSARPFIRVESGACVGRFGYQEYELGPTEAGLARAIRRMSQLRREMETEEVA*
Ga0116106_104654143300009645PeatlandNPHEGELSEKPFIRVESGTFVRRFGDQEFELGPTEAGLARAIRRMSQLRHEMETEVV*
Ga0116217_1101101813300009700Peatlands SoilSEVHHLDLAAIVARLSAKPRIRVESGAFVGRFGDQEYELGTTEAGLARAIRRMSALRREIQEKVA*
Ga0116130_100831963300009762PeatlandVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA*
Ga0116219_1006655823300009824Peatlands SoilVHQLNIRALVARLSAKPFIRVESGAFIGRFGDQEYELGSTEAGLARAIHKMSQLRQEIQAEVA*
Ga0074045_1044010513300010341Bog Forest SoilIRAIVARLSRKAFIRVEAGSFIGRIGDQEYALGPTEAGLARAIGRMRQLRREREAEAA*
Ga0136449_10043232613300010379Peatlands SoilVHHLSIRAIVARLSAKPLIRVESGTFVGCLGNEEYVLGSTEGGLARAIRRMDELRREIQAEVA*
Ga0136449_10111226823300010379Peatlands SoilMSAKPFIRVESGAFVGRFGDQEYELGSTEAGLAWAIRRMSELRREVQTEVA*
Ga0136449_10198654813300010379Peatlands SoilVARLSAKPFIRVESGAFIGRFGDQEYELGSTEAGLARAIRKMSQLRQEIQAEVA*
Ga0136449_10254644023300010379Peatlands SoilRLRAKPFIRVEAGVFVGRFGGQEYVLGPTRAGLPQAIRKMSELRWEILAEVA*
Ga0137384_1071547913300012357Vadose Zone SoilLDIPTIVARLSAKPCIRVESGVFVGRFGDQEYGLGSTEAGLARAIRRMSALRRQIQEDVA
Ga0163162_1292230913300013306Switchgrass RhizosphereLSAKPFIKVESGSFVGGFGDQEYELGSTEAGVARAIRRMRELRREREAEVA*
Ga0181533_107249013300014152BogVHALNIRENVARLSGKPFIRVETGNFVGRIGDREYELGPTEAGLVRAISRMRQLRLESEAEAA*
Ga0181527_111231823300014153BogVDELNIREIVARLSGRPFIRAEAGSFIGRFGDQEYGLGSTEAGLPMAIGRMSQLRREMEAEAA*
Ga0181529_1027213513300014161BogVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELRPTEAGLARAIRRMSQLPREMETDVA*
Ga0181532_1002471353300014164BogVHQVNVQAIVARLSAKPVIRVESGVFVGRFGGEEYTLAPTEAGLERAIRRMSQLRREREEAAA*
Ga0181532_1016252323300014164BogLDIRAIAARLSAKPFIRIESGFFVGQFGDQEYELGSTEAGLARAIRRMSRLRREAELEEVA*
Ga0181532_1039138823300014164BogVHQLNIRATVARLSEKPFIRLESGAFVGRFGDQEYELGPTAAGLARAIRRMSQLPREMETDVA*
Ga0181523_1073110413300014165BogKSRSHPARRFAEVHQVNVQAIVARLSAKPVIRVESGVFVGRFGGEEYTLAPTEAGLERAIRRMSQLRREREEAAA*
Ga0181534_1002111283300014168BogRLSGKPFIRVESGAFVGRFGDQEYELGPTAAGLARAIRRMSQLRREMESEVA*
Ga0181531_1070343623300014169BogVNLRAIVARLSAKPSIRVESGVFVGRFGEDEYALGPTEAGLLQAVRKMSQVRRERELEVA
Ga0181535_1009571033300014199BogVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETDVA*
Ga0181526_1020006433300014200BogEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEVA*
Ga0181526_1042504313300014200BogVHQLDIRAIVARLSEKPVIRVESGAFVGRFGDQQYELGSTEAGLARAIRRMSQLRREMETEVA*
Ga0181526_1060332613300014200BogVHQVNVQAIVARLSAKPYIRVESGVFVGRLAGEEYDLGPTEAGLARAIRRMSQLRREREAAAA*
Ga0181526_1069649923300014200BogPRRFAEVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELRPTEAGLARAIRRMSQLPREMETDVA*
Ga0157380_1303765113300014326Switchgrass RhizosphereVHQLNLGAIAARLSAKPFIKVESGSFVGGFGDQEYELGSTEAGVARAIRRMREIRREIQA
Ga0182013_1046534913300014492BogRLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA*
Ga0182013_1048816613300014492BogHLHIGAMVARLSAKPFIRVESGAFVGRFGEEEYALGPTEAGLAQAIRRMSQLRREREAEAA*
Ga0182012_1039694213300014499BogMHGLNLGRIVVRLSAKPSIRVQSGIFVGRFGEEEYALGSTEGGLVQAVRRMRQVRREREMEVA*
Ga0181536_1035150433300014638BogLSGRPFIRAEAGSFIGRFGDQEYGLGSTEAGLPMAIGRMSQLRREMEAEAA*
Ga0181516_1030750823300014655BogVNVQAIVARLSAKPYIRVESGVFVGRFAGEEYDLGPTEAGLARAIRRMSQLRREREAAAA
Ga0181519_1004702553300014658BogVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELGPTEAGLARAIRRMSQLPREMETDVA*
Ga0182030_1048965813300014838BogAEVHDLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA*
Ga0182027_1096994613300014839FenVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA*
Ga0157379_1125569813300014968Switchgrass RhizosphereQAIVARLSAKPRIRVASGSFVARVDNQEYVLGSTEAGVAQAIRKMSQLRQEIQTEMA*
Ga0157376_1042793913300014969Miscanthus RhizosphereVHQLNIQVIVARLSAKPRIRVASGRFVARVDGQEYVLGSTDAGVARAIRRMRELRLEIQAEVA*
Ga0132255_10185458513300015374Arabidopsis RhizosphereARLSAKPFIRVQSGAFVGRVRDQEYGLGSTEAGVARAIRRMNELRQEMEAEGA*
Ga0182035_1210871313300016341SoilAIVARLSAKPRIRVDSDTFVGRLGDQEYELGSTEPGVARAIRRMRELRREIQPEVA
Ga0182040_1115075023300016387SoilVHRLNLGAIVARLSEKPGMRVDSGTFVCQFGDQEYELGSTEAGVARAIRRMRELRREIQPEVA
Ga0187856_101091213300017925PeatlandLNIRATVARLSARPFIRVESGACVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEEV
Ga0187856_109465733300017925PeatlandRAIVARLSAKPSIRVESGAFVGRFGDQEYELGPTEAGVARAIRRMSQLRREMETEDVA
Ga0187856_120532323300017925PeatlandGHRLGPRRFAEVHQLNIRAAVARLSAKPFIRVESGACVCRFGNQEYALGPTEAGLARAIRRMSQLRRELEAEVA
Ga0187849_109706113300017929PeatlandVHQLNIRAIVARLSAKPSIRVESGAFVGRFGDQEYELGPTEAGVARAIRRMSQLRREMETEDVA
Ga0187849_129446523300017929PeatlandLDIRAIVARLSARPFIRVESGAFVGRFGDEEYELGPTEAGLARAIGRMSQLRREMEADAA
Ga0187803_1016642823300017934Freshwater SedimentVHHLNIPAMVARLSAKPCIRVESGAFMGRCGDQDYELGSTEAGLARAIRRMSELRREIQAKVA
Ga0187848_1014314523300017935PeatlandVHQLNIRAIVTRLSARPFIRVESGIFVGRFVDQEYELGPTEAGLARAIRRMSQLRREMEAEVA
Ga0187848_1037389323300017935PeatlandLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA
Ga0187879_1024378433300017946PeatlandHRLGPRRFAEAHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMRQLRREMETEVA
Ga0187847_1057853723300017948PeatlandVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELGPTEAGLARAIRRMSQLPREMETDVA
Ga0187847_1087167713300017948PeatlandEVHQVNVQEIVARLSTKPFIRVESGVFVGRFGGEEYDLGPTEAGLVLAIRGMSQLRRERESAAA
Ga0181520_1038886313300017988BogVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELRPTEAGLARAIRRMSQLPREMETDVA
Ga0187868_114257033300018002PeatlandAIVARLSARPFIRVESGAFVGRFGDEEYELGPTEAGLARAIGRMSQLRREMEADAA
Ga0187888_109148233300018008PeatlandGPRRFAEVHQLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGSTEAGLARAIRRMSQLRREMETEVA
Ga0187884_1040010213300018009PeatlandEPHQLDIRATVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA
Ga0187880_126897513300018016PeatlandVDELNIREIVARLSGRPFIRAEAGSFIGRFGDQEYGLGSTEAGLPMAIGRMSQLRREMEAEAA
Ga0187872_1008358843300018017PeatlandLNIRATVARLSARPFIRVESGACVGRFGDQEYELGPTEAGLARAIRRMSQLRRE
Ga0187864_10002146143300018022PeatlandVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA
Ga0187864_1020073113300018022PeatlandVHQLDIRAIVARLSARPFIRVESGAFVGRFGDQEYELGPTKAGLARAIRRMSQLRREMETEVA
Ga0187885_1056237213300018025PeatlandGACVGEDCANAKAARSARVSRLSAKPFIRVESGAFVGRFGDQEYELGPTETGLARAIGRMSQLRREIEAEVA
Ga0187869_1002715853300018030PeatlandVARLSEKPFIRVESGAFVGRFGDQEYELGPTEADLARAIRRMSQPRREMETEVA
Ga0187867_1043162623300018033PeatlandYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0187875_1076575713300018035PeatlandHRRFAEVHQVNVQAIVARLSAKPYIRVESGVFVGRFAGEEYDLGPTEAGLARAIRRMSQLRREREAAAA
Ga0187883_1008840913300018037PeatlandSYHRLGPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGPTQAGLARAIRRMSQLRREMETEVA
Ga0187855_1002035973300018038PeatlandVHQLDIRATVARLSEKPFIRVQSGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETDVA
Ga0187855_1014626613300018038PeatlandIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA
Ga0187855_1029549113300018038PeatlandIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMRQLRREMETEVA
Ga0187871_1087038513300018042PeatlandPHRGHSVFHEASMGAKPFIRVESGVLFGRFGEEEYALGSTEAGLARAIRRMNQLRREWEVEAA
Ga0187887_1047121223300018043PeatlandVHQVNVQEIVARLSARPFIRVESGVFVGRLGEEEYALGCTEAGLARAIRRMNQLRREWEVEAA
Ga0187858_1019562643300018057PeatlandLNLRAIVARLSGKPFIRVEGGSFIGRVGDQEYQLGSTATGLAWAIRRMSQLRREREAEAA
Ga0187784_1021798243300018062Tropical PeatlandPAIVARLSAKPSIRVEAGRFVGRLGDQEYALGTTEAGLARAIRRMTALRQEVLAEVA
Ga0187784_1025317523300018062Tropical PeatlandLVAKLSAKPTIRVESGSFVGRLGDQEYELGTTAAGVARAIRRMTALRRDIPAEVA
Ga0187784_1051102033300018062Tropical PeatlandFAEAHQLNVPQIVARLSAKPSIRVQSGGFVGILHNQEYPLGTTAAGIARAIRKMNALRRETLMEVA
Ga0224553_101365053300022875SoilPHEGELSEKPFIRVESGTFVRRFGDQEFELGPTEAGLARAIRRMSQLRHEMETEVV
Ga0224553_109693523300022875SoilLGPRRFAEVHDLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA
Ga0224554_101977313300023068SoilFAEVHDLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPTEAGLARAIRRMSQLRREMETEVA
Ga0224559_110004043300023091SoilVARLSAKAIIRVESGSFVGRLGDREYELGSTEAGVARAIRRMSELRREMEAARCGRSAPDSHVS
Ga0208562_111253823300025460PeatlandPRRFAEVHQLDIRAIVARLSEKPFIRAESGAFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0255350_107718613300026502SoilVHHLNIRAIVARLSGKPFIRVEAGSFVGRLGDQEYHLGFTEAGLARAISRMSQLRREREAEAA
Ga0302156_1002137713300028748BogEGELSEKPFIRVESGTFVGQFGDQEFELGPTEAGLARAIRRMSQLRHEMETEVV
Ga0302279_1032054123300028783BogLGPRRFAEAHQLDIQATVARLSEKPFIRVESGAFVGRYGDQEYVLGSTGAGLARAIRKMSQLRRELETEVA
Ga0311341_1062036913300029908BogLDIQATVARLSEKPFIRVESGAFVGRYGDQEYVLGSTGAGLARAIRKMSQLRRELETEVA
Ga0302188_1019222033300029986BogDIRAIVARLSEKPFIRVESGTFVGRFGDQEYELGSTEAGLARAIRRMRQLRREMETEVA
Ga0311345_1009421813300030688BogVNVQAIVARLSAKPFIRVESGVFVGRFGEEEYALGPTEAGLARAVRRMSQVRRERETEVA
Ga0170834_10580785613300031057Forest SoilVHQLNILAIVARLNAKPWIRVESGTFVGYLGDQEYELGSTEAGVARAIRRMRELRR
Ga0170823_1167058913300031128Forest SoilMHQLNLWAIVARLSEKPRIRVDSGTFVGRFGDQEYELGPTEAGVARAIRRMRELRREIQAEVA
Ga0170824_10392377513300031231Forest SoilPGNFSSNAGDVYDRFSAKPWIRVEAGTFVGRFGDQEYELGSTEAGVARAIRRMRELRREIQAEVA
Ga0302325_1179421223300031234PalsaMHKIDVRVIVARLSAKPCIRVESGLFVGRFGEEEYALGSTASGLVHAIQRIRQLQRERGTEAA
Ga0302324_10344462013300031236PalsaGWGHGKFAEMHKIDVRAIVARLSAKPCIRVESGLFVGRFGEEEYALGSTASGLVHAIQRIRQLQRERGTEAA
Ga0170820_1394079733300031446Forest SoilMHQLNLGAIVARLSEKPRIRVDSGTFVGRFGDQEYELGPTEGRVAWAIRRMRELRLEIQGEVA
Ga0170818_11379178713300031474Forest SoilMHQLNLGAIVARLSEKPRIRVDSGTFVGRFGDQEYELGSTEAGVARAIRRMRELRREIQAEVA
Ga0302320_1086626913300031524BogAEMHGLNLGRIVARLSAKPSIRVQSGIFVGRFGEEEYALGSTEGGLVQAVRRMRQVRREREMEVA
Ga0307474_1119086423300031718Hardwood Forest SoilLNIPALVARLSAKPIIRVESGVFVGQFGDQEYRLGSTEAGLAQAIRRMSALRNEIQASP
Ga0306920_10312588023300032261SoilVIVARLSEKPRIRVDSGTFMGRFGDQEYELGSTEAGVARAIRRMRELRREIQPEVA
Ga0335080_1034793713300032828SoilMDSYHKLGLREFSEVHHLNIPAVVARLSAKPFIRVESGAFVGRFGDQEYELGSTEGLARAIRRMS
Ga0335080_1034793753300032828SoilLNIPAVVARLSAKPFIRVESGAFVGRFGDLEYELGSTEAGLARAIRRMSELRREVQADVA
Ga0335081_1100384733300032892SoilKFSEAHQVSIPAIVARLSAKPFIRVESGGFVGRLGDHEYELGPTQAGLPRAIRRMSELRREMLAEVA
Ga0326728_1057159633300033402Peat SoilLDLPAMVARLSAKPRIRVESGIFVGRFGDQEYELGSTEAGLARAIRKMSAIRREIQAKVA
Ga0334804_011072_2017_21993300033818SoilLDIRAIVARLSEKPFIRVESGAFVGRFGDQEYELGPAEAGLARAIRRMSQLRREIETEVA
Ga0334790_008604_2035_22263300033887SoilVHGLDIRAIVARLSGKPHIRIEAGAFVGRFGDQEYELGTTKAGPARAIRRMSELRRELEAEVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.