NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074935

Metagenome / Metatranscriptome Family F074935

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074935
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 55 residues
Representative Sequence GVPVCVWSSSRSRRDDALLKDLGVSQFITKPSGLDQFMEIGKIIKDLLAGPRAG
Number of Associated Samples 104
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.84 %
% of genes near scaffold ends (potentially truncated) 97.48 %
% of genes from short scaffolds (< 2000 bps) 92.44 %
Associated GOLD sequencing projects 99
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.479 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(38.655 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.697 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.27%    β-sheet: 13.41%    Coil/Unstructured: 57.32%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF01339CheB_methylest 47.90
PF03705CheR_N 13.45
PF00072Response_reg 9.24
PF13596PAS_10 1.68
PF04203Sortase 1.68
PF01609DDE_Tnp_1 0.84
PF01799Fer2_2 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 95.80
COG1352Methylase of chemotaxis methyl-accepting proteinsSignal transduction mechanisms [T] 26.89
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 1.68
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.84
COG3293TransposaseMobilome: prophages, transposons [X] 0.84
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.84
COG5421TransposaseMobilome: prophages, transposons [X] 0.84
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.84
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.48 %
UnclassifiedrootN/A2.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003541|JGI20214J51650_10837561All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300003674|Ga0006876_100813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3080Open in IMG/M
3300003674|Ga0006876_100814All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300004140|Ga0058894_1009835All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus612Open in IMG/M
3300004617|Ga0068955_1185754All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005327|Ga0070658_10077612All Organisms → cellular organisms → Bacteria2725Open in IMG/M
3300005356|Ga0070674_100955905All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005436|Ga0070713_101450466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4666Open in IMG/M
3300005534|Ga0070735_10177469All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300005535|Ga0070684_102000781All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales547Open in IMG/M
3300005542|Ga0070732_10125416All Organisms → cellular organisms → Bacteria1522Open in IMG/M
3300005563|Ga0068855_102149337All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005591|Ga0070761_10618218All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005947|Ga0066794_10045564All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300006358|Ga0068871_100907036All Organisms → cellular organisms → Bacteria817Open in IMG/M
3300006854|Ga0075425_101179493All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300006871|Ga0075434_100795848All Organisms → cellular organisms → Bacteria → Acidobacteria962Open in IMG/M
3300006954|Ga0079219_11273496All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300009101|Ga0105247_10828781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4708Open in IMG/M
3300009148|Ga0105243_12265308All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300009168|Ga0105104_10221621All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41030Open in IMG/M
3300009520|Ga0116214_1242842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4683Open in IMG/M
3300009521|Ga0116222_1444640All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4565Open in IMG/M
3300009549|Ga0116137_1022702All Organisms → cellular organisms → Bacteria2306Open in IMG/M
3300009623|Ga0116133_1167562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4581Open in IMG/M
3300009662|Ga0105856_1024751All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300009839|Ga0116223_10490594All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300010341|Ga0074045_10822588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4587Open in IMG/M
3300010373|Ga0134128_11423424All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300010379|Ga0136449_104685447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4500Open in IMG/M
3300011052|Ga0138585_144536All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4542Open in IMG/M
3300011120|Ga0150983_15645367All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4611Open in IMG/M
3300012960|Ga0164301_11319021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300012989|Ga0164305_11539059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300013104|Ga0157370_11684243All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300013296|Ga0157374_11565961All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300013297|Ga0157378_12232439All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300013297|Ga0157378_12741069All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4545Open in IMG/M
3300014161|Ga0181529_10186765All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300014161|Ga0181529_10478199All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300014164|Ga0181532_10610143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4592Open in IMG/M
3300014168|Ga0181534_10819365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4551Open in IMG/M
3300014200|Ga0181526_10199682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41279Open in IMG/M
3300014200|Ga0181526_11003676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4524Open in IMG/M
3300014200|Ga0181526_11093101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4501Open in IMG/M
3300014494|Ga0182017_10512715All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4734Open in IMG/M
3300014494|Ga0182017_10834891All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300014496|Ga0182011_10185714All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41420Open in IMG/M
3300014496|Ga0182011_10374308All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4933Open in IMG/M
3300014496|Ga0182011_10789100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4595Open in IMG/M
3300014502|Ga0182021_13750319All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4504Open in IMG/M
3300014638|Ga0181536_10198258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41002Open in IMG/M
3300017931|Ga0187877_1383583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4531Open in IMG/M
3300017932|Ga0187814_10277562Not Available638Open in IMG/M
3300017942|Ga0187808_10541566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4541Open in IMG/M
3300017946|Ga0187879_10684159All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300017948|Ga0187847_10883964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4508Open in IMG/M
3300018002|Ga0187868_1029492All Organisms → cellular organisms → Bacteria2526Open in IMG/M
3300018009|Ga0187884_10247092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4727Open in IMG/M
3300018022|Ga0187864_10039622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42719Open in IMG/M
3300018033|Ga0187867_10486731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076679Open in IMG/M
3300018038|Ga0187855_10637354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4621Open in IMG/M
3300018042|Ga0187871_10156092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41288Open in IMG/M
3300018043|Ga0187887_10101978All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300018043|Ga0187887_10304716All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4941Open in IMG/M
3300018046|Ga0187851_10624955All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300018046|Ga0187851_10847653All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4514Open in IMG/M
3300019082|Ga0187852_1424442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4517Open in IMG/M
3300019788|Ga0182028_1040026All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4549Open in IMG/M
3300019788|Ga0182028_1040741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41431Open in IMG/M
3300019788|Ga0182028_1359963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41240Open in IMG/M
3300020580|Ga0210403_11041174All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4639Open in IMG/M
3300020581|Ga0210399_10148379All Organisms → cellular organisms → Bacteria1939Open in IMG/M
3300021181|Ga0210388_10821753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4804Open in IMG/M
3300021432|Ga0210384_10199361All Organisms → cellular organisms → Bacteria1799Open in IMG/M
3300021861|Ga0213853_10763428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4570Open in IMG/M
3300023088|Ga0224555_1202157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4544Open in IMG/M
3300023101|Ga0224557_1244128All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300025500|Ga0208686_1051945All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4955Open in IMG/M
3300025576|Ga0208820_1029007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41701Open in IMG/M
3300025924|Ga0207694_11872714All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300025925|Ga0207650_11917751All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300025927|Ga0207687_11561373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4567Open in IMG/M
3300027497|Ga0208199_1079895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4683Open in IMG/M
3300027787|Ga0209074_10147900All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4843Open in IMG/M
3300027825|Ga0209039_10000290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales48718Open in IMG/M
3300027853|Ga0209274_10090641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41498Open in IMG/M
3300027854|Ga0209517_10242384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41084Open in IMG/M
3300027911|Ga0209698_11359832All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300027986|Ga0209168_10101368Not Available1485Open in IMG/M
3300028860|Ga0302199_1252133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4531Open in IMG/M
3300028873|Ga0302197_10536139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4508Open in IMG/M
3300029817|Ga0247275_1055166All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41116Open in IMG/M
3300029910|Ga0311369_11015112All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300029943|Ga0311340_10746721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4832Open in IMG/M
3300029951|Ga0311371_11240349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4857Open in IMG/M
3300030057|Ga0302176_10035286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41904Open in IMG/M
3300030399|Ga0311353_10242894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41672Open in IMG/M
3300030494|Ga0310037_10486120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4502Open in IMG/M
3300030706|Ga0310039_10379759All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4523Open in IMG/M
3300030805|Ga0265756_107477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4667Open in IMG/M
3300031241|Ga0265325_10153324All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41088Open in IMG/M
3300031241|Ga0265325_10262544All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4779Open in IMG/M
3300031344|Ga0265316_10876960All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300031525|Ga0302326_10551117All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41730Open in IMG/M
3300031726|Ga0302321_102986676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4552Open in IMG/M
3300031754|Ga0307475_11353989All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300032160|Ga0311301_11642812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4778Open in IMG/M
3300032160|Ga0311301_11706221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4758Open in IMG/M
3300032160|Ga0311301_12168681Not Available639Open in IMG/M
3300032515|Ga0348332_14167442All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300033402|Ga0326728_10095134All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA43654Open in IMG/M
3300033408|Ga0316605_10071813All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42556Open in IMG/M
3300033414|Ga0316619_11256246All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300033416|Ga0316622_100815187All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA41085Open in IMG/M
3300033486|Ga0316624_10603024All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4955Open in IMG/M
3300033513|Ga0316628_103314286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4584Open in IMG/M
3300033983|Ga0371488_0069799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA42061Open in IMG/M
3300034091|Ga0326724_0576127All Organisms → cellular organisms → Bacteria564Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil12.61%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland11.76%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen7.56%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.04%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.20%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.52%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.52%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.52%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.68%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.68%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.68%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.68%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.84%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.84%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.84%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.84%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.84%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.84%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003674Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004140Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004617Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005947Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011052Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028860Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3EnvironmentalOpen in IMG/M
3300028873Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_1EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030805Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20214J51650_1083756123300003541WetlandSSSQSRRDEXLLKDLGVVQFITKPSGLDQFMEIGKTIKDLLARPGTG*
Ga0006876_10081343300003674Peatlands SoilVWSSSESRRDRTRIMDLGVTQFVTKPAGLDQFLEIGKIIKDLLAGHTST*
Ga0006876_10081423300003674Peatlands SoilLVCVWSSSESRRDRTRIMDLGVTQFVTKPAGLDQFLEIGKIIKDLLAGHTST*
Ga0058894_100983513300004140Forest SoilPVCVWSSSRSRRDEALLKDLGVSQFITKPSGLDQFMQIGKIIKDLLTDPRAGRRRLAARRATL*
Ga0068955_118575423300004617Peatlands SoilVCVWSSSESRRDRTRIMDLGVTQFVTKPAGLDQFLEIGKIIKDLLAGHTST*
Ga0070658_1007761213300005327Corn RhizosphereKHLAGVPVCAWSSSQSSRDRSMLEELGVSQFITKPAGLDQFLAIGKLIKDLLTDPIAA*
Ga0070674_10095590523300005356Miscanthus RhizospherePVCVWSSSRSRQDEAMFKDLGVSRFITKPAGLDQFMEIGKTIKDLLAAPRPA*
Ga0070713_10145046623300005436Corn, Switchgrass And Miscanthus RhizosphereASHLGGIPVCVWSSSHSRRDEVLLNSLGVSKFITKPSGLDQFMKIGKIIADLLAVSGSH*
Ga0070735_1017746923300005534Surface SoilRNAGLFAGVPVCVWSSSRSRRDEALLKELGVSRFIPKPSGLSQFMEIGKILKDVLAVAKAS*
Ga0070684_10200078113300005535Corn RhizosphereHLAGVPVCVWSSSRSRRDEALLKDMGVSQFITKPSGLDQFMEIGKTIKDLLAGSTAA*
Ga0070732_1012541613300005542Surface SoilWSSSESRRDRARIMDLGVSQFVTKPAGLDQFLEIGKLIMDLLAGHATT*
Ga0068855_10214933723300005563Corn RhizosphereIRVAKHLAGIPVCAWSSSQSMSDRSSLAELGVSQVITKPAGLDQFLAIGRLIKDLLTGSGAA*
Ga0070761_1061821813300005591SoilRAAKRLASVPVCVWSSSESRRDQSLLKSLGVSQFITKPSGLDQFMEIGKIIKDLLAGVPAR*
Ga0066794_1004556423300005947SoilSASHLGGVPVCVWSSSRSRRDEALLKELGVTQFITKPSGLDQFMEIGKTIKDLLAASTPD
Ga0068871_10090703613300006358Miscanthus RhizosphereGVPVCVWSSSRSRQDAAIIVQLGVSRFIPKPTGLEQFMEIGKILKELLAVPRAA*
Ga0075425_10117949333300006854Populus RhizosphereSLICAWSSSQSRRDRTRLMDLGVAQFVNKPTGLDQFLEIGKLIKDLLAGVHSNCCGTA*
Ga0075434_10079584833300006871Populus RhizosphereGSATHLAGVPVCVWSSSQSRRDQALLTDLGVARFVTKPSGLDQFMEIGKIIKDLLAGHTDS*
Ga0079219_1127349623300006954Agricultural SoilPVCAWSSSQSRRDEAMLRDLGVTRFITKPAGLDQFMEIGKIIKDLLVSSSAG*
Ga0105247_1082878123300009101Switchgrass RhizosphereDVPVCVWSSSRSLRDESALKDLGVSQFIPKPSGLEQFMAIGQTIKGLLAAAILAPGGPAHA*
Ga0105243_1226530823300009148Miscanthus RhizosphereGVPVCAWSSSQSLRDKDLLQELGIERFITKPSGLRQFLQIGSIIKDVLAASSPAR*
Ga0105104_1022162123300009168Freshwater SedimentGVPVCAWSSSQSRRDRSWLEDLGVSQFITKPSGLDQFMEIGKVIKDLLASPGAG*
Ga0116214_124284223300009520Peatlands SoilSHLNGVPVCVWSSSRSRKDEALLKELGVTRFITKPSGLGQFMEIGRTIKDLFAGHGGG*
Ga0116222_144464023300009521Peatlands SoilAHLAGVPVCVWRSSRSWRDEALLKDLGVCRFITKPSGLDPFMEIGKIIKDLIAIPGAD*
Ga0116137_102270243300009549PeatlandIRSATHLGGVPVCVWSSSRSRRDETLLKELGVSLFITKPSGLDQFMEIGKTIKDLLGV*
Ga0116133_116756213300009623PeatlandPVCVWSSSQSRRDKSLLKDLGVSQFITKPSGLDQFMEIGKTIKDLLAGAATC*
Ga0105856_102475123300009662Permafrost SoilVCVWSSSQSRRDQALLADLGVARFITKPSGLDQFMEIGKIIKDLVS*
Ga0116223_1049059423300009839Peatlands SoilVPVCVWSSSQSPRAAALLKDIGVRQFIAKPSGLDQFMEIGKILKDLLAAPKAR*
Ga0074045_1082258823300010341Bog Forest SoilGLNGVPVCVWSSSQSRRDEALLKGLAVSEFIAKPAGLDQFMEIGKTIKDLLASHRAG*
Ga0134128_1142342413300010373Terrestrial SoilLGGIPVCVWSSSHTRRDEALLNNLGVSKFITKPSGLDQFMKIGKIIADLLAVSGSR*
Ga0136449_10468544713300010379Peatlands SoilWSSSRSPRDQSVLVDLGVVRFVTKPCGLDQFMEIGVIIEDLLSGRKAGWTAIT*
Ga0138585_14453623300011052Peatlands SoilSESRRDRTRIMDLGVTQFVTKPAGLDQFLEIGKIIKDLLAGHTST*
Ga0150983_1564536713300011120Forest SoilGVPVCVWSSSRSRRDEAVLKDLGVAQFITKPAGLDQFMEIGKTIKDVLAGSMAA*
Ga0164301_1131902113300012960SoilVPVCVWSSSQSRRDEALLKEIGISRFINKPAGLDQFMEIGKIIKDLLAGSEAP*
Ga0164305_1153905923300012989SoilAAVPVCVWSSSQSLGDEGMLKKFGVARFITKPTGLNQFMEIGKIIKDVVTGAGPA*
Ga0157370_1168424313300013104Corn RhizosphereEIRVAKHLAGIPVCAWSSSQSMSDRSSLAELGVSQVITKPAGLDQFLAIGRLIKDLLTGSGAA*
Ga0157374_1156596123300013296Miscanthus RhizospherePVCVWSSSRSLRDEALLKEVGVSQFITKPSGLDHFMEIGSILKGVLAGPHGR*
Ga0157378_1223243923300013297Miscanthus RhizosphereKARHLDGVPVCVWSSSRSRQDEAMFKDLGVSRFITKPAGLVQFMEIGKTIKDLLAAPRPA
Ga0157378_1274106923300013297Miscanthus RhizosphereAGIPVCVWSSSRSRRDEALLKEIGISQFINKPAGLDQFMEIGKIIRDLLAGSESP*
Ga0181529_1018676513300014161BogRSAGYLAGVPVCVWSSSQSRRDEALLKDLGVSQFITKPSGLDQFMEIGKAIKDLLPDHGPA*
Ga0181529_1047819923300014161BogCVWSSSRSRRDEALLEDLGVAQFITKPAGLDQFMEIGKILRDLLASASAG*
Ga0181532_1061014313300014164BogATHLGGVPVCVWSSSRSPRDEAVLKDLGVCQFITKPSGLDQFMEIGKTLKDLLAAPRAG*
Ga0181534_1081936523300014168BogVCVWSSSQSRRDGALLKDLGVSRFITKPSGLDQFMQIGKTIKDLLASAKAG*
Ga0181526_1019968223300014200BogLAGVPVCVWSSSQSRRDEALLKDLGVSQFITKPSGLDQFMEIGKAIKDLLPDHGPA*
Ga0181526_1100367623300014200BogAGIPMYLWSSSQSRRDKSLLKDLGVAQFIAKPSGPDQFMAIGKTIKDLPADSRAG*
Ga0181526_1109310113300014200BogPVCVWSSSRSRRDEALLKDLGVAQFITKPSGLDQFMEIGKIVTDLLARAGTATRQG*
Ga0182017_1051271513300014494FenVPVCVWSSSQSRRDKSLLHDLGVSHFITKPSGLDQFMEIGKTIKDLLRGAGR*
Ga0182017_1083489113300014494FenEIQHAKHLAGVPVCAWSSSQSGRDQKLLTELGVVRFITKPSGLDQFMEIGKILKDLLA*
Ga0182011_1018571413300014496FenLGGVPVCVWSSSRSRRDEALLKELGVRQFITKPSGLDQFMEIGKTLKDLLAGAKAG*
Ga0182011_1037430813300014496FenLGGVPVCVWSSSRSRRDEALLKELGVRQFITKPSGLDQFMEIGKILKDLLAGAKGG*
Ga0182011_1078910023300014496FenSSSRSPRDEAMLRDLGVTQFITKPAGLDQFMEIGRTIKDLLAGSKA*
Ga0182021_1375031913300014502FenVWSSSRSRRDEALLKELGVSQFITKPSGLDQFMEIGKIIKDLLAGPVAE*
Ga0181536_1019825823300014638BogGVPVCVWSSSQSRRDEARLKNLGVSQFITKPTGLNQFMEIGRILKDVLAGPESGCGEPIQV*
Ga0187877_138358313300017931PeatlandIRSATHLGGVPVCVWSSSRSRRDETLLKELGVSLFITKPSGLDQFMEIGKTIKDLLAGASAG
Ga0187814_1027756223300017932Freshwater SedimentARALVCVWSSSQFRRDRTRLMDLGVAQFVTKPVGLDQFLEIGKLIKDLLAGHAAA
Ga0187808_1054156613300017942Freshwater SedimentVWSSSHSRRDEALLKDLGVTQFITKPSGLGQFMEIGKIIKGLLASRGAG
Ga0187879_1068415913300017946PeatlandVPVCVWSSSRSRRDEDLLKDLGVSRFITKPAGLDQFMEIGKSIKELLAVSGGD
Ga0187847_1088396413300017948PeatlandSAGHLAGIPVCVWSSSRSRRDEALLKDLGVAQFITKPSGLDQFMEIGKIVTDLLARAGTATRQG
Ga0187868_102949213300018002PeatlandGGVPVCVWSSSRSPRDEAVLKDLGVCQFITKPSGLHQFMEIGKTLKDLLAAPRAG
Ga0187884_1024709223300018009PeatlandVCVWSSSRSRRDEALLKDLGVAQFITKPSGLDQFMEIGKIVTDLLARAGTATRQG
Ga0187864_1003962223300018022PeatlandLGGVPVCVWSSSRSPRDEALLKDLGVRQFITKPSGLDQFMEIGKILKDLLAAPKAT
Ga0187867_1048673123300018033PeatlandGVPVCVWSSSRSPRDEAVLKDLGIRQFITKPAGLDQFMDIGRILKDLLVAPRAG
Ga0187855_1063735413300018038PeatlandGVPVCVWSSSRSRRDESMLKELGVSRFIPKPSGLDQFMEIGKRIKDVLASHRAG
Ga0187871_1015609213300018042PeatlandHLAGIPVCVWSSSRSRRDESLLKDLGVSQFIPKPSGLNQFMEIGKIIKDLLAVAKTG
Ga0187887_1010197813300018043PeatlandWSSSRSRRDEALLKGLGVSQFITKPCGLDQFMEIGIIIKDLLAGPRESQSRLRR
Ga0187887_1030471623300018043PeatlandVPVCVWSSSRSRRDESLLKDLGVSQFIPKPSGLDQFMAIGKIIKDLLESPRAA
Ga0187851_1062495523300018046PeatlandCVWSSSQSRRDQALLMDLGVARFVTKPSGLDQFMEIGVTIKEMLAA
Ga0187851_1084765323300018046PeatlandGVPVCVWSSSRSRRDESLLKSLGVSQFIPKPSGLDQFMEIGKIIKELLPGAKAA
Ga0187852_142444223300019082PeatlandCVWSSSRSRRDEALLKQLGVSQFITKPSGLDQFMDIGRILKDALAQCNQ
Ga0182028_104002613300019788FenVRMEFSSRSRRDETLLKELGVSLFITKPSGLDQFMEIGKTIKDLLAGASAG
Ga0182028_104074113300019788FenAAKHLTGIPVCVWSSSQSRRDKSLLNDLGVSQFITKPSGLDQFMEIGKTIKDLLAGPRAG
Ga0182028_135996313300019788FenVCVWSSSRSRRDETLLKELGVSLFITKPSGLDQFMEIGKTIKDLLAGASAG
Ga0210403_1104117423300020580SoilSSSRSRRDEALLKDLGVAQFITKPSGLGKFMEIGKTIKDLLTGPIGR
Ga0210399_1014837943300020581SoilQHFAKALVCAWSSSQSRRDRTRLTDLGVAHFVTKPAGLDQFLAIGTIIKDLLARHKAA
Ga0210388_1082175323300021181SoilRDQSLLKSLGVSQFITKPSGLDQFMEIGKIIKDLLTSAPAGRGRLRAPSSFSAPG
Ga0210384_1019936143300021432SoilSSQSRRDRTRLTDLGVAHFVTKPAGLDQFLAIGTIIKDLLARHKAA
Ga0213853_1076342813300021861WatershedsIRGARHLIGVPVCAWSSSQSMKDRTMLEDLGVSQFITKPSGLDQFMQIGKTIKDLLASPGTV
Ga0224555_120215713300023088SoilNYLAGVPVCVWSSSQSRHDEALLKDLGVSQFITKPSGLDQFMEIGKVIKDLLPSHGAA
Ga0224557_124412823300023101SoilQHLAGIPVCVWSSSQSRRDKALLKDLGVSQFITKPSGLDQFMEIGKTIKDLLAG
Ga0208686_105194523300025500PeatlandGVPVCVWSSSRSRRDETLLKELGVSLFITKPSGLDQFMEIGKTIKDLLAGPRAG
Ga0208820_102900723300025576PeatlandHLGGVPVCVWSSSRSGRDEALLRELGVLKFITKPAGLDQFMEIGKTIKDLLATPKAG
Ga0207694_1187271413300025924Corn RhizosphereEIHNANHLAGVPVCVWSSSRSRRDEALLKDMGVSQFITKPSGLDQFMEIGKTIKDLLAGSTAA
Ga0207650_1191775113300025925Switchgrass RhizosphereIRNTPYLTGIPVCVWSSSRSRQDAAIIEQLGVSRFIPKPTGLAQFMEIGKILKDLLAVPRAA
Ga0207687_1156137313300025927Miscanthus RhizosphereHLDGIPVCVWSSSRSRQDETMLRDLGVSRFITKPAGLEQFMEIGKTIKDLLVAPRAA
Ga0208199_107989523300027497Peatlands SoilCASHLNGVPVCVWSSSRSRKDEALLKELGVTRFITKPSGLGQFMEIGRTIKDLFAGHGGG
Ga0209074_1014790023300027787Agricultural SoilVCVWSSSRSRRDEALLKDLGVSQFITKPSGLDQFMKIGKIIADLLAVSGSH
Ga0209039_10000290473300027825Bog Forest SoilWSSSRSRRDEALLQDLGVAQFITKPSGLDQFMEIGKIIKDLLVTPRAG
Ga0209274_1009064113300027853SoilVPVCVWSSSRSRRDEALLKGLGVSRFITKPAGLDQFMEIGKIVKDLLAGSAAEAG
Ga0209517_1024238423300027854Peatlands SoilLGGVPVCVWSSSRSRRDEALLKDLGVCQFITKPSGLDEFMQIGKVIKDLIASHRAN
Ga0209698_1135983233300027911WatershedsIPICVWSSSQSKRDEALLKNLGVCQFINKPSGLDQFMEIGKTIKDLLVGPRTA
Ga0209168_1010136833300027986Surface SoilWSSSESRRDRARIMDLGVSQFVTKPAGLDQFLEIGKLIMDLLAGHATT
Ga0302199_125213313300028860BogAERFAGVPVCAWSSSQSRRDQALLAELGVARFISKPSGLDQFMEIGAILKGILAGPAAA
Ga0302197_1053613913300028873BogSAERFAGVPVCAWSSSQSRRDQALLAELGVARFISKPSGLDQFMEIGAILKGILAGPAAA
Ga0247275_105516613300029817SoilSASHLGDVSVCVWSSSRSRRDEALLKDLGVVRFITKPSGLDQFMEIGKTIKDLLTAPSPG
Ga0311369_1101511213300029910PalsaVCVWSSSRSRRDEALLKELGVSLFINKPSGVNQFMEIGKMIKDLLAGAAARMTPVREW
Ga0311340_1074672113300029943PalsaGARHLSGIPVCAWSSSQSQQDQALLMELGVARFVTKPLGLDQFMEIGKIIKDLLAGHMDG
Ga0311371_1124034913300029951PalsaGVPVCVWSSSRSRRDDALLKDLGVSQFITKPSGLDQFMEIGKIIKDLLAGPRAG
Ga0302176_1003528663300030057PalsaVWSSSRSRRDDALLKDLGVSQFITKPSGLDQFMEIGKIIKDLLAGPRAG
Ga0311353_1024289413300030399PalsaSRRDEALLKELGVSLFINKPSGVNQFMEIGKMIKDLLAGAAARMTPVREW
Ga0310037_1048612013300030494Peatlands SoilPVCVWSSSRSRRDEALLKDLGVSKFITKPSGLDQFMDIGKTIKDLLAGNGAG
Ga0310039_1037975913300030706Peatlands SoilVCAWSSSQSPRDHSLLMDLGVARFVTKPSGLDQFMEIGLIIKDLLAGPSAG
Ga0265756_10747723300030805SoilVPVCVWSSSQSRKDEAVLKNLGVSQFITKPSGLDQFMEIGRTIKDLLAAPRAAVTGLFST
Ga0265325_1015332423300031241RhizospherePVCVWSSSQSRRDEALLKDLGVTQFITKPSGLDQFMAIGKIIKDLLTGATAG
Ga0265325_1026254423300031241RhizosphereLANVPVCVWSSSRSRRDESLLKELGVSQFIPKPSGLSQFMAIGKTIRDVLVASRAA
Ga0265316_1087696013300031344RhizosphereKHLTGIPVCVWSSSQSRRDKSLLNDLGVSQFITKPSGLDQFMEIGKTIKDLLGM
Ga0302326_1055111723300031525PalsaHLRDVPVCVWSSSDSRRDEALLKELGISQFITKPAGLDQFMEIGTIIKDLLAA
Ga0302321_10298667613300031726FenRSAPHLGGVPVCVWSSSRSGRDEALLKSLGVSLFITKPAGLDQFMEIGKTLKDLLAAPGT
Ga0307475_1135398913300031754Hardwood Forest SoilHLAGILLCAWSSSQSGRDRARLVDLGVTRFVTKPAGLDQFMEIGKLIKDLLAGYRAAGRQSP
Ga0311301_1164281213300032160Peatlands SoilSATHLGGIPVCVWSSSRSGRDEALLKGLGVTQFITKPAGLNQFMEIGKTIKDLLRSSSPG
Ga0311301_1170622113300032160Peatlands SoilWSSSRSRRDESLLKDLGVSQFIPKPSGLDQFMGIGKIIKDLLVCAEAG
Ga0311301_1216868113300032160Peatlands SoilIVVCAWSSSQSPRDRTRLMDLGVAQFVTKPAGLDQFLEIGKLIKDLLSGAAA
Ga0348332_1416744213300032515Plant LitterAMVCVWSSSESRRDRARIMDLGVAQFVTKPAGLDQFLEIGKLIKDLLAGHMTA
Ga0326728_1009513423300033402Peat SoilVCVWSSSQSRRDKSLLKDLGVSQFITKPSGLDRFMEIGKTIKDLLPRPSAG
Ga0316605_1007181323300033408SoilNTKHLAGVPVCAWSSSQSRRDRELLAELGVVRFITKPSRLDQFMEIGKILTDLLA
Ga0316619_1125624623300033414SoilCAWSSSQSRRDRDLFKELGVVRFITKPSGLDQFMEIGKILKDLLE
Ga0316622_10081518713300033416SoilSSSQSRRDEALLKDLGVSQFITKPSGLDQFMEIGKIIKDLLTGPSAG
Ga0316624_1060302413300033486SoilHLGGVPVCVWSSSRSKRDEAVLKDLGISQFITKPSGLDQFMEIGKVIKDLLAATRAG
Ga0316628_10331428623300033513SoilCVWSSSQAWRDRSLLKDLGVARFITKPTGLDQFMEIGIIIKELLARPEAG
Ga0371488_0069799_1884_20333300033983Peat SoilVWSSSRSGRDGALLKELGVLKFITKPAGLDQFMEIGKTLKDLLADANTA
Ga0326724_0576127_1_1563300034091Peat SoilLCAWSSSQSRRDAASLKALGVCRFITKPTGLDKFIEVGVIIKDLLACAGGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.