Basic Information | |
---|---|
Family ID | F074661 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 43 residues |
Representative Sequence | LAFAAHAVSRCPRAKAVTFDAFSPSLTPDVLFRSVERIRAAL |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.68 % |
% of genes near scaffold ends (potentially truncated) | 97.48 % |
% of genes from short scaffolds (< 2000 bps) | 92.44 % |
Associated GOLD sequencing projects | 90 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.891 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.101 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.824 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF14067 | LssY_C | 10.92 |
PF03960 | ArsC | 3.36 |
PF05114 | DUF692 | 1.68 |
PF00005 | ABC_tran | 1.68 |
PF04069 | OpuAC | 0.84 |
PF07715 | Plug | 0.84 |
PF01799 | Fer2_2 | 0.84 |
PF05977 | MFS_3 | 0.84 |
PF12840 | HTH_20 | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 3.36 |
COG3220 | Uncharacterized conserved protein, UPF0276 family | Function unknown [S] | 1.68 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002243|C687J29039_10160451 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300002558|JGI25385J37094_10027573 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300002560|JGI25383J37093_10144647 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300002560|JGI25383J37093_10152623 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
3300002911|JGI25390J43892_10027857 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
3300002912|JGI25386J43895_10181839 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005171|Ga0066677_10330608 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 872 | Open in IMG/M |
3300005172|Ga0066683_10848465 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005181|Ga0066678_10562066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 758 | Open in IMG/M |
3300005181|Ga0066678_11046151 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005451|Ga0066681_10182448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1249 | Open in IMG/M |
3300005545|Ga0070695_100258642 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300005552|Ga0066701_10607979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 665 | Open in IMG/M |
3300005556|Ga0066707_10495726 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
3300005556|Ga0066707_10987761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
3300005559|Ga0066700_10527808 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300005560|Ga0066670_10139456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1405 | Open in IMG/M |
3300005561|Ga0066699_10487713 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 881 | Open in IMG/M |
3300005566|Ga0066693_10222973 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005568|Ga0066703_10153938 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300005574|Ga0066694_10005815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 5068 | Open in IMG/M |
3300005574|Ga0066694_10248302 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005576|Ga0066708_10873120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
3300005888|Ga0075289_1010225 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1253 | Open in IMG/M |
3300006794|Ga0066658_10895463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300006796|Ga0066665_10413955 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300006797|Ga0066659_10693566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 832 | Open in IMG/M |
3300006804|Ga0079221_11784729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
3300006806|Ga0079220_11890917 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300006854|Ga0075425_100772781 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1101 | Open in IMG/M |
3300006914|Ga0075436_100073812 | All Organisms → cellular organisms → Bacteria | 2361 | Open in IMG/M |
3300006914|Ga0075436_101416484 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300007004|Ga0079218_11755534 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300007255|Ga0099791_10142327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1118 | Open in IMG/M |
3300007255|Ga0099791_10622565 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300009137|Ga0066709_103690546 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300009137|Ga0066709_104291210 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
3300010046|Ga0126384_12107062 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010140|Ga0127456_1184253 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
3300010325|Ga0134064_10140797 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
3300010326|Ga0134065_10465777 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300010333|Ga0134080_10178990 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300010336|Ga0134071_10221049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 938 | Open in IMG/M |
3300010337|Ga0134062_10154861 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1021 | Open in IMG/M |
3300010337|Ga0134062_10396697 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
3300012199|Ga0137383_10554796 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300012199|Ga0137383_10692234 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300012200|Ga0137382_10903414 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 636 | Open in IMG/M |
3300012201|Ga0137365_10993158 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
3300012201|Ga0137365_11100969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 572 | Open in IMG/M |
3300012202|Ga0137363_11337432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 605 | Open in IMG/M |
3300012203|Ga0137399_10761813 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300012207|Ga0137381_11053944 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 700 | Open in IMG/M |
3300012208|Ga0137376_10356569 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1270 | Open in IMG/M |
3300012209|Ga0137379_10684619 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 931 | Open in IMG/M |
3300012209|Ga0137379_11004229 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 739 | Open in IMG/M |
3300012285|Ga0137370_11014486 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
3300012349|Ga0137387_10787332 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
3300012349|Ga0137387_10965223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 613 | Open in IMG/M |
3300012351|Ga0137386_11271273 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
3300012356|Ga0137371_10622542 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
3300012358|Ga0137368_10275006 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300012359|Ga0137385_10944245 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 712 | Open in IMG/M |
3300012361|Ga0137360_11690884 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
3300012410|Ga0134060_1189174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1071 | Open in IMG/M |
3300012685|Ga0137397_10951728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
3300012917|Ga0137395_11226203 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300012918|Ga0137396_10167170 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300012922|Ga0137394_11117315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 652 | Open in IMG/M |
3300012927|Ga0137416_11961282 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300014154|Ga0134075_10088653 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300014157|Ga0134078_10410409 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300017657|Ga0134074_1089593 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300017657|Ga0134074_1097803 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300017657|Ga0134074_1110130 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300018431|Ga0066655_10349988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 969 | Open in IMG/M |
3300018468|Ga0066662_10350387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1270 | Open in IMG/M |
3300018468|Ga0066662_12234924 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300018468|Ga0066662_12419166 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300021178|Ga0210408_10725418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 782 | Open in IMG/M |
3300024219|Ga0247665_1029573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 712 | Open in IMG/M |
3300024323|Ga0247666_1060187 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
3300025319|Ga0209520_10461707 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300026277|Ga0209350_1127224 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
3300026297|Ga0209237_1249381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
3300026298|Ga0209236_1232136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 626 | Open in IMG/M |
3300026300|Ga0209027_1056315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1470 | Open in IMG/M |
3300026300|Ga0209027_1284202 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
3300026301|Ga0209238_1027586 | All Organisms → cellular organisms → Bacteria | 2125 | Open in IMG/M |
3300026310|Ga0209239_1158835 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300026310|Ga0209239_1193631 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 744 | Open in IMG/M |
3300026318|Ga0209471_1008378 | All Organisms → cellular organisms → Bacteria | 5513 | Open in IMG/M |
3300026322|Ga0209687_1013492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2704 | Open in IMG/M |
3300026323|Ga0209472_1186893 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300026326|Ga0209801_1293364 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
3300026327|Ga0209266_1224868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
3300026327|Ga0209266_1255538 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
3300026328|Ga0209802_1270844 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300026537|Ga0209157_1043961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2432 | Open in IMG/M |
3300026540|Ga0209376_1392004 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300026542|Ga0209805_1284485 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300026548|Ga0209161_10480755 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300027748|Ga0209689_1010405 | All Organisms → cellular organisms → Bacteria | 6180 | Open in IMG/M |
3300027846|Ga0209180_10180012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1219 | Open in IMG/M |
3300027846|Ga0209180_10807242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
3300027862|Ga0209701_10562278 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 611 | Open in IMG/M |
3300027873|Ga0209814_10027305 | All Organisms → cellular organisms → Bacteria | 2339 | Open in IMG/M |
3300027875|Ga0209283_10604673 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300027882|Ga0209590_10955267 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300027909|Ga0209382_11426800 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300028536|Ga0137415_11330776 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300031720|Ga0307469_11265001 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300031753|Ga0307477_10832137 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300032174|Ga0307470_10090653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1719 | Open in IMG/M |
3300032180|Ga0307471_100706355 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300033407|Ga0214472_10245043 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
3300033433|Ga0326726_11088507 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300033812|Ga0364926_120817 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300034177|Ga0364932_0310115 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.21% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.97% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.36% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.84% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.84% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033812 | Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17 | Environmental | Open in IMG/M |
3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C687J29039_101604511 | 3300002243 | Soil | PAEPSNEMLDFMATAVERCPQAKAVTFDAFSPSLTGDVLFRSVARIRAAL* |
JGI25385J37094_100275731 | 3300002558 | Grasslands Soil | EMLAFLAHAVTRCPQAQAVTFDAFSPSLTAEALFRSVERIRDAL* |
JGI25383J37093_101446472 | 3300002560 | Grasslands Soil | PAEPTDEMLDFTALAVSRCPAAKAVTFDAFAPSLTSDVLFKSVERIREAL* |
JGI25383J37093_101526232 | 3300002560 | Grasslands Soil | EMLAFAAHAVSRCPRAKAVTFDAFSPSLKAEVLFRSVERIREAL* |
JGI25390J43892_100278573 | 3300002911 | Grasslands Soil | PAAPSDEMLDFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRQSL* |
JGI25386J43895_101818391 | 3300002912 | Grasslands Soil | EPTDEMLDFTALAVSRCPAAKAVTFDAFAPSLTSDVLFKSVERIREAL* |
Ga0066677_103306081 | 3300005171 | Soil | AAHAVSRCPRAKAVTFDAFSPSLTPDVLFRSVERIRAAL* |
Ga0066683_108484651 | 3300005172 | Soil | TEPDDAMLDFMAHAVVRCPGAKAVTFDAFSPSLTADVLLSSVSRIRAAL* |
Ga0066678_105620661 | 3300005181 | Soil | SDEMLAFAAYAVGRCPQVKAVTFDAFSPSLTADVLLRSVERIRKVL* |
Ga0066678_110461512 | 3300005181 | Soil | SVEMLDFLALAVSRCPRARAVTFDAFSPSLTADTLLRSVERIRGAL* |
Ga0066681_101824483 | 3300005451 | Soil | AARAVTRCPRAQAVTFDAFSPGLTADVLLKSVGRIRAALS* |
Ga0070695_1002586421 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | TEPSDAMLDFLGHALTRCPRAKAVTFDAFSPSLSADCLLRSVERIRKAV* |
Ga0066701_106079791 | 3300005552 | Soil | HRCPRARAVTFDAFSPSLTPDALLRSVERIRKAV* |
Ga0066707_104957262 | 3300005556 | Soil | LAHAVTRCPQAKAVTFDAFSPSLTAEALFRSVERIRETL* |
Ga0066707_109877612 | 3300005556 | Soil | AFAAHAVSRCPRLKAVTFDAFSPSLTAEVLFRSVERIRGAL* |
Ga0066700_105278082 | 3300005559 | Soil | AHALTRCPATRAVTFDAFSPSLTADVLFSSVDRIRAAL* |
Ga0066670_101394561 | 3300005560 | Soil | SDEMLDFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRQSL* |
Ga0066699_104877131 | 3300005561 | Soil | LAFAAHAVSRCPRAKAVTFDAFSPSLTPDVLFRSVERIRAAL* |
Ga0066693_102229731 | 3300005566 | Soil | MALAVSRCPSARAVTFDAFSPSLTPEVLLSSVERIRRAL* |
Ga0066703_101539381 | 3300005568 | Soil | WIAPAEPSDEMLAFAARAVARCPRAQAVTFDAFSPGLTAEVLLKSVGRIRAALS* |
Ga0066694_100058159 | 3300005574 | Soil | DEMLDFAAYAVTRCPRARAVTFDAFSPSLTAEVLLRSVERIRGAL* |
Ga0066694_102483021 | 3300005574 | Soil | LAFAARAVTRCPRAQAVTFDAFSPGLTADVLLKSVGRIRAALS* |
Ga0066708_108731201 | 3300005576 | Soil | AEPSDAMLDFLGHAVQRCPRARAVTFDAFSPSLTPDALFRSVERIRKAV* |
Ga0075289_10102251 | 3300005888 | Rice Paddy Soil | AVSRCPRAKAVTFDAFSPSLTADVLFRSVERMRGAL* |
Ga0066658_108954632 | 3300006794 | Soil | AAYAVGRCPQVKAVTFDAFSPSLTADVLLRSVERIRKVL* |
Ga0066665_104139552 | 3300006796 | Soil | SDEMLEFTAHAAARCPQAKAVTFDAFSPSLSADVLFRSVERIRRAL* |
Ga0066659_106935662 | 3300006797 | Soil | PAEPSDEMLAFAAHAVSRCPRAKAVTFDAFSPSLTADVLFRSVERIRGAL* |
Ga0079221_117847291 | 3300006804 | Agricultural Soil | FAAHALTRCPRVKAVTFDAFSPSLSAEVMFRSVERIRGAL* |
Ga0079220_118909171 | 3300006806 | Agricultural Soil | EMLDFMAYAVSRCPGVRAVTFDAFSPTLTSDALFASVARIREVMGN* |
Ga0075425_1007727812 | 3300006854 | Populus Rhizosphere | LRRCPRARAVTFDAFSPSLTSDALFRSVERIRKAV* |
Ga0075436_1000738124 | 3300006914 | Populus Rhizosphere | AHALRRCPRARAVTFDAFSPSLTSDALFRSVERIRKAV* |
Ga0075436_1014164841 | 3300006914 | Populus Rhizosphere | MLDFMALAVSRCPAAKAVTFDAFAPSLTSDVLFKSVERIREAV* |
Ga0079218_117555342 | 3300007004 | Agricultural Soil | AHAVERCHQAKAVTFDAFSPSLAADVLVRSVERIRRAL* |
Ga0099791_101423271 | 3300007255 | Vadose Zone Soil | AHAVSRCPRAQAVTFDAFSPSLKAEVLFRSVERIREAL* |
Ga0099791_106225652 | 3300007255 | Vadose Zone Soil | MLDFMAHALTRCPAAKAVTFDAFSPSLTADVLFASVDRIRASL* |
Ga0066709_1036905462 | 3300009137 | Grasslands Soil | DFMAYAVTQCTQARAVTFDAFSPSVRAEVLFRSVERIRQAL* |
Ga0066709_1042912102 | 3300009137 | Grasslands Soil | MLDFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRKAL* |
Ga0126384_121070621 | 3300010046 | Tropical Forest Soil | RCPGVRAVTFDAFSPTLTGDVLFSSVERIRKALGN* |
Ga0127456_11842532 | 3300010140 | Grasslands Soil | AFAAHAVSRCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL* |
Ga0134064_101407972 | 3300010325 | Grasslands Soil | AEPSDEMLAFAAHAVSRCPRAKAVTFDAFSPSLTPDVLFRSVERIRGAL* |
Ga0134065_104657772 | 3300010326 | Grasslands Soil | FATHAVTRCPGARAVTFDAFSPSLTAEVLLRSVERIRAALA* |
Ga0134080_101789901 | 3300010333 | Grasslands Soil | TRCPGARAVTFDAFSPSLTAEVLLRSVERIRVALA* |
Ga0134071_102210492 | 3300010336 | Grasslands Soil | AFAAHAVSRCPRARAITFDAFSPSLTAEVLFRSVERIREAL* |
Ga0134062_101548611 | 3300010337 | Grasslands Soil | MLAFAAHAVSRCPRAKAVTFDAFSPSLTTEVLFRSVERIRAAL* |
Ga0134062_103966972 | 3300010337 | Grasslands Soil | HAVRRCPRARAVTFDAFSPSLTPDALFRSVERIRKAV* |
Ga0137383_105547962 | 3300012199 | Vadose Zone Soil | ALTRCPAAKAVTFDAFSPSLTADVLLSSVDRIRAAL* |
Ga0137383_106922342 | 3300012199 | Vadose Zone Soil | LDFMAHALTRCPAAKAVTFDAFSPSLTADVLLSSVDRIRAAL* |
Ga0137382_109034142 | 3300012200 | Vadose Zone Soil | SDAMLDFLGHALHRCPRARAVTFDAFSPSLTPDALLRSVERIRKAV* |
Ga0137365_109931582 | 3300012201 | Vadose Zone Soil | DEMLAFAAHAVSRCPQAKAVTFDAFSPTLTADVLFRSVARIREAS* |
Ga0137365_111009691 | 3300012201 | Vadose Zone Soil | WIAPVEPSDEMLAFAAHAVSRCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL* |
Ga0137363_113374321 | 3300012202 | Vadose Zone Soil | PSDEMLAFAAHAVSRCPRARAVTFDAFSPSLTADVLFRSVERIRGAL* |
Ga0137399_107618131 | 3300012203 | Vadose Zone Soil | LQGPWIAPTEPSDEMLAFMAHAVARCPRAQAVTYDAFSPSLRSDVLFRSVERIRRAL* |
Ga0137381_110539441 | 3300012207 | Vadose Zone Soil | HAVSRCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL* |
Ga0137376_103565693 | 3300012208 | Vadose Zone Soil | DFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRKAL* |
Ga0137379_106846192 | 3300012209 | Vadose Zone Soil | HAASRCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL* |
Ga0137379_110042291 | 3300012209 | Vadose Zone Soil | AAHAVSRCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL* |
Ga0137370_110144862 | 3300012285 | Vadose Zone Soil | PAEPSDEMLAFAAHAVSRCPRVKAVTFDAFSPSLTAEVLFRSVERIRGAL* |
Ga0137387_107873321 | 3300012349 | Vadose Zone Soil | MLDLMVHAVARCPGARAVTFDAFSPSLTAEGLFTSVARIRRALGN* |
Ga0137387_109652231 | 3300012349 | Vadose Zone Soil | AHAVSRCPRARAITFDAFSPALTAEVLFRSVERIRGAL* |
Ga0137386_112712731 | 3300012351 | Vadose Zone Soil | EMLAFAAHAVSRCPRVKAVTFDAFSPSLTAEVLFRSVERIRGAL* |
Ga0137371_106225422 | 3300012356 | Vadose Zone Soil | MLDFMALAVSRCPRARAVTFDAFSPSLTADVLLRSVERIRRAL* |
Ga0137368_102750063 | 3300012358 | Vadose Zone Soil | AQAVARCPAAKAVTFDAFSPSLTADVLLSSVHRIRAAL* |
Ga0137385_109442451 | 3300012359 | Vadose Zone Soil | HAVSCCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL* |
Ga0137360_116908842 | 3300012361 | Vadose Zone Soil | AVSQCPRAQAVTFDAFSPSLKAEVLFRSVERIREAL* |
Ga0134060_11891742 | 3300012410 | Grasslands Soil | MLAFAAHAVSRCPRAKAVTFDAFAPSLTTDVLLRTVERIRGAL* |
Ga0137397_109517281 | 3300012685 | Vadose Zone Soil | SDEMLAFAAHAVSRCPRAKAVTFDAFAPSLTAEILFRSVERIRGAL* |
Ga0137395_112262031 | 3300012917 | Vadose Zone Soil | PSDAMLDFMAHALTRCPAAKAVTFDAFSPSLPDDILFSSVDRIRAAL* |
Ga0137396_101671703 | 3300012918 | Vadose Zone Soil | VMLDFMAHALTRCPAAKAVTFDAFSPSLTADVLFSSVDRIRAAL* |
Ga0137394_111173152 | 3300012922 | Vadose Zone Soil | EMLAFAAYAVSRCPRAKAVTFDAFSPSLTAEVLFRSVERIRGAL* |
Ga0137416_119612822 | 3300012927 | Vadose Zone Soil | VRRCPGAKAVTFDAFSPSLTADVLFTSVARIREAL* |
Ga0134075_100886531 | 3300014154 | Grasslands Soil | FMTHALARCPAAKAVTFDAFSPSLTADVLFSSVDRIRAAL* |
Ga0134078_104104091 | 3300014157 | Grasslands Soil | DFMALAVSRCPRARAVTFDAFSPSLTADVLLRSVERIRRAL* |
Ga0134074_10895931 | 3300017657 | Grasslands Soil | LDFMAHAVVRCPGAKAVTFDAFSPSLTADVLLSSVSRIRAAL |
Ga0134074_10978031 | 3300017657 | Grasslands Soil | MALAVSRCPCAQAVTFDAFSPSLTPEVLLSSVERIRKVL |
Ga0134074_11101302 | 3300017657 | Grasslands Soil | AARCPQAKAVTFDAFSPSLTSDVLFRSIERIRAAL |
Ga0066655_103499882 | 3300018431 | Grasslands Soil | AAHAVSRCPRAKAVTFDAFAPSLTTDVLFRTVERIRGAL |
Ga0066662_103503871 | 3300018468 | Grasslands Soil | APAEPSDAMLDFLAHALHRCPRARAVTFDAFSPSLTPDALLRSVERIRKAV |
Ga0066662_122349242 | 3300018468 | Grasslands Soil | FMAHALTRCPRAKAVTFDAFSPSLTADVLFSSVDRVRAAL |
Ga0066662_124191662 | 3300018468 | Grasslands Soil | PSDAMLAFLAHAVSRCPQAKAVTFDAFSPSLTADVLLRSVERIRAAL |
Ga0210408_107254181 | 3300021178 | Soil | IGPAEPSDAMLAFAAHAVSRCPRAQAVTFDAFSPSLTAEVLLRSVERIREAL |
Ga0247665_10295731 | 3300024219 | Soil | ASRCPKARAVTFDAFSPSLTADVLLRSVERIRAAL |
Ga0247666_10601872 | 3300024323 | Soil | HAVDRCPGVRAVTFDAFSPTLTSDVLFASVARIRSALGN |
Ga0209520_104617071 | 3300025319 | Soil | PAEPSTEMLDLMAYAVACCPNLKAVTFDAFSPSLTAEVLFRSVARIRGAL |
Ga0209350_11272242 | 3300026277 | Grasslands Soil | MLEFLAHAVTRCPQAQAVTFDAFSPSLTAEALFRSVERIRDAL |
Ga0209237_12493812 | 3300026297 | Grasslands Soil | TDQMLDFMAHAVSRCPQAKAVTFDAFSPSLTADVLFRSVDRMRHAL |
Ga0209236_12321362 | 3300026298 | Grasslands Soil | RTSAVMLAFAAHAVSRCPRAKAVTFDAFSPSLTAEVLFRSVERIRGAL |
Ga0209027_10563153 | 3300026300 | Grasslands Soil | PAAPSDEMLDFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRRAL |
Ga0209027_12842021 | 3300026300 | Grasslands Soil | SDAMLAFLAHAVNRCPRARAVTFDAFSPSLTPDALLRSVERIRQAL |
Ga0209238_10275864 | 3300026301 | Grasslands Soil | VTQCPQAKAVTFDAFSPSLTAEALFRSVERIRAAL |
Ga0209239_11588351 | 3300026310 | Grasslands Soil | DFMGLAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRGAL |
Ga0209239_11936312 | 3300026310 | Grasslands Soil | VHRCPRARAVTFDAFSPSLTPDALFRSVERIRKAV |
Ga0209471_100837810 | 3300026318 | Soil | MLDFLAHAVHRCPRARAVTFDAFSPSLTPDALFRSVERIRKAV |
Ga0209687_10134924 | 3300026322 | Soil | APAEPSDEMLAFAAHAVSRCPRAKAVTFDAFSPSLTPDVLFRSVERIRAAL |
Ga0209472_11868931 | 3300026323 | Soil | AARAVTRCPRAQAVTFDAFSPGLTADVLLKSVGRIRAALS |
Ga0209801_12933641 | 3300026326 | Soil | LDFMAHAVSRCPQAKAVTFDAFSPSLTADVLFRSVDRMRHAL |
Ga0209266_12248682 | 3300026327 | Soil | PSDEMLDFAAYAVTRCPRARAVTFDAFSPSLTAEVLLRSVERIRGAL |
Ga0209266_12555381 | 3300026327 | Soil | AAHAVSRCPRAKAVTFDAFSPSLTAEVLLRSVERIRGAL |
Ga0209802_12708442 | 3300026328 | Soil | SDEMLDFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRKAL |
Ga0209157_10439611 | 3300026537 | Soil | GFLAHAVTQCPQAKAVTFDAFSPSLTAEALFRSVERIRAAL |
Ga0209376_13920041 | 3300026540 | Soil | AAPSDEMLDFMALAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRKVL |
Ga0209805_12844852 | 3300026542 | Soil | EMLDFMGLAVSRCPRAQAVTFDAFSPSLTPEVLLSSVERIRAAL |
Ga0209161_104807551 | 3300026548 | Soil | LDFMALAVGRCPRAQAVTFDAFSPSLTPEVLLSSVERIRKAL |
Ga0209689_10104056 | 3300027748 | Soil | PAEPTDEMLDFTALAVSRCPAAKAVTFDAFAPSLTSDVLFKSVERIREAL |
Ga0209180_101800121 | 3300027846 | Vadose Zone Soil | AFAAHAVRRCPRARALTFDAFSPSLTAEVLLRSVERIREAL |
Ga0209180_108072422 | 3300027846 | Vadose Zone Soil | MLAFAAHAVSRCPRAKAVTFDAFSPSLKAEVLFRSVERIREAL |
Ga0209701_105622782 | 3300027862 | Vadose Zone Soil | MLAFAAHAVSRCPRAQAVTFDAFSPSLTAEVLFRSVARIREAL |
Ga0209814_100273055 | 3300027873 | Populus Rhizosphere | FLGHAVSRCPGAKAVTFDAFSPSLTADVLVRSVERIRAAL |
Ga0209283_106046731 | 3300027875 | Vadose Zone Soil | DFLAYAVSRCPQARAVTFDAFSSSLAPDVLFRSVARIRGVL |
Ga0209590_109552672 | 3300027882 | Vadose Zone Soil | IAPSEPSDQMLDFMAHAAAKCPRAQAVTFDAFSPSLRAEVLFRTVERIREAL |
Ga0209382_114268001 | 3300027909 | Populus Rhizosphere | PTEPSAAMLDFLGYAVSRCPGAKAVTFDAFSPTLTVDVLVRSVERIRAAL |
Ga0137415_113307762 | 3300028536 | Vadose Zone Soil | VRRCPGAKAVTFDAFSPSLTADVLFTSVARIREAL |
Ga0307469_112650012 | 3300031720 | Hardwood Forest Soil | SEEMLAFAARAVARCPRAQAVTFDAFSPGLTAELLLRSVGRIRAALS |
Ga0307477_108321371 | 3300031753 | Hardwood Forest Soil | EMLDFMAHTVARCPRAQAVTFDAFSPSLRSEVLFRSVERIRRAL |
Ga0307470_100906533 | 3300032174 | Hardwood Forest Soil | AAHAASRCPKARAVTFDAFSPSLTADVLLRSVERIRAAL |
Ga0307471_1007063553 | 3300032180 | Hardwood Forest Soil | VDRCPGVRAVTFDAFSPTLSSDVLFTSVARIRQALGN |
Ga0214472_102450431 | 3300033407 | Soil | TGPSDEMLAFMAHAVAKCPRAKAVTFDAFSPSLTAEVLVGSVERIRSAL |
Ga0326726_110885071 | 3300033433 | Peat Soil | MLDLMVHAVARCPNAKAVTFDAFSPALGMDVLLASVARIRKALRN |
Ga0364926_120817_424_549 | 3300033812 | Sediment | MAHAVARCPQARAVTFDAFSPSLSAEVLLSSVERIRKALGN |
Ga0364932_0310115_410_547 | 3300034177 | Sediment | MLEFMAHAVARCPQARAVTFDAFSPSLSADVLLSSVERIRKALGN |
⦗Top⦘ |