NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074522

Metagenome / Metatranscriptome Family F074522

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074522
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 36 residues
Representative Sequence MLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS
Number of Associated Samples 90
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.04 %
% of genes near scaffold ends (potentially truncated) 95.80 %
% of genes from short scaffolds (< 2000 bps) 84.03 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.908 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.210 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.378 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.03%    β-sheet: 0.00%    Coil/Unstructured: 70.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF13546DDE_5 5.04
PF13358DDE_3 2.52
PF04255DUF433 1.68
PF00496SBP_bac_5 1.68
PF14104DUF4277 1.68
PF01609DDE_Tnp_1 1.68
PF01075Glyco_transf_9 1.68
PF00239Resolvase 0.84
PF13473Cupredoxin_1 0.84
PF13613HTH_Tnp_4 0.84
PF04304DUF454 0.84
PF00296Bac_luciferase 0.84
PF04909Amidohydro_2 0.84
PF13673Acetyltransf_10 0.84
PF13700DUF4158 0.84
PF01610DDE_Tnp_ISL3 0.84
PF13683rve_3 0.84
PF03972MmgE_PrpD 0.84
PF02810SEC-C 0.84
PF01568Molydop_binding 0.84
PF03400DDE_Tnp_IS1 0.84
PF10042DUF2278 0.84
PF14224DUF4331 0.84
PF02653BPD_transp_2 0.84
PF13495Phage_int_SAM_4 0.84
PF07978NIPSNAP 0.84
PF02585PIG-L 0.84
PF00106adh_short 0.84
PF11255DUF3054 0.84
PF01555N6_N4_Mtase 0.84
PF13359DDE_Tnp_4 0.84
PF03050DDE_Tnp_IS66 0.84
PF14319Zn_Tnp_IS91 0.84
PF16277DUF4926 0.84
PF03023MurJ 0.84
PF02371Transposase_20 0.84
PF04191PEMT 0.84
PF08388GIIM 0.84
PF12728HTH_17 0.84
PF02630SCO1-SenC 0.84
PF01850PIN 0.84
PF09827CRISPR_Cas2 0.84
PF00067p450 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 1.68
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 1.68
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 1.68
COG5421TransposaseMobilome: prophages, transposons [X] 1.68
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 1.68
COG3293TransposaseMobilome: prophages, transposons [X] 1.68
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 1.68
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 1.68
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.84
COG3547TransposaseMobilome: prophages, transposons [X] 0.84
COG3464TransposaseMobilome: prophages, transposons [X] 0.84
COG3436TransposaseMobilome: prophages, transposons [X] 0.84
COG2832Uncharacterized membrane protein YbaN, DUF454 familyFunction unknown [S] 0.84
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.84
COG2244Membrane protein involved in the export of O-antigen and teichoic acidCell wall/membrane/envelope biogenesis [M] 0.84
COG0534Na+-driven multidrug efflux pump, DinF/NorM/MATE familyDefense mechanisms [V] 0.84
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.84
COG2124Cytochrome P450Defense mechanisms [V] 0.84
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 0.84
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.84
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.84
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.84
COG1662Transposase and inactivated derivatives, IS1 familyMobilome: prophages, transposons [X] 0.84
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.84
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.84
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.84
COG0728Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis)Cell wall/membrane/envelope biogenesis [M] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.91 %
UnclassifiedrootN/A31.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_102419036All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300005552|Ga0066701_10322710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales957Open in IMG/M
3300005558|Ga0066698_10560992All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300005577|Ga0068857_100885560All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300005764|Ga0066903_100235541All Organisms → cellular organisms → Bacteria2799Open in IMG/M
3300005764|Ga0066903_100497143All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300005764|Ga0066903_101375082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1324Open in IMG/M
3300005764|Ga0066903_106692681All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Anabaena → unclassified Anabaena → Anabaena sp. 90599Open in IMG/M
3300005764|Ga0066903_107073597Not Available581Open in IMG/M
3300005764|Ga0066903_107603869Not Available558Open in IMG/M
3300005981|Ga0081538_10253033Not Available670Open in IMG/M
3300006846|Ga0075430_100296464Not Available1337Open in IMG/M
3300006846|Ga0075430_100755392Not Available801Open in IMG/M
3300006847|Ga0075431_100135231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2541Open in IMG/M
3300006880|Ga0075429_101216197All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300006904|Ga0075424_102801521All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300006969|Ga0075419_10189647All Organisms → cellular organisms → Bacteria1357Open in IMG/M
3300009038|Ga0099829_10565247All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300009038|Ga0099829_10914667Not Available728Open in IMG/M
3300009089|Ga0099828_10110643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium2388Open in IMG/M
3300009089|Ga0099828_10242219All Organisms → cellular organisms → Bacteria1616Open in IMG/M
3300009090|Ga0099827_10010188All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6024Open in IMG/M
3300009090|Ga0099827_10081955All Organisms → cellular organisms → Bacteria → Proteobacteria2521Open in IMG/M
3300009090|Ga0099827_10165962Not Available1817Open in IMG/M
3300009100|Ga0075418_10234991Not Available1951Open in IMG/M
3300009100|Ga0075418_12215279All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300009137|Ga0066709_100287284All Organisms → cellular organisms → Bacteria2226Open in IMG/M
3300009137|Ga0066709_102883455All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300009147|Ga0114129_10102534All Organisms → cellular organisms → Bacteria3957Open in IMG/M
3300009147|Ga0114129_10286054Not Available2201Open in IMG/M
3300009147|Ga0114129_11645539All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300009553|Ga0105249_10083161All Organisms → cellular organisms → Bacteria → Proteobacteria2979Open in IMG/M
3300010042|Ga0126314_10483445All Organisms → cellular organisms → Bacteria → Terrabacteria group898Open in IMG/M
3300010043|Ga0126380_10047372All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella2298Open in IMG/M
3300010043|Ga0126380_11115615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria673Open in IMG/M
3300010046|Ga0126384_11088053Not Available732Open in IMG/M
3300010047|Ga0126382_10921798Not Available758Open in IMG/M
3300010047|Ga0126382_11819805All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010047|Ga0126382_12356024Not Available516Open in IMG/M
3300010047|Ga0126382_12402922All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300010361|Ga0126378_10325998All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300010361|Ga0126378_12404403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria602Open in IMG/M
3300010362|Ga0126377_12727180Not Available569Open in IMG/M
3300010362|Ga0126377_12822220All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300010366|Ga0126379_13259608All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria543Open in IMG/M
3300010373|Ga0134128_13147894Not Available507Open in IMG/M
3300010398|Ga0126383_11171797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium858Open in IMG/M
3300010398|Ga0126383_11675696Not Available725Open in IMG/M
3300011271|Ga0137393_10423382All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina1141Open in IMG/M
3300012189|Ga0137388_10880269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Chlorogloeopsidaceae → Chlorogloeopsis → Chlorogloeopsis fritschii829Open in IMG/M
3300012199|Ga0137383_10798625All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor689Open in IMG/M
3300012199|Ga0137383_11103642All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium574Open in IMG/M
3300012201|Ga0137365_11205350Not Available541Open in IMG/M
3300012203|Ga0137399_11225664Not Available632Open in IMG/M
3300012206|Ga0137380_10743555All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300012207|Ga0137381_11772156Not Available507Open in IMG/M
3300012209|Ga0137379_10398173Not Available1286Open in IMG/M
3300012210|Ga0137378_11825816All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012211|Ga0137377_11875605All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300012349|Ga0137387_11014130Not Available595Open in IMG/M
3300012355|Ga0137369_10491389All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300012362|Ga0137361_10323155Not Available1414Open in IMG/M
3300012362|Ga0137361_11671172All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300012918|Ga0137396_10718196Not Available737Open in IMG/M
3300012918|Ga0137396_11180288Not Available541Open in IMG/M
3300012929|Ga0137404_11178104All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300012930|Ga0137407_11170822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria729Open in IMG/M
3300012938|Ga0162651_100052564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense644Open in IMG/M
3300012948|Ga0126375_11632210Not Available556Open in IMG/M
3300012971|Ga0126369_10043652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae → Hymenobacter3782Open in IMG/M
3300012971|Ga0126369_10108307Not Available2532Open in IMG/M
3300012971|Ga0126369_10770630All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium1043Open in IMG/M
3300014968|Ga0157379_10260743All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1575Open in IMG/M
3300016319|Ga0182033_10115369All Organisms → cellular organisms → Bacteria2007Open in IMG/M
3300016357|Ga0182032_11178583All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300016445|Ga0182038_10094022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2157Open in IMG/M
3300018063|Ga0184637_10555434Not Available659Open in IMG/M
3300018078|Ga0184612_10478037All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300018079|Ga0184627_10031563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2674Open in IMG/M
3300018082|Ga0184639_10222028Not Available1001Open in IMG/M
3300018481|Ga0190271_12591442Not Available608Open in IMG/M
3300019249|Ga0184648_1258344All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300020170|Ga0179594_10073092All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300021073|Ga0210378_10347376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales554Open in IMG/M
3300025922|Ga0207646_11265036All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300026023|Ga0207677_11084647Not Available729Open in IMG/M
3300026301|Ga0209238_1048054All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300026317|Ga0209154_1093848All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300026326|Ga0209801_1090224All Organisms → cellular organisms → Bacteria → Proteobacteria1335Open in IMG/M
3300026333|Ga0209158_1153065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4842Open in IMG/M
3300026540|Ga0209376_1085730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1659Open in IMG/M
3300027013|Ga0209884_1014151Not Available776Open in IMG/M
3300027655|Ga0209388_1096851Not Available847Open in IMG/M
3300027671|Ga0209588_1238130Not Available559Open in IMG/M
3300027846|Ga0209180_10373273All Organisms → cellular organisms → Bacteria → Acidobacteria811Open in IMG/M
3300027880|Ga0209481_10029037All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus wardiae2492Open in IMG/M
3300027880|Ga0209481_10136492All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300027880|Ga0209481_10632799All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300027907|Ga0207428_10047966All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium3429Open in IMG/M
3300027907|Ga0207428_10128074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. JS16631944Open in IMG/M
3300027909|Ga0209382_10378128Not Available1581Open in IMG/M
3300027948|Ga0209858_1012886All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300028587|Ga0247828_11115434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_2_20CM_53_11523Open in IMG/M
3300030499|Ga0268259_10014895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1390Open in IMG/M
3300031096|Ga0308193_1089809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales515Open in IMG/M
3300031114|Ga0308187_10467901All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031546|Ga0318538_10085321Not Available1609Open in IMG/M
3300031573|Ga0310915_10608411All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05774Open in IMG/M
3300031576|Ga0247727_10573020Not Available856Open in IMG/M
3300031736|Ga0318501_10591649All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella609Open in IMG/M
3300031747|Ga0318502_10465982All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031796|Ga0318576_10611305All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella513Open in IMG/M
3300031852|Ga0307410_11768641All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300031893|Ga0318536_10424526All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300031947|Ga0310909_10027044All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4210Open in IMG/M
3300032060|Ga0318505_10328701All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium722Open in IMG/M
3300032261|Ga0306920_102778215Not Available667Open in IMG/M
3300033181|Ga0272431_10106870Not Available1908Open in IMG/M
3300033551|Ga0247830_10288210All Organisms → cellular organisms → Bacteria1254Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil15.13%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere14.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.04%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.04%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.52%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.52%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.68%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.84%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.84%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.84%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.84%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
AgaveHost-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027013Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027948Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300030499Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2)Host-AssociatedOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033181Rock endolithic microbial communities from Victoria Land, Antarctica - Linnaeus Terrace sudEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10241903633300000559SoilAEPINMLPEKPEPVLFATMLTQVASLGRIHAVQPCFSFS*
Ga0066701_1032271033300005552SoilMLPEKPEPILLRQMLNKVAGLGRIHASQPSFSFS*
Ga0066698_1056099213300005558SoilMLPEKPEPILLAKILNQVAGLGRIHAIEPSFSFS*
Ga0068857_10088556023300005577Corn RhizosphereMLPEKPEPILLAKIRNQVAGLGRIHAAQASFSFA*
Ga0066903_10023554113300005764Tropical Forest SoilMLPEKPEPILLRQILHKVAGLGRIHASQPSSSFS*
Ga0066903_10049714313300005764Tropical Forest SoilMLPEKPEPVLLAKILNRVAGLGRIHATPPSFSFS*
Ga0066903_10137508223300005764Tropical Forest SoilMLPEKPEPILLAKIRNQVASLGRIHAAQPAFSFS*
Ga0066903_10669268113300005764Tropical Forest SoilMLPEKPEPVLLEQIRTKVACLGRIHGSQPSFSFS*
Ga0066903_10707359723300005764Tropical Forest SoilMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS*
Ga0066903_10760386913300005764Tropical Forest SoilQMLPEKPEPVLLAKIRTQVASLGRIHAPQPCFSSL*
Ga0081538_1025303313300005981Tabebuia Heterophylla RhizosphereETIKMLPAKPEPVLFAKVLNQVAGLGRIHTSQPSFSFS*
Ga0075430_10029646443300006846Populus RhizosphereLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS*
Ga0075430_10075539213300006846Populus RhizosphereMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS*
Ga0075431_10013523163300006847Populus RhizosphereMLPEKPEPILLAKIRNQVAGLGRIHIAQPSFSFS*
Ga0075429_10121619713300006880Populus RhizosphereQMLPEKPEPVLLRQILNKVASLGRIHASQPSFSFS*
Ga0075424_10280152113300006904Populus RhizosphereTIKMLPEKPEPVLLAKLLKQVAGLGRIHAAQPSFSFS*
Ga0075419_1018964713300006969Populus RhizosphereKMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS*
Ga0099829_1056524723300009038Vadose Zone SoilIQMLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS*
Ga0099829_1091466713300009038Vadose Zone SoilPMLPEKPEPVLLAKILNQVARLGRIHASQPPFSFA*
Ga0099828_1011064313300009089Vadose Zone SoilMLPEKPEPVLLAKILNQVAGLGRIHASQPSFSFS*
Ga0099828_1024221913300009089Vadose Zone SoilMLPEKPEPVLLAQIFNKVAGLGRIHAVQSSFNPG*
Ga0099827_1001018823300009090Vadose Zone SoilMLPEKPEPVLLRQILNKVAGLGRIHAAQTSFSFS*
Ga0099827_1008195513300009090Vadose Zone SoilMLPEKPEPVLLGRILNEGAGLGRIHASQPSFSFA*
Ga0099827_1016596223300009090Vadose Zone SoilKMLPEKPEPVLLRQILNKVAGLGRIHAAQPSFSFS*
Ga0075418_1023499113300009100Populus RhizosphereKLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS*
Ga0075418_1221527923300009100Populus RhizosphereQMLPEKPEPGLLAKIRHQVAGLGRIHTSQSSFSVL*
Ga0066709_10028728413300009137Grasslands SoilKMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS*
Ga0066709_10288345513300009137Grasslands SoilKMLPEKPEPILLAKILNQVAGLGRIHAIEPSFSFS*
Ga0114129_1010253413300009147Populus RhizosphereMLPEKPEPVLLAKILNQVAGLGRIHATQPSFSFS*
Ga0114129_1028605413300009147Populus RhizosphereMLPEKPEPVLLRQILNKVAGLGRIHASQPSFSFS*
Ga0114129_1164553913300009147Populus RhizosphereMLPEKPEPVLLEQIRNKVACLGRIHASQPSFSFS*
Ga0105249_1008316143300009553Switchgrass RhizosphereMSTEKPEPILFAKILNQVAGLGRIHAVLPAFSFS*
Ga0126314_1048344533300010042Serpentine SoilMLPEKPEPILLAKILNRVAGLGRIHAAQSSFSFS*
Ga0126380_1004737213300010043Tropical Forest SoilMLPQKPEPVLLRQIFHKVAGLGRIHAAQPSFSFA*
Ga0126380_1111561513300010043Tropical Forest SoilKMLPEKPESDLLAKIRYHVACLGRIHTSQPCFSFV*
Ga0126384_1108805313300010046Tropical Forest SoilMLPEKPEPVLLAKILHQVAGLGRIHATQPSFSFS*
Ga0126382_1092179813300010047Tropical Forest SoilMLPEKPEPVLLGQILHKVAGLGRIHASQPSFSFS*
Ga0126382_1181980513300010047Tropical Forest SoilKMLPEKPEPVLLAKILKQVAGLGRIHATQPSFSFS*
Ga0126382_1235602423300010047Tropical Forest SoilKMLPEKPEPVLLRQILHKVAGLGRIHAAQPSFSFS*
Ga0126382_1240292213300010047Tropical Forest SoilIKMLPEKPEPILFAKILHQVASLGRIHASQASFSFS*
Ga0126378_1032599813300010361Tropical Forest SoilMLPEKPEPILLRQILHKVAGLGRIHAAPPSFSFS*
Ga0126378_1240440313300010361Tropical Forest SoilKMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS*
Ga0126377_1272718023300010362Tropical Forest SoilMLPEKPEPVLLEQILNKVACLGRIHAAQPSFSVS*
Ga0126377_1282222013300010362Tropical Forest SoilEETIKMLPEKPEPVLLGQILHKVTCLGRIHASQRSGSFS*
Ga0126379_1325960813300010366Tropical Forest SoilMLPEKPEPILLRQILHKVAGLGRIHAAQPSFSFS*
Ga0134128_1314789413300010373Terrestrial SoilYVEERIKMLPEKPEPVFLGQILHKIACLSRIHASQPSCSFS*
Ga0126383_1117179713300010398Tropical Forest SoilKMLPEKPEPVVLRQILRKVAGLGRIHASQPAFSFA*
Ga0126383_1167569613300010398Tropical Forest SoilETIKMLPEKPEPILLRQILHKVAGLGRIHAAQPSFSFS*
Ga0137393_1042338213300011271Vadose Zone SoilMLPEKPEPVLLAKILNQVAGLGRIHAAEPSFSFS*
Ga0137388_1088026913300012189Vadose Zone SoilTIKMLPEKPEPVLLAKILHQVAGLGRIHAAPPSFSFS*
Ga0137383_1079862513300012199Vadose Zone SoilQMLPEKPEPILLCQILNKVAGLGRIHASQPSFSFS*
Ga0137383_1110364223300012199Vadose Zone SoilEETIKMLPEKPEPVLFAKILHKVACLGRIHASQPSVSFS*
Ga0137365_1120535013300012201Vadose Zone SoilRLPEKPEPVLLRQILNKVAGLGRIHASQPSFSFS*
Ga0137399_1122566413300012203Vadose Zone SoilQMLPEKPEPVLLAKIRNQVAGLGRIHVSPPSFSFS*
Ga0137380_1074355513300012206Vadose Zone SoilMLPEKPEPILLCQILNKVAGLGRIHASQPSFSFS*
Ga0137381_1177215613300012207Vadose Zone SoilMLPEKPEPVLLAKLLNQVTSLGRIHLSQPSFRFAELAMVLP
Ga0137379_1039817313300012209Vadose Zone SoilKMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS*
Ga0137378_1182581613300012210Vadose Zone SoilMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS*
Ga0137377_1187560523300012211Vadose Zone SoilEETRQMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS*
Ga0137387_1101413013300012349Vadose Zone SoilMLPEKPEPVLFAKILNQVAGLGRIHATQPSLSFS*
Ga0137369_1049138923300012355Vadose Zone SoilMLPEKPEPILLAKILKQVAGLGRIHAAQPTFSCSELA*
Ga0137361_1032315513300012362Vadose Zone SoilMLPETPEPVLLHQILNKVAGLGRLHASQPTFSFS*
Ga0137361_1167117213300012362Vadose Zone SoilKMLPEKPEPILFAKILNQVAGLGRIHATQPSCSFS*
Ga0137396_1071819613300012918Vadose Zone SoilETIQMLPEKPEPVLLAKILNQVAGLGRIHAAPPSFSFS*
Ga0137396_1118028813300012918Vadose Zone SoilKMLPEKPEPVLFAKILNQVAGLGRIHAFQPSVSFS*
Ga0137404_1117810413300012929Vadose Zone SoilQMLPEKPEPVLLGQILHKVACLGRMHVSQPAFSFS*
Ga0137407_1117082233300012930Vadose Zone SoilETIKMLPEKPEPILFAKILNRVAGLGRIHVSPPSFSFS*
Ga0162651_10005256413300012938SoilIKMLPEKPEPILFAKILNQVAGLGRIHASLPSFSFS*
Ga0126375_1163221013300012948Tropical Forest SoilMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFRFS*
Ga0126369_1004365213300012971Tropical Forest SoilMLPEKPEPILLVKIRNRVASLGRIHAAQPSFSFA*
Ga0126369_1010830713300012971Tropical Forest SoilIKMLPEKPEPILFAKILNQVASLGRIHASQASFSFS*
Ga0126369_1077063013300012971Tropical Forest SoilKMLPEKPEPVLLEQIRTKVACLGRIHGSQPSFSFS*
Ga0157379_1026074313300014968Switchgrass RhizosphereYVEEMLQMLPEKPEPILLRQMLNKVACVGRIHAAQRSFSLS*
Ga0182033_1011536933300016319SoilEETIKMLPEKPEPVLFRQIRQEVAALGRIHASQPSFSFS
Ga0182032_1117858313300016357SoilQMLPEKPEPVLLAKILNRVAGLGRIHATQPSFSFS
Ga0182038_1009402233300016445SoilQMLPEKPEPILLAKIRNRVASLGRIHAAPPSFSFA
Ga0184637_1055543413300018063Groundwater SedimentQMLPEKPEPVLLGQILNKVACLGRIHASQPSFSFS
Ga0184612_1047803713300018078Groundwater SedimentQMLPEKPEPVLLRRILNKVACLGRIHASQPSFSFS
Ga0184627_1003156313300018079Groundwater SedimentKMLPEKPEPVLLAKIRNQVAGLGRIHVSPPSFSFS
Ga0184639_1022202813300018082Groundwater SedimentQLLPEKPEPVLLAKILNQVARLGRIHASQPSFSFA
Ga0190271_1259144213300018481SoilIKMLPEKPEPILLHEILTKVSGFGRIHASQPSFSFS
Ga0184648_125834413300019249Groundwater SedimentMLPEKPELVLLGHILNKVAGLGRMHASQPVCSFSS
Ga0179594_1007309223300020170Vadose Zone SoilIKMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS
Ga0210378_1034737623300021073Groundwater SedimentEETIKMLPEKPEPILFAKILNRVAGLGRIHVSPPSFSFS
Ga0207646_1126503633300025922Corn, Switchgrass And Miscanthus RhizosphereIQMLPEKPEPVLLERILNKVACLGRIHAAQPSFSFS
Ga0207677_1108464723300026023Miscanthus RhizosphereQMLPEKPEPILLRQMLNKVACLGRIHAAQPSFSLS
Ga0209238_104805423300026301Grasslands SoilIKMLPEKPEPVLFAKILNQVAGLGRIHAAQPSFSFS
Ga0209154_109384833300026317SoilIQMLPEKPEPILFAKILNQVAGLGRIHASQPSVSFS
Ga0209801_109022433300026326SoilTIKMLPEKPEPILLRQILNKVAGLGRIHASQPSFSFS
Ga0209158_115306513300026333SoilIQMRPEKPAPVLLAKILNQVASLGRMHAAQPSFSFS
Ga0209376_108573013300026540SoilQMLPEKPEPILLRQMLNKVAGLGRIHASQPSFSFS
Ga0209884_101415133300027013Groundwater SandKMLPEKPEPVLLAKILNQVAGLGRIHVSPPSFSFS
Ga0209388_109685123300027655Vadose Zone SoilKMLPEKPEPVLFAKILNQVAGLGRIHASQPSFSFS
Ga0209588_123813013300027671Vadose Zone SoilKMLPEKPEPILFAKILNQVARLGRIHASPVSFSFS
Ga0209180_1037327323300027846Vadose Zone SoilIKMLPEKPEPVLLGRILNEVAGLGRIHASQPSFSFA
Ga0209481_1002903753300027880Populus RhizosphereKMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS
Ga0209481_1013649213300027880Populus RhizosphereIKMLPEKPEPVLLRQILHKVAGLGRIHASQPSFSFS
Ga0209481_1063279913300027880Populus RhizosphereIKLLPEKPEPILLAKILNQVASVGRIHAAQPPFSLS
Ga0207428_1004796653300027907Populus RhizosphereIKMLPEKPEPVLLAKLLKQVAGLGRIHAAQPSFSFS
Ga0207428_1012807423300027907Populus RhizosphereQMLPEKPEPVLLEQIRNKVACLGRIHASQPSFSFS
Ga0209382_1037812813300027909Populus RhizosphereIKMLPEKPEPVLLRQILNKVAGLGRIHSSQPSFSFS
Ga0209858_101288623300027948Groundwater SandEETIKMLPEKPEPVLLAKILNQVAGLGRIHVSPPSFSFS
Ga0247828_1111543413300028587SoilIKMLPEKPEPVLLRQILRKVAGLGRIHASHSSFSFS
Ga0268259_1001489513300030499AgaveIKLLPEKPEPILLAKIRTQVAGLGRIHAAQPSFSFA
Ga0308193_108980913300031096SoilQMLPEKPEPILLRQILDRVACLGRIHIPQPSFSFS
Ga0308187_1046790113300031114SoilEETIKMLPEKPEPVLFAKILHHVAGLGRIHTTQPSLSFS
Ga0318538_1008532123300031546SoilIKMLPEKPEPVLLAKILHQVAGLGRIHATQPSFSFS
Ga0310915_1060841113300031573SoilIKLLPEKPEPILLAKIRNQVAGLGRIHAAQPSFSFS
Ga0247727_1057302023300031576BiofilmKLLPQKPEPVLLAQIFNTVAALGRIHPVQPDFSPG
Ga0318501_1059164913300031736SoilIKMLPEKPEPVLLAKIRNHVAGLGRIHAAQPSFSFS
Ga0318502_1046598213300031747SoilIQMLPEKPEPVLLAKILNRVAGLGRIHATQPSFSFS
Ga0318576_1061130513300031796SoilIKMLPEKPEPVLFRQILHKVAGLGRIHASQPSFSFS
Ga0307410_1176864113300031852RhizosphereKMLPEKPEPILLAKIRNQVAGLGRIHAAPPSFSFA
Ga0318536_1042452613300031893SoilIKMLPEKPEPVLLAKILNQVAGLGRIHATQPSFSFS
Ga0310909_1002704413300031947SoilIKMLPEKPEPVLLAKILNQVAGLGRIHAAQPSFSFS
Ga0318505_1032870113300032060SoilKMLPEKPEPVLFRQILHKVAGLGRIHASQPSFSFS
Ga0306920_10277821513300032261SoilIKMLPEKPEPVLFAKILNQVTGLGRIHATQPSLSFA
Ga0272431_1010687033300033181RockLTMLPEKPEPILVARIFAKMASLGRVHAVPPDSLAS
Ga0247830_1028821013300033551SoilKMLPEKPEPVLLRQILRKVAGLGRIHASHSSFSFS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.