NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074667

Metagenome Family F074667

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074667
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 48 residues
Representative Sequence MKAFLVAFGVGIVLAGATGAQAYHRFWANCNYDAPTFMTTMTRDAGQDY
Number of Associated Samples 103
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 90.76 %
% of genes from short scaffolds (< 2000 bps) 91.60 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(31.092 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(59.664 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 40.26%    β-sheet: 0.00%    Coil/Unstructured: 59.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF03979Sigma70_r1_1 4.20
PF04542Sigma70_r2 3.36
PF00239Resolvase 2.52
PF04545Sigma70_r4 1.68
PF02410RsfS 0.84
PF13231PMT_2 0.84
PF13413HTH_25 0.84
PF03176MMPL 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 7.56
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 3.36
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 3.36
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 3.36
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 2.52
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 2.52
COG0799Ribosomal silencing factor RsfS, regulates association of 30S and 50S subunitsTranslation, ribosomal structure and biogenesis [J] 0.84
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.84
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_103340786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria889Open in IMG/M
3300000956|JGI10216J12902_107340816All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria581Open in IMG/M
3300000956|JGI10216J12902_109781203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300000956|JGI10216J12902_110102485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300000956|JGI10216J12902_110745587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300001536|A1565W1_10734378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1095Open in IMG/M
3300001537|A2065W1_10562762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300001537|A2065W1_10601880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300004114|Ga0062593_102498501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300004480|Ga0062592_101135576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300004643|Ga0062591_102609560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300004643|Ga0062591_102790639All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300005163|Ga0066823_10151267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria514Open in IMG/M
3300005175|Ga0066673_10382730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300005176|Ga0066679_11002304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300005181|Ga0066678_10137777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1516Open in IMG/M
3300005187|Ga0066675_10629463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300005187|Ga0066675_11125727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria585Open in IMG/M
3300005343|Ga0070687_100296525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300005353|Ga0070669_101578252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300005438|Ga0070701_10519316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300005454|Ga0066687_10385168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300005455|Ga0070663_100016062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4850Open in IMG/M
3300005456|Ga0070678_100374473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1230Open in IMG/M
3300005468|Ga0070707_100001728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria21048Open in IMG/M
3300005471|Ga0070698_100170949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2114Open in IMG/M
3300005536|Ga0070697_101624739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300005552|Ga0066701_10237783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1125Open in IMG/M
3300005563|Ga0068855_102543286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria509Open in IMG/M
3300005598|Ga0066706_11248156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005598|Ga0066706_11342409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300005614|Ga0068856_100594649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1127Open in IMG/M
3300005713|Ga0066905_101174173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria685Open in IMG/M
3300006794|Ga0066658_10570518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300006845|Ga0075421_102731285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300009012|Ga0066710_102293495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300009090|Ga0099827_11230926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300009137|Ga0066709_100236138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2434Open in IMG/M
3300009137|Ga0066709_100421483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1858Open in IMG/M
3300009137|Ga0066709_100778064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1384Open in IMG/M
3300009156|Ga0111538_11385743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300009551|Ga0105238_11985988All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300010039|Ga0126309_10501116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300010047|Ga0126382_11890546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300010301|Ga0134070_10361042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300010336|Ga0134071_10042170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2041Open in IMG/M
3300010373|Ga0134128_10430338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1473Open in IMG/M
3300012008|Ga0120174_1039455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1360Open in IMG/M
3300012014|Ga0120159_1034776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1703Open in IMG/M
3300012189|Ga0137388_11996882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria508Open in IMG/M
3300012199|Ga0137383_10189430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1507Open in IMG/M
3300012200|Ga0137382_10040131All Organisms → cellular organisms → Bacteria2867Open in IMG/M
3300012201|Ga0137365_10920138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria637Open in IMG/M
3300012206|Ga0137380_11346612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300012207|Ga0137381_11589715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria545Open in IMG/M
3300012208|Ga0137376_11621308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300012356|Ga0137371_10918230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300012358|Ga0137368_10100637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2243Open in IMG/M
3300012358|Ga0137368_10476446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium808Open in IMG/M
3300012358|Ga0137368_10491262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300012941|Ga0162652_100025808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria852Open in IMG/M
3300012948|Ga0126375_10283536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1140Open in IMG/M
3300012957|Ga0164303_10334868All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria908Open in IMG/M
3300012958|Ga0164299_10158331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300012961|Ga0164302_11323934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria583Open in IMG/M
3300012972|Ga0134077_10221477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria776Open in IMG/M
3300012984|Ga0164309_10092382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1888Open in IMG/M
3300012986|Ga0164304_10143192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1495Open in IMG/M
3300012988|Ga0164306_10203449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1391Open in IMG/M
3300013501|Ga0120154_1084187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300013772|Ga0120158_10255773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria873Open in IMG/M
3300014150|Ga0134081_10305879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300014326|Ga0157380_10087597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2560Open in IMG/M
3300014745|Ga0157377_10535660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria825Open in IMG/M
3300014968|Ga0157379_12431725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria523Open in IMG/M
3300015264|Ga0137403_10764366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300015265|Ga0182005_1259814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300018027|Ga0184605_10425128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300018071|Ga0184618_10142347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300018433|Ga0066667_11973650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300018482|Ga0066669_10861981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300018482|Ga0066669_12271582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300019873|Ga0193700_1012350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1386Open in IMG/M
3300019875|Ga0193701_1011901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1733Open in IMG/M
3300019879|Ga0193723_1118547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300020002|Ga0193730_1182684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria527Open in IMG/M
3300020018|Ga0193721_1132930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300021078|Ga0210381_10047492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1275Open in IMG/M
3300021078|Ga0210381_10159261All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria770Open in IMG/M
3300025900|Ga0207710_10621373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300025905|Ga0207685_10182529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300025910|Ga0207684_10636210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria909Open in IMG/M
3300025922|Ga0207646_10005679All Organisms → cellular organisms → Bacteria13084Open in IMG/M
3300025931|Ga0207644_10356442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1189Open in IMG/M
3300025961|Ga0207712_10697557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria886Open in IMG/M
3300026295|Ga0209234_1212900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria646Open in IMG/M
3300026326|Ga0209801_1258307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300026332|Ga0209803_1311478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300026335|Ga0209804_1205312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300026550|Ga0209474_10291871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300028381|Ga0268264_11132608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300028710|Ga0307322_10040443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1121Open in IMG/M
3300028714|Ga0307309_10055387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300028722|Ga0307319_10025090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1832Open in IMG/M
3300028768|Ga0307280_10019518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1937Open in IMG/M
3300028791|Ga0307290_10109032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300028791|Ga0307290_10242417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300028796|Ga0307287_10399110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria517Open in IMG/M
3300028814|Ga0307302_10424824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300028819|Ga0307296_10388902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria762Open in IMG/M
3300028824|Ga0307310_10192781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
3300028824|Ga0307310_10519288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria601Open in IMG/M
3300028828|Ga0307312_10031238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3104Open in IMG/M
3300028875|Ga0307289_10467095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300028878|Ga0307278_10519660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300028881|Ga0307277_10063459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1522Open in IMG/M
3300028884|Ga0307308_10575445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300028885|Ga0307304_10461736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300031939|Ga0308174_11119294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil15.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.72%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost5.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.36%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.84%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001536Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300012008Permafrost microbial communities from Nunavut, Canada - A39_80cm_12MEnvironmentalOpen in IMG/M
3300012014Permafrost microbial communities from Nunavut, Canada - A10_80cm_6MEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012941Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300013772Permafrost microbial communities from Nunavut, Canada - A10_80_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10334078623300000956SoilMRAFIAMLGIGLTLSAVGGAQAYHRFWVNCNYDAPTFMTTMTRD
JGI10216J12902_10734081613300000956SoilMLVAGFALSGVNGAQAYHRFWANCNSDAPTFMTTMTRDAAQDYAN
JGI10216J12902_10978120313300000956SoilVKTFIFALAAGLLLTATTGAQAYHRFWANCNYDAPTFMTTMTRD
JGI10216J12902_11010248513300000956SoilMKTFLVAFGVGVVLAGATGAQAYHRFWAGCNYDAPTFMTTMTRDAGQDYSNAAR
JGI10216J12902_11074558723300000956SoilMKAFLVAFGIGLVLAGATGAHAYHRFWAGCNYDAPTFMTTMTRDAGQDYSNAARYEGY
A1565W1_1073437823300001536PermafrostMKAFLVAFGVGVVLAGATGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYANEDFGFEG*
A2065W1_1056276213300001537PermafrostMKAFLVAFGVGIVLAGATGAQAYHRFWANCNYDAPTFMTT
A2065W1_1060188013300001537PermafrostMKAFLVAFGVGVVLAGATGAQAYHRFWTNCNYDAPTFMT
Ga0062593_10249850123300004114SoilMKAFLVTFGVAVVLAGATGAQAYHRFWAKCNYDAPTFMLTMTRDAAQDYANAARYEGY
Ga0062592_10113557623300004480SoilMRAFVAMLAAGFALSGVTGAQAYHRFWANCNTDPPTFMTTMSRDAAQDYAN
Ga0062591_10260956023300004643SoilMKAFLVAFGVAVVLAGATGAQAYHRFWAKCNYDAPTFMTTMTRDAAQDYAN
Ga0062591_10279063923300004643SoilMRAFIAMLVAGFALSGVTGAQAYHRFWATCNADAPTFVTTMTRDAGQDYANAARY
Ga0066823_1015126713300005163SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANAA
Ga0066673_1038273023300005175SoilMRALIVLFGIGLILSSATGAQAYHRFWVNCNYEAPTFMTTM
Ga0066679_1100230413300005176SoilMRGFFVLFGIGLILSSAAGAQAYHRFWVNCNYDAPTFMTTMT
Ga0066678_1013777723300005181SoilMKAFLAAFGVAIVLAGAAGAQAYHRFWANCNYDAPTFMTTMT
Ga0066675_1062946323300005187SoilMRALIVLFGIGLILSSATGAQAYHRFWVNCNYEAPTFMTTMT
Ga0066675_1112572723300005187SoilMRCIAVLFGIGLILSSATGAQAYHRFWASCNYDAATFMTT
Ga0070687_10029652513300005343Switchgrass RhizosphereMKIFLLSLVAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTM
Ga0070669_10157825213300005353Switchgrass RhizosphereMRIFLLALVAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYA
Ga0070701_1051931613300005438Corn, Switchgrass And Miscanthus RhizosphereMKAFLLSFALVFALTAASGAQAYHRFWARCNGDAPTFMTTMTRDA
Ga0066687_1038516813300005454SoilMRRILFLFGIGLIVSSAAGAQAYHRFWVNCNYDVPTFMTTMTRDAA
Ga0070663_10001606213300005455Corn RhizosphereMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQ
Ga0070678_10037447323300005456Miscanthus RhizosphereMKAFLVTFGVAVVLAGAASAQAYHRFWANCDYGAPTFMTTMTRDAAQSYANAARYEG
Ga0070707_100001728143300005468Corn, Switchgrass And Miscanthus RhizosphereMKAFLAAFGVAIVLAGAAGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYANEDFGFEG*
Ga0070698_10017094913300005471Corn, Switchgrass And Miscanthus RhizosphereMKAFLAAFGLAIVLAGAAGAQAYHRFWANCNYDAPTFMTTMT
Ga0070697_10162473913300005536Corn, Switchgrass And Miscanthus RhizosphereMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRD
Ga0066701_1023778313300005552SoilMKAFLMAFGVGLVLAAASGAQAYHRFWAGCNYDAPTFMTTMTRD
Ga0068855_10254328613300005563Corn RhizosphereMKPFISALVAGFALSGVSGAQAYHRFWAGCNADPPTFMTTMTRDAAQTY
Ga0066706_1124815613300005598SoilMRGFIAMLVAGFALSGVSGAQAYHRFWANCNFDAPTFMTTMTRD
Ga0066706_1134240913300005598SoilMRAFLWACGVGLVLAGATGAQAYHRFWASCNDNAPTFVTTMTRDAAQDYA
Ga0068856_10059464923300005614Corn RhizosphereMKIFLLALAAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQ
Ga0066905_10117417323300005713Tropical Forest SoilMKAFFCSLGLGLVLASANGAQANHRFWARCNYEAPTFTTSMTRDAAQDYANAA
Ga0066658_1057051813300006794SoilMRCIAVLFGIGLILSSATGAQAYHRFWASCNYDAPTFMTTMTRDG
Ga0075421_10273128513300006845Populus RhizosphereMKAFFCCLGLAWVLACATGAQANHRFWARCNYEAPTFTTSMTR
Ga0066710_10229349523300009012Grasslands SoilMKAFLLAFGLGLVLTGATGAQAYHRFWANCNYDAPTFMTTMT
Ga0099827_1123092613300009090Vadose Zone SoilMRVFLTACGIGVVLAMAAGAQAYHRFWANCNYDSPTFVLTLTRDAAQD
Ga0066709_10023613823300009137Grasslands SoilMKAFLMAFGVGLVLAAASGAQAYHRFWAGCNYDAPTFMTTMTRDAGQDYSNEDFGFEGVTMRP*
Ga0066709_10042148313300009137Grasslands SoilMKAFLIALGFGFVLAGTTGAQAYHRFWANCNYEAPTFMTTMTRDAAQDYANAAR
Ga0066709_10077806423300009137Grasslands SoilMKAFLVAFGIAVVLAGATGAQAYHRFWANCNYDAPTFMTTMTRDA
Ga0111538_1138574313300009156Populus RhizosphereMRAFVAMLAAGFALSGVTGAQAYHRFWANCNTDPPTFMTTMTRDAA
Ga0105238_1198598823300009551Corn RhizosphereMKAFLVTFGVAVVLAGAASAQAYHRFWANCDYGAPTFMTTMTRDAAQ
Ga0126309_1050111613300010039Serpentine SoilMMLALGLALSTTSGAQAYHRFWPSCNADDPTFMTTMTRDAAQDYANAARYDGYQWGG
Ga0126382_1189054623300010047Tropical Forest SoilMKAFFAMLAAGFALSGVTGAQAYHRFWANCNTDGATF
Ga0134070_1036104223300010301Grasslands SoilMKIFLVAFCSGLVLAGATGAQAYHRFWANCNYDAP
Ga0134071_1004217033300010336Grasslands SoilMKAFLVAFGIGVVLAGATGAQAYHRFWSNCNYDAPTFMTTMTRDA
Ga0134128_1043033813300010373Terrestrial SoilMRIFLLALVAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDA
Ga0120174_103945533300012008PermafrostMKAFLVAFGVGIVLAGATGAQAYHRFWANCNYDAPTFMTTMTRDAGQDY
Ga0120159_103477633300012014PermafrostMKAFLVAFGVGIVLAGATGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYANEDFGFEG*
Ga0137388_1199688223300012189Vadose Zone SoilMKAFLIAFGVATVLAGATGAQAYHRFWANCNYDAPTFMTTITRDAAQNYANAARY
Ga0137383_1018943023300012199Vadose Zone SoilMKMFLVAFCAGLVLTGATGAQAYHRFWANCNYDAPTFMTTMTRDAAQDY
Ga0137382_1004013113300012200Vadose Zone SoilMRTFVAMLVAGLALSGVTGAQAYHRFWANCNTDPPTFMTTM
Ga0137365_1092013833300012201Vadose Zone SoilMRRLILLFGLGVILSTAAGAQAYHRFWVNCNYDAATFMTTMTRDAAQDYANAA
Ga0137380_1134661223300012206Vadose Zone SoilMKAFLAAFGVGLVLAGATGAQAYHRFWAGCNYDAPTFMTTMTRDAAQNYAN
Ga0137381_1158971523300012207Vadose Zone SoilMKAFLVAFGIAVVLAGATGAQAYHRFWANCNYDAPTFMT
Ga0137376_1162130813300012208Vadose Zone SoilMKVFLVAFGIAVVLAGATGAQAYHRFWANCNYDAPTFMTTMT
Ga0137371_1091823023300012356Vadose Zone SoilMKMFLVAFGVGFVLAGANGAQAYHRFWANCNYDAPTFMTTMTRDAAQ
Ga0137368_1010063713300012358Vadose Zone SoilMKVFLVCVGLGLVLAAASGAQAYHRFWASCNYDAPTFMTTMTRDAVQDYANAARYE
Ga0137368_1047644613300012358Vadose Zone SoilMKVFLVCVGLGLVLASASGAQAYHRFWASCNYDAPTFMTTMTRDAVQDYANEDFGFEG*
Ga0137368_1049126223300012358Vadose Zone SoilMRRFIVMLAVGVAVSAATGAQAYHRFWANCNYDSSTFMTTMTRD
Ga0162652_10002580813300012941SoilMKIFLLTLGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANAARY
Ga0126375_1028353613300012948Tropical Forest SoilMRIFVATLVAGFALSGVNGAQAYHRFWANCNADDPTFMTTMTR
Ga0164303_1033486813300012957SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANAARYEG
Ga0164299_1015833123300012958SoilMKAFLVAFGVAVVLAGATGAQAYHRFWADSRYDAPTFMTTMTGDAARNYA
Ga0164302_1132393423300012961SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMT
Ga0134077_1022147713300012972Grasslands SoilMKTFLVALGAGLVLAGASGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYAN
Ga0164309_1009238213300012984SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNFDSPTFMTTMTRDAGQDYANAARY
Ga0164304_1014319213300012986SoilMRIFLLALGAGLVLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANA
Ga0164306_1020344913300012988SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPT
Ga0120154_108418723300013501PermafrostMKLFLVAFCTGLVLAGATGAQAYHRFWASCNYDSPTFMTTMTRDAAQDYANEDFGFEG*
Ga0120158_1025577323300013772PermafrostMKAFLVAFGVGVVLAGATGAQAYHRFWTNCNYDAP
Ga0134081_1030587923300014150Grasslands SoilMKAFLMAFGVGLVLAVASGAQAYHRFWAGCNYDAPTFMTTMTRDAGQD
Ga0157380_1008759713300014326Switchgrass RhizosphereMRIFLLALVAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTR
Ga0157377_1053566023300014745Miscanthus RhizosphereMKAFLVTFGVAVVLAGAASAQAYHRFWANCDYGAPTFMTTMTRDAAQSYANAARYEAERAAEAQ
Ga0157379_1243172513300014968Switchgrass RhizosphereMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQSY
Ga0137403_1076436623300015264Vadose Zone SoilMKMFLVAFGVGLVLAGANGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYAN
Ga0182005_125981413300015265RhizosphereMRSFVAMLVAGFALSGVNGAQAYHRFWANCNTDAPTFMT
Ga0184605_1042512823300018027Groundwater SedimentMKAFLVASCIGVVLAGATGAQAYHRFWARCNYDAPTFMTTMTRDAAQ
Ga0184618_1014234723300018071Groundwater SedimentMKMFLVAFGVGFVLAGATGAQAYHRFWANCNYDAPTFMTTMTR
Ga0066667_1197365013300018433Grasslands SoilMRAFVAMLVAGFALSGVTGAQAYHRFWANCNTDPPTFM
Ga0066669_1086198123300018482Grasslands SoilMKAFLAAFGVAIVLAGAAGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYANEDCRFEG
Ga0066669_1227158213300018482Grasslands SoilMKAFLVAFGIGLVLAAATGAQAYHRFWANCNYDAPTFMTTMTRDAGQDYSNEDFGFEG
Ga0193700_101235023300019873SoilMKPFLVAFGVAAVLAGATGAQAYHRFWANCNYDAPTFMTT
Ga0193701_101190113300019875SoilMKPFLAAFGVAVVLAGAAGAQAYHRFWANCNYDAP
Ga0193723_111854723300019879SoilMKMFLVAFGVGLVLAGANGAQAYHRFWANCNYDAPTFMTTM
Ga0193730_118268413300020002SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYESPTFMTTMTRDAGQSYANAAR
Ga0193721_113293023300020018SoilMKMFLVAFGVGFVLAGANGAQAYHRFWANCNYDAPTFM
Ga0210381_1004749223300021078Groundwater SedimentMKAFLIAFGVAVVLAGATGAQAYHRFWANCNYEAPTFMTTMTRDAAQDYAN
Ga0210381_1015926123300021078Groundwater SedimentMKAFLGAFGVAVVLAGATGAQAYHRFWANCNYDSPTFMTTMTRDAAQDYANAA
Ga0207710_1062137323300025900Switchgrass RhizosphereMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQSYANAARYEG
Ga0207685_1018252913300025905Corn, Switchgrass And Miscanthus RhizosphereMKIFLLALGAGLLLGGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQSYANEDFGF
Ga0207684_1063621013300025910Corn, Switchgrass And Miscanthus RhizosphereMRTFLVALGIGFVLIAATGAQAYHRFWARCNYDPPTFTT
Ga0207646_1000567933300025922Corn, Switchgrass And Miscanthus RhizosphereMKAFLAAFGVAIVLAGAAGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYANEDFGFEG
Ga0207644_1035644223300025931Switchgrass RhizosphereMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPMFMTTMTRDAGQSYANAARYEG
Ga0207712_1069755723300025961Switchgrass RhizosphereMRIFLLALVAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQSYANAARYE
Ga0209234_121290023300026295Grasslands SoilMKAFLMAFGVGLVLAAASGAQAYHRFWAGCNYDAPTFMTTMTRDAGQDYSN
Ga0209801_125830723300026326SoilMKAFLAAFGVAIVLAGAAGAQAYHRFWVNCNYDAPTFMTTMTRDAAQDYANAARYEG
Ga0209803_131147813300026332SoilMKAFLVAFGIAVLLAGATGAQAYHRFWANCNYDAPTFMTTMTRDAAQDYAN
Ga0209804_120531213300026335SoilMRRILFLFGIGLIVSSAAGAQAYHRFWVNCNYDVPTFMTTMTRDAAQGYANGARYEGYQ
Ga0209474_1029187123300026550SoilMKAFLLAFGVGLLLAGASGAQAYHRFWARCNYDAPTFMTTMTRDAG
Ga0268264_1113260823300028381Switchgrass RhizosphereMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQSYANAARYE
Ga0307322_1004044313300028710SoilMRRFIVMLGIGLALSATTGAQAYHRFWANCNDDAPTFMTTMTRDA
Ga0307309_1005538713300028714SoilMRRFIVMLGIGLALSATTGAQAYHRFWANCNDDASTF
Ga0307319_1002509013300028722SoilMKTFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANAAR
Ga0307280_1001951833300028768SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSP
Ga0307290_1010903213300028791SoilMKPFLVAFGVAAVLAGATGAQAYHRFWANCNYDAPTFMT
Ga0307290_1024241723300028791SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANEGFGFGR
Ga0307287_1039911013300028796SoilMKIFLLTLGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANAAR
Ga0307302_1042482413300028814SoilMRRFIVMLGIGLALSATTGAQAYHRFWANCNDDAPTFMTTITRDAAQDYANAARYEGYQW
Ga0307296_1038890223300028819SoilMKAFLVAFAVGVVLAGAAGAQAYHRFWANCNYDAPTFMTTMTRDA
Ga0307310_1019278123300028824SoilMRRFIVTLGIGLALSATSGAQAYHRFWAGCNYDAPTFMTTMTR
Ga0307310_1051928813300028824SoilMKAFLVAFAIGVVLAGATGAQAYHRFWSNCNYDAPTFMTTMTRDAAQDYANAA
Ga0307312_1003123813300028828SoilMKAFLVACGIGVVLAGATGAQAYHRFWARCNYDAPTFMTTMTRDAA
Ga0307289_1046709513300028875SoilMKIFLLTLGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRD
Ga0307278_1051966013300028878SoilMKRFIVMVGIGLALSATTGAQAYHRFWANCNDDAATFMTTMTRDAAQDYANEDFGFER
Ga0307277_1006345923300028881SoilMRRFIVMLGIGLALSATTGAQAYHRFWANCNDDASTFMTTMTRD
Ga0307308_1057544513300028884SoilMKIFLLALGAGLLLAGANGAQAYHRFWTNCNYDSPTFMTTMTRDAGQDYANEDFGF
Ga0307304_1046173613300028885SoilMRRFIVTLGIGLALSATSGAQAYHRFWAGCNYDAPTFMTM
Ga0308174_1111929423300031939SoilMRSFIALLVAGFALSGVPGAQAYHRFWAGCNYDPPTFMTTMTRDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.