Basic Information | |
---|---|
Family ID | F074992 |
Family Type | Metagenome |
Number of Sequences | 119 |
Average Sequence Length | 41 residues |
Representative Sequence | MPQIDAPSLCERFGTLAVAVGLTVGELASVSAVVITVKAEG |
Number of Associated Samples | 66 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 3.45 % |
% of genes near scaffold ends (potentially truncated) | 10.08 % |
% of genes from short scaffolds (< 2000 bps) | 97.48 % |
Associated GOLD sequencing projects | 66 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (94.958 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.958 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (94.958 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 94.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0097621_1014280111 | 3300006237 | Miscanthus Rhizosphere | VPQIDAPSLGECFGTLAIAVGLTIGELASVSAVVVAVKAEG* |
Ga0105243_130284821 | 3300009148 | Miscanthus Rhizosphere | VPQIDAPCLCDLVGTLAVVVGLTDGEKSSVRAVAAAVKA |
Ga0157374_110476451 | 3300013296 | Miscanthus Rhizosphere | VPQIDAPSRCERFGAMAVAVGLTGGEFALVSAVVAAVKAGA* |
Ga0157374_120566962 | 3300013296 | Miscanthus Rhizosphere | MPQIDAPSLCERFGTLAVAIELTGGEFASVSAVVVAVKAGA* |
Ga0157378_122023382 | 3300013297 | Miscanthus Rhizosphere | MPQIDAPSLCEHFGTLVVAVELTIDELASVSAVVVAVKAGG* |
Ga0182122_10115432 | 3300015267 | Miscanthus Phyllosphere | VPQIDAPSRCERFGAMAVAVGLTGGEFASVSAVVAAVKAEA* |
Ga0182122_10697211 | 3300015267 | Miscanthus Phyllosphere | PSRCERFGAMAVTVGLTSGEFASVSAVVAAVKAGA* |
Ga0182154_10469151 | 3300015268 | Miscanthus Phyllosphere | MPQIDAPSSYERFGTLAVVVGLTIDELAPVSAVVAAVKAGG* |
Ga0182154_10489451 | 3300015268 | Miscanthus Phyllosphere | VPQIDAPSRCERFCALAVAVGLTGGEFASVSAVVIAVKAEA* |
Ga0182154_10615071 | 3300015268 | Miscanthus Phyllosphere | VLPLTSIVPQIDAHSRCERFGALAVTVGLTGGEFASVSAVVVVVKAEA* |
Ga0182113_10129771 | 3300015269 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVTVELIVDELASVSAVIVAVKAGA* |
Ga0182113_10239542 | 3300015269 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAIAVGLTIGETASVYAIVVA |
Ga0182113_10661992 | 3300015269 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAFGLTFGELASVSAIIVVVKA |
Ga0182188_10208562 | 3300015274 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVELIVDELASVNAVVVAVKAGA* |
Ga0182188_10580271 | 3300015274 | Miscanthus Phyllosphere | MPQIDAPSRCERSGTLTVAVELTVDELASVSAVIVAVKAEG* |
Ga0182172_10326362 | 3300015275 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAVAVGLTIGELASVSAVIITVKAEG* |
Ga0182172_10358432 | 3300015275 | Miscanthus Phyllosphere | MPQIDAPSLCEHFGTLALAVELTVDELASVRGIVVVVKAGG* |
Ga0182172_10753271 | 3300015275 | Miscanthus Phyllosphere | MSQIDAPSSCERVGTLAVAVGLTVGELAPVSAVIATVKARG* |
Ga0182170_10157641 | 3300015276 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAVAVGLTVGELAPVSAVVAAVKAGG* |
Ga0182170_10695092 | 3300015276 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVGLTGGEFASVSAVIVAVKAEA* |
Ga0182128_10179042 | 3300015277 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAVAIELTVDELASVSAVIVAVKAGG* |
Ga0182128_10262302 | 3300015277 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAVAVELTVDDLASVSAVVVTVKAGG* |
Ga0182160_10196452 | 3300015281 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTIGELASVSAVIVAVKAEGQG* |
Ga0182160_10583271 | 3300015281 | Miscanthus Phyllosphere | MSSLTSVVPQIDAPSLYECFGTLAVAVGLTVGELASVSAVVVAVKAEG* |
Ga0182124_10079952 | 3300015282 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTIGELASVSAVVVAVKAEG* |
Ga0182156_10876771 | 3300015283 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVGLTVGELEPVSAVVVVVKAEG* |
Ga0182186_10718031 | 3300015285 | Miscanthus Phyllosphere | VPQIDAPSLCERFGTLAIAVGLTVNETASVSAVIAVVKAEA* |
Ga0182176_10350452 | 3300015286 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVGLTVGELASVSAVVITVKAEG* |
Ga0182176_10540521 | 3300015286 | Miscanthus Phyllosphere | MPQIDAPSLCKRFGTLAVAVELSGGEFASVSTVVAAVKAGA* |
Ga0182176_10572661 | 3300015286 | Miscanthus Phyllosphere | VLSLTFVVPQIDAPSRCERFGALAVAIGLTGGEFALVSALVVAVKAEA* |
Ga0182171_10494192 | 3300015287 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAVAVGLTVGELAPVSVVEATVNARG* |
Ga0182173_10634811 | 3300015288 | Miscanthus Phyllosphere | VPQIDAPSLCERFGTLAVAVGLTVGELASVSAVVITVKAEG* |
Ga0182173_10733962 | 3300015288 | Miscanthus Phyllosphere | MPQIDAPSLCEHFGTLAVAVELTIDELASISAVVVAVKAGG* |
Ga0182138_10328022 | 3300015289 | Miscanthus Phyllosphere | MPQIDASSLCEHFGTLAIAVGLTIGELASVSAVVVAVKAEG* |
Ga0182125_10353051 | 3300015291 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVGLTVGELASVSAAIIAVKAEG* |
Ga0182125_10367362 | 3300015291 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTVAVAIELTIDELASVSAIIVTVKAGG* |
Ga0182141_10337701 | 3300015292 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAVVVAVKAEG* |
Ga0182126_10496781 | 3300015294 | Miscanthus Phyllosphere | VPQIDAPSRCERFGAMAVAVGLTGGEFASVSAIVAAVKAGA* |
Ga0182126_10729791 | 3300015294 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAVVVAVKAE |
Ga0182175_10320401 | 3300015295 | Miscanthus Phyllosphere | VPQIDAPSRCERFGAMAVAVGLTGGEFASVSAVVAAVKAGA* |
Ga0182157_10266041 | 3300015296 | Miscanthus Phyllosphere | MPQIDAPSRCECFGTLAVAVGLTVDELASVSAVVVAVKAGG* |
Ga0182157_10601612 | 3300015296 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAIVVAVKAEG* |
Ga0182157_10919301 | 3300015296 | Miscanthus Phyllosphere | VPQIDAPSLCERFGTLAVAVGLTIGELASVSAVIITVKAEG* |
Ga0182106_10331012 | 3300015298 | Miscanthus Phyllosphere | MPQIDAPSSCERFGTLAVVVGLTIGELAPVSAVVATVKARG* |
Ga0182106_10552951 | 3300015298 | Miscanthus Phyllosphere | DAPSRCECFGTLAVAVGLTVDELASVSAVVVGVKAGG* |
Ga0182107_10678682 | 3300015299 | Miscanthus Phyllosphere | VPQINAPSRCERFGAMIVAIGLIGGEFASVSAVVAVVKAGA* |
Ga0182108_10313612 | 3300015300 | Miscanthus Phyllosphere | MPQIDAPSSCERFGTLVVAIGLTVGELAPVSAVVAAVKAGG* |
Ga0182108_10357562 | 3300015300 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALVVAVGLTGGEFASVSAVIVAVKAEA* |
Ga0182108_10660781 | 3300015300 | Miscanthus Phyllosphere | MPSIDASSHGDCFGSLAVAVGLTVGELASVSAVIVAVKAES* |
Ga0182143_10977591 | 3300015302 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVELTVDELASVSAVVVTVKAGG* |
Ga0182123_10209301 | 3300015303 | Miscanthus Phyllosphere | MHSIDASSHGDCFGTLAVAVGPTIGELASVSAVIVAVKAEG* |
Ga0182123_10569401 | 3300015303 | Miscanthus Phyllosphere | VPQIDAYSRCERFGAMAVAVGLTGGEFASVSAVVAVVKAGA* |
Ga0182123_10966362 | 3300015303 | Miscanthus Phyllosphere | VPQIDAPSRCERFGAMAVAVGLTGGEFASVSAVVVVVKAEA* |
Ga0182112_10486661 | 3300015304 | Miscanthus Phyllosphere | MPQIDAPSLCERFCTLAVAVELTVDDLASVSAVIIVVKVGG* |
Ga0182112_10641721 | 3300015304 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAVVVVVKAEG* |
Ga0182158_10964841 | 3300015305 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAIELTGGEFASVSAVVVAVKAGG* |
Ga0182144_10286891 | 3300015307 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAVIVAVKAEG* |
Ga0182142_10741411 | 3300015308 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAGAVELTDDEFASVSAVVAAVKAGA* |
Ga0182140_10396972 | 3300015314 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVGPTGGEFASVSAVIVAVKAKA* |
Ga0182140_10827831 | 3300015314 | Miscanthus Phyllosphere | VPQIDAPSLGECFGTFAVDVGLTIGELASVSAVVVAVKAEG* |
Ga0182140_11076431 | 3300015314 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAIAIELTIDELALVSAVVVAVEAGG* |
Ga0182110_10841371 | 3300015322 | Miscanthus Phyllosphere | VPQIDAPSHYECFGAMAVPVGLTGGKFESVSAVVAAVKAGA* |
Ga0182129_10681022 | 3300015323 | Miscanthus Phyllosphere | MPQMDAPSRCEHSGTLAVAVELTIDELASVSAVVVAVKAEG* |
Ga0182109_10516501 | 3300015342 | Miscanthus Phyllosphere | VPHIDAPNRCERFGALAVAVGLTGGEFVSVSAVVDAVKAEA* |
Ga0182109_11575152 | 3300015342 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVEFTVDELASVNAVVVAVKAGG* |
Ga0182109_11582181 | 3300015342 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLAVVIGLTIGERASVSVIVAAVKAEG* |
Ga0182109_12144321 | 3300015342 | Miscanthus Phyllosphere | VPQIDALSSCERVGTLAVAVGLTGGELAPVSAVEATVKARG* |
Ga0182155_11633021 | 3300015343 | Miscanthus Phyllosphere | SLCERFGTLAVVVELTGGEFASVSTVVAAVKAGA* |
Ga0182189_10355321 | 3300015344 | Miscanthus Phyllosphere | MPQIDAPSSCERFGTLAVVVGLTIGELAPVSAVVAAVKAGG* |
Ga0182189_10860671 | 3300015344 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVGLTGGEFASVSAVVVVVKAEA* |
Ga0182189_11203462 | 3300015344 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVELTVDELASVSAVIVAVKAES* |
Ga0182189_11374101 | 3300015344 | Miscanthus Phyllosphere | VPQIDAPSLCERFGTLAIAVGLTVGELASVSAVVVAVKAEA* |
Ga0182111_10680562 | 3300015345 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAIAVGLTIGELASVSTIVVAVKAEG* |
Ga0182111_12387812 | 3300015345 | Miscanthus Phyllosphere | MPQIDAPILCERFGTLAIVVELTDGEFTSVSAVVAAVKAGA* |
Ga0182139_12406631 | 3300015346 | Miscanthus Phyllosphere | MPQIDAPSSCERFGTLAVVVGLTVDELAPVSAVVAAVKAGG* |
Ga0182177_10384562 | 3300015347 | Miscanthus Phyllosphere | VPSSCERVGTLAIAVGLTGGELAPVSAVDATVNARG* |
Ga0182161_11443182 | 3300015351 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLVVAVELTVDELASVSAVVVVVKAEG* |
Ga0182159_11534711 | 3300015355 | Miscanthus Phyllosphere | VPQIDAPSRCEHFGALAVAVGLTGGEFASVIAAVKAGA* |
Ga0182159_12095501 | 3300015355 | Miscanthus Phyllosphere | MPQIDAPSRCERFGTLAVAVELTVDELAPVSAVVVAVKAGG* |
Ga0182159_13048971 | 3300015355 | Miscanthus Phyllosphere | MPEIDAPSSCERFGTLAITIGLTVGELAPVSAVIAAVKAGG* |
Ga0182145_11689051 | 3300015361 | Miscanthus Phyllosphere | MPQIDAPSPCERFGTLVVAVGLTIGETASVSAIVAAVKAKG* |
Ga0182203_10561251 | 3300017404 | Miscanthus Phyllosphere | VPQIDAPSLCEHFGTLAVAIGLTVGELASVSAIVVIVKAEG |
Ga0182220_10419291 | 3300017407 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVTVGLTVGELASVSTIIVAVKAKG |
Ga0182220_11007932 | 3300017407 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVAVELTGGEFASINAVVAAVKAKA |
Ga0182220_11045541 | 3300017407 | Miscanthus Phyllosphere | MPQIDASNLCERFGTLAVAVGLTVGELASVSAVVITVKAEG |
Ga0182204_10654201 | 3300017409 | Miscanthus Phyllosphere | MPQIDAPSSYERFGTLTVAVGLTVGELAPVSAVVAAVKAGG |
Ga0182204_10780971 | 3300017409 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAVIVAVKAEG |
Ga0182207_11411891 | 3300017410 | Miscanthus Phyllosphere | VQVGTSIGALSLAKRFGTLAVAIELTVGEFSSVSAVVVVVKAEG |
Ga0182208_10605001 | 3300017411 | Miscanthus Phyllosphere | MPQIDETSSCERFGTLAVAVGLTVGKLAPVSALAIVVKAGGWG |
Ga0182222_10356062 | 3300017413 | Miscanthus Phyllosphere | VLSLTSVLPHIDAPSRCEHFGALAIAVGLTGGEFASVSAVVVAVKAEA |
Ga0182222_10880551 | 3300017413 | Miscanthus Phyllosphere | VPQIDAPSLCERFGTLAVAVGLTVGELASVSAAIIAVKAEG |
Ga0182222_10910361 | 3300017413 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVGLTIGELAPVSAVVAAVKAEA |
Ga0182222_11069862 | 3300017413 | Miscanthus Phyllosphere | MPQIDAPSPCEHFGTLAVAVGLTVGETASVSAVVVAVKAGG |
Ga0182202_10258533 | 3300017415 | Miscanthus Phyllosphere | VPQIDAPSYGERFGTLAVAIGLTIGEEASVSAVIAVVKR |
Ga0182202_11025551 | 3300017415 | Miscanthus Phyllosphere | VLSLTFVVPQIDAPSLCERFGTLAVAVGLTVGELASVSAAIIAVKAEG |
Ga0182228_11033062 | 3300017420 | Miscanthus Phyllosphere | VPSPCERFGIFAVAVGLTVGETASVSAVIATVKAK |
Ga0182228_11275861 | 3300017420 | Miscanthus Phyllosphere | MSQIDASSLCEHFGTLAVAIGLTVGELASVSAVVVAVKAE |
Ga0182219_10812841 | 3300017424 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAIVVGLTVDELASVSAVVAVKAEG |
Ga0182224_10517612 | 3300017425 | Miscanthus Phyllosphere | MLSLTSVVPQIDAPSRCERFGALAVAVGLTGGEFASVSAVVVAVKAEA |
Ga0182190_10830642 | 3300017427 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVGLTGGEFASISAVVGAVKAKA |
Ga0182190_11192151 | 3300017427 | Miscanthus Phyllosphere | VPQIDASSLCKRFGTLAVVVELTGGEFASVSAVVAAVKAGA |
Ga0182190_11475172 | 3300017427 | Miscanthus Phyllosphere | VPQIDASSRYERFGAMVVAVGLTGDEFASVSAVVAAVKAGA |
Ga0182190_11642711 | 3300017427 | Miscanthus Phyllosphere | MPQINAPSSCERFGTLAVAVGLTVGELAPVSAVDATVNARGWG |
Ga0182206_10211961 | 3300017433 | Miscanthus Phyllosphere | VPQIDAPSRCERFGAMAVAVELTGDEFTSVSAVVAAVKAGA |
Ga0182206_10835952 | 3300017433 | Miscanthus Phyllosphere | MPQIDAPSLCEHFGTLVVAVELTVDELASVSTIVVVVKAEG |
Ga0182209_10414253 | 3300017436 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAVAVGLTVGELASVSAVVVVVKAEG |
Ga0182191_10732561 | 3300017438 | Miscanthus Phyllosphere | MLQIDAPSLCERFGTLAIAIELTIDELALVSAVVVAVEAGG |
Ga0182221_10784731 | 3300017442 | Miscanthus Phyllosphere | MPQIDAPSSCERFGTLAVVVGLTVGELAPVSTVVAEVKAEG |
Ga0182193_11507152 | 3300017443 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVGLTGGEFASVSAVVVAVKAEA |
Ga0182193_11513092 | 3300017443 | Miscanthus Phyllosphere | MPQIDAPSSCERFGTLAIAVGLTVGELAPVSAVVAAVKAGG |
Ga0182218_10523901 | 3300017683 | Miscanthus Phyllosphere | VPQVDAPSCVERFGAMAVAVGLTGGELAPVSVVDATVNDRG |
Ga0182227_11263492 | 3300017685 | Miscanthus Phyllosphere | MPSIDASSHGDCFGSLAVAVGLTVGELASVSAVIVAVKAEG |
Ga0182205_10332203 | 3300017686 | Miscanthus Phyllosphere | VPQIDAPSRCERFGALAVAVRLTVGELPPVSAVIVVVKAEG |
Ga0182205_10873751 | 3300017686 | Miscanthus Phyllosphere | VQIGTSVGAPSIGERFGTLAVAVGLTAGEFSSVSAVVVVVKAEG |
Ga0182205_11689691 | 3300017686 | Miscanthus Phyllosphere | MPQIDAPSLCERFGTLAVVVELTVDELASVSAVVVAVKAGA |
Ga0182223_10493482 | 3300017690 | Miscanthus Phyllosphere | VSQIDAPSRCERFDALAVAVGLIGDEFASVSAVVVAVKAKA |
Ga0182223_10733242 | 3300017690 | Miscanthus Phyllosphere | MPQIDAPSLCERFCTLAVAVELTVDDLASVSAVVVTVKAGG |
Ga0182223_11120182 | 3300017690 | Miscanthus Phyllosphere | MPSIDASSHGDCFGTLAIAVGLTIGELASVSAVVVAVKAEG |
Ga0207677_118468021 | 3300026023 | Miscanthus Rhizosphere | MPQIDAPSLCKRFDTLAVAVELTVDELASVNAVVVAVKAGA |
⦗Top⦘ |