Basic Information | |
---|---|
Family ID | F074453 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 42 residues |
Representative Sequence | QAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAMEL |
Number of Associated Samples | 77 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.16 % |
% of genes from short scaffolds (< 2000 bps) | 93.28 % |
Associated GOLD sequencing projects | 71 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.185 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (44.538 % of family members) |
Environment Ontology (ENVO) | Unclassified (80.672 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.992 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF01844 | HNH | 5.88 |
PF13481 | AAA_25 | 5.04 |
PF01541 | GIY-YIG | 5.04 |
PF06054 | CoiA | 3.36 |
PF10544 | T5orf172 | 1.68 |
PF09250 | Prim-Pol | 1.68 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG4469 | Competence protein CoiA, contains predicted nuclease domain | General function prediction only [R] | 3.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.18 % |
All Organisms | root | All Organisms | 37.82 % |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 44.54% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.92% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.92% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.88% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.52% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.68% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.84% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.84% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.84% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.84% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.84% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032018 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middle | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25909J50240_10417943 | 3300003393 | Freshwater Lake | GLPQAKCKDATNRTKKTQMWCNALRNITAEDIVLASQKAIELGA* |
Ga0068876_102622151 | 3300005527 | Freshwater Lake | PQAKCKDATNKTKGTQYWCNALRNITAQDIVEAAKKAMELEG* |
Ga0049081_102688382 | 3300005581 | Freshwater Lentic | AKCKDASNRTPKTQYWCNALRNITAEDIVLASKKAMELESK* |
Ga0073913_100956091 | 3300005940 | Sand | CKDATNRTKKTQMWCNALRNITAEDIVEAAKKAIELGDGK* |
Ga0073926_100849212 | 3300005943 | Sand | TNRTKKTQMWCNALRNITAEDIVEAAKKAIELGDGK* |
Ga0079300_100950453 | 3300007162 | Deep Subsurface | DATNKTPKTQYWCNALRNITAQDIVEASKKAIELESK* |
Ga0075458_100827102 | 3300007363 | Aqueous | KCKDATNKTPKTQMWCNALRNITAQDIVEAAKKAMELEG* |
Ga0104242_10295893 | 3300008962 | Freshwater | KDASNRTPKTQYWCNALRNITAQDIVEASKKAMELEEVKESK* |
Ga0114973_102026973 | 3300009068 | Freshwater Lake | AKCKDATNKTPKTQYWCNALRNITAQDIVEASKKAIELGA* |
Ga0114973_102919101 | 3300009068 | Freshwater Lake | HAGLPQAKCKDATNKTPKTQMWCNALRNIKAEDIVEASKKAVDLDFSNGAKK* |
Ga0114973_104085581 | 3300009068 | Freshwater Lake | PQAKCKDATNKTPKTQMWCNALRHITAQDIVEASMKALELEDKSQEAK* |
Ga0114980_105675171 | 3300009152 | Freshwater Lake | QAKCKDAINKTPKTQMWCNALRNITAEDIVVASKKAIELEIK* |
Ga0114980_106167072 | 3300009152 | Freshwater Lake | LPQAKCKDASNKTPKTQMWCNALRNIKAEDIVEASMKALELEDNSHAKS* |
Ga0114968_101929431 | 3300009155 | Freshwater Lake | SNRTPKTQYWCNALRNITAQDIVEASKKAMELGEVKESK* |
Ga0114968_103376902 | 3300009155 | Freshwater Lake | RTPKTQYWCNALRNITAQDIVEASKKAMELGEVKESK* |
Ga0114978_101860841 | 3300009159 | Freshwater Lake | KCKDASNRTPKTQLWCNALRNITAEMIVNNAKKAMQPEKV* |
Ga0114970_1000867611 | 3300009163 | Freshwater Lake | RPHGGLPQAKCKDASNKTPKTQYWCNALRNITAEDIVVAPHKAMELEEK* |
Ga0114979_102626462 | 3300009180 | Freshwater Lake | CKDASNRTPKTQLWCNALRNITAEMIVDAAKKAVELDGK* |
Ga0114969_107294831 | 3300009181 | Freshwater Lake | KCKDASNRTPKTQYWCNALRNITAQDIVEASKKAMELGEVKESK* |
Ga0114974_101382523 | 3300009183 | Freshwater Lake | TQMWCNALRHITAQDIVEASMKALELVDKSQETK* |
Ga0114976_102241801 | 3300009184 | Freshwater Lake | AKCKDASNRTPKTQYWCNALRNITAQDIVEASKKAMELESNG* |
Ga0114976_106417412 | 3300009184 | Freshwater Lake | CKDASNKTPKTQMWCNALRNIKAEDIVDASMKALELEDNSQETK* |
Ga0114958_104342142 | 3300009684 | Freshwater Lake | GLPQAKCKDASNKTPKTQIWCNALRNITAQDIVDASMKALELEDKQHEENK* |
Ga0129336_103199841 | 3300010370 | Freshwater To Marine Saline Gradient | DATNKTPKTQMWCNALRNITAQDIVEAAKKAMELEG* |
Ga0119951_10119116 | 3300012000 | Freshwater | CKDATNKTPKTQMWCNALRNITAQDIVEAAKKAMELES* |
Ga0119951_10215781 | 3300012000 | Freshwater | HAGLPQQKCKDATNKTPKTQMWCNALRNITAQDIVEAAKKAMELES* |
Ga0119955_10207764 | 3300012006 | Freshwater | QAKCKDATNKTPKTQMWCNALRNIKAEDIVLASKKAIDLDFQQGETK* |
Ga0119955_11387881 | 3300012006 | Freshwater | CKDATNKTPKTQYWCNALRNITAQDIVEASKKAIELESK* |
Ga0157498_10748352 | 3300012666 | Freshwater, Surface Ice | KCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVEEVKESK* |
Ga0181364_10294342 | 3300017701 | Freshwater Lake | ALPIWGLPQAKCKDATNKTPKTQYWCNALRNITAEDIVVASRKAMELEENK |
Ga0181364_10518593 | 3300017701 | Freshwater Lake | LPQAKCKDATNKTPKTQYWCNALRNITAEDIVVASHKAMELEQQK |
Ga0181350_10199571 | 3300017716 | Freshwater Lake | QAKCKDASNRTPKTQYWCNALRNITAEDIVLASKKAMELESK |
Ga0181362_10468041 | 3300017723 | Freshwater Lake | GGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELEEVKESK |
Ga0181362_10789633 | 3300017723 | Freshwater Lake | QAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAMEL |
Ga0181362_11007261 | 3300017723 | Freshwater Lake | KDATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVQESK |
Ga0181365_10293221 | 3300017736 | Freshwater Lake | PHGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAIELGA |
Ga0181365_11540421 | 3300017736 | Freshwater Lake | DATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVKESK |
Ga0181356_10122523 | 3300017761 | Freshwater Lake | AGLPQAKCKDASNRTPKTQLWCNALRNITPEMIVDAAKKAVELDGK |
Ga0181356_10906932 | 3300017761 | Freshwater Lake | ATNRTKKTQMWCNALRNITAEDIVEAAKKVVEEIKESK |
Ga0181356_11492201 | 3300017761 | Freshwater Lake | RPHAGLPQAKCKDASNKTPRTQYWCNALRNITAEDIVVASRKAMELEPK |
Ga0181358_10842813 | 3300017774 | Freshwater Lake | GRPHAGLPQAKCKDASNKTPRTQYWCNALRNITAEDIVVASRKAMELEPK |
Ga0181358_11538973 | 3300017774 | Freshwater Lake | KDASNRTPKTQYWCNALRNITAEDIVLASKKAMELESK |
Ga0181358_12041432 | 3300017774 | Freshwater Lake | GLPQAKCKDASNKTPRTQYWCNAPRNITAEDIVVASHKAMELEEK |
Ga0181358_12753871 | 3300017774 | Freshwater Lake | QAKCKDASNRTPKTQYWCNALRNITAQDIVEASKKAMEL |
Ga0181357_12473701 | 3300017777 | Freshwater Lake | QAKCKDATNRTKKTQMWCNALRNITAEDIVLASQKAIEL |
Ga0181357_13384401 | 3300017777 | Freshwater Lake | GLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAMELVA |
Ga0181349_10575771 | 3300017778 | Freshwater Lake | GLPQAKCKDASNKTPKTQYWCNALRNITAEDIVVASRKAMELDQQK |
Ga0181349_10672783 | 3300017778 | Freshwater Lake | KCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVMELGSNG |
Ga0181349_12461271 | 3300017778 | Freshwater Lake | PQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVMDLEEK |
Ga0181346_11067203 | 3300017780 | Freshwater Lake | GLPQAKCKDATNRTKKTQMWCNALRNITAEDIVLASQKAIEL |
Ga0181348_11960433 | 3300017784 | Freshwater Lake | GGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAMEL |
Ga0181348_12118073 | 3300017784 | Freshwater Lake | LPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELGDGK |
Ga0181348_12914711 | 3300017784 | Freshwater Lake | TNRTKKTQMWCNALRNITAEDIVEAAKKVVELEEKK |
Ga0181355_12679293 | 3300017785 | Freshwater Lake | LPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVK |
Ga0181355_13708072 | 3300017785 | Freshwater Lake | LPQAKCKDATHRTKKTEMWCNALRNITAEDIVEASKKAIELGA |
Ga0187842_12366223 | 3300018790 | Freshwater | GLPQAKCKDASNRTPKTQYWCNALRNITAQDIVEASKKAMELDAGK |
Ga0187843_101999193 | 3300019093 | Freshwater | ATNRTKKTQMWCNALRNITAEDIVEAAKKVMEEVK |
Ga0181359_10200941 | 3300019784 | Freshwater Lake | KDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELGSNG |
Ga0181359_11595431 | 3300019784 | Freshwater Lake | DATNRTKKTQMWCNALRNITAEDIVEAAKKVVELEEKK |
Ga0181359_11766132 | 3300019784 | Freshwater Lake | TNRTKKTQMWCNALRNITAEDIVEAAKKVVELGEKK |
Ga0194130_103942133 | 3300021376 | Freshwater Lake | PQAKCKDATNRTKGTQYYCNAIRAITAEMIVGKAKEAMEENK |
Ga0181353_10307183 | 3300022179 | Freshwater Lake | HAGLPQQKCKDATNKTPKTQMWCNALRNITAQDIVEAAKKAMELEG |
Ga0181354_10879151 | 3300022190 | Freshwater Lake | HGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELGEKK |
Ga0181354_11277044 | 3300022190 | Freshwater Lake | RATNRTKKTQMWCNALRNITAEDIVEAAKKVMDLEEK |
Ga0181354_11638811 | 3300022190 | Freshwater Lake | CKDATNRTKKTQMWCNALRNITAEDIVEAAKKVMELEEKK |
Ga0181354_11717541 | 3300022190 | Freshwater Lake | HGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAMELGA |
Ga0181351_11056084 | 3300022407 | Freshwater Lake | CKDATNRTKKTQMWCNALRNITAEDIVEAAKKVMDLEEK |
Ga0181351_11067383 | 3300022407 | Freshwater Lake | PQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELEEVKESK |
Ga0181351_11550751 | 3300022407 | Freshwater Lake | PQAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAIELGA |
Ga0181351_11779052 | 3300022407 | Freshwater Lake | NATNRTKKTQMWCNALRNITAEDIVEAAKKAIELGDGK |
Ga0181351_12527673 | 3300022407 | Freshwater Lake | ETNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVKESK |
Ga0181351_12622011 | 3300022407 | Freshwater Lake | DPHAGLPQAKCKDASNKTPRTQYWCNALRNITAEDIIVASRKAMELEPK |
Ga0214917_101419893 | 3300022752 | Freshwater | QAKCKDASNKTPKTQYWCNALRNITAQDIVLASQKAMELESK |
Ga0214917_103547841 | 3300022752 | Freshwater | TQLWCNALRNITAQDIVEASMKALELEDKQHGEKK |
Ga0214921_103386923 | 3300023174 | Freshwater | GLPQAKCKDASNRTPKTQYWCNALRNITAQDIVLASQKAIEL |
Ga0214923_102678901 | 3300023179 | Freshwater | QKCKDATNKTAKTQMWCNALRNITAQDIVEAAKKAMELEG |
Ga0208916_102847162 | 3300025896 | Aqueous | TNKTPKTQYWCNALRNITAQDIVEASKKAMELEEKK |
Ga0209552_10429611 | 3300027563 | Freshwater Lake | CKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVKESK |
Ga0209651_11254261 | 3300027581 | Freshwater Lake | HGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVKESK |
Ga0209357_10507433 | 3300027656 | Freshwater Lake | CKDATNRTKKTQMWCNALRNITAEDIVEAAKRVVELGSNG |
Ga0209357_11510783 | 3300027656 | Freshwater Lake | PQAKCKDATNRTKKTQMWCNALRNITAEDIVEASKKAMEL |
Ga0209087_11057281 | 3300027734 | Freshwater Lake | PHAGLPQAKCKDASNRTPKTQYWCNALRNITAQDIVLASQKAIELETK |
Ga0209087_12630512 | 3300027734 | Freshwater Lake | AKCKDASNRTPKTQYWCNALRNITAEDIVLASKKAMELESK |
Ga0209296_10815541 | 3300027759 | Freshwater Lake | LPQAKCKDASNKTPKTQMWCNALRHITAQDIVEASMRALELEDNSHAKS |
Ga0209500_102721712 | 3300027782 | Freshwater Lake | SNRTPKTQYWCNALRNITAEDIVLASKKAMELESK |
Ga0209246_101705073 | 3300027785 | Freshwater Lake | GLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVMDLEEK |
Ga0209353_102550381 | 3300027798 | Freshwater Lake | DATNKTPKTQYWCNALRNITAEDIVVASRKAMELEEK |
Ga0209353_102699582 | 3300027798 | Freshwater Lake | HGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELGDGK |
Ga0209354_101121523 | 3300027808 | Freshwater Lake | LPQAKCKDASNKTPKTQYWCNALRNITAEDIVVASRKAMELEENK |
Ga0209354_103039331 | 3300027808 | Freshwater Lake | KDATNRTKKTQMWCNALRNITAEDIVEASKKAMEL |
Ga0209354_103280251 | 3300027808 | Freshwater Lake | AKCKDASNKTKGTQYWCNALRNITAEMIVENAKKAMQPEDVK |
Ga0209990_100418141 | 3300027816 | Freshwater Lake | PQAKCKDATNKTKGTQYWCNALRNITAQDIVEAAKKAMELEG |
(restricted) Ga0247837_12319561 | 3300027970 | Freshwater | AKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELEGS |
Ga0209401_11667583 | 3300027971 | Freshwater Lake | HAGLPQAKCKDATNKTPKTQMWCNALRNIKAEDIVEASKKAVDLDFSNGAKK |
(restricted) Ga0247839_10402904 | 3300028553 | Freshwater | PQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVTL |
(restricted) Ga0247839_12088622 | 3300028553 | Freshwater | QGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELEGS |
(restricted) Ga0247832_11691561 | 3300028557 | Freshwater | KCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVTL |
(restricted) Ga0247831_10940301 | 3300028559 | Freshwater | AKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVTL |
(restricted) Ga0247843_11018163 | 3300028569 | Freshwater | CRPQGGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVTL |
(restricted) Ga0247843_11988161 | 3300028569 | Freshwater | GLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVTL |
Ga0307378_107874801 | 3300031566 | Soil | HAPCRPQAGLPQAKCKDATNRTKKTQLWCNALRNITAEDIVEAAKKVVTL |
Ga0307376_102172962 | 3300031578 | Soil | QAKCKDATNRTKKTQMWCNALRNITPEDIVEAAKKVVTL |
Ga0307377_110848252 | 3300031673 | Soil | PQAKCKDATNRTKKTQMWCNALRNITPEDIVEAAKKVVEL |
Ga0315293_110605641 | 3300031746 | Sediment | LPQSKCKDATNKTKGTQYWCNALRNISAEMIVEKAKKAMEDQKD |
Ga0315288_113656372 | 3300031772 | Sediment | CKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVELEDKQHEEKK |
Ga0315288_113714502 | 3300031772 | Sediment | AKCKDASNRTKKTQMWCNALRNITAEDIVEAAKKVVELGEKQHEEKK |
Ga0315290_105300721 | 3300031834 | Sediment | GLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVK |
Ga0315285_103932583 | 3300031885 | Sediment | PQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVEEVK |
Ga0315278_105028893 | 3300031997 | Sediment | KCKDATNRTKKTQMWCNALRNITAEDIVEAAKNVVKLEEVKESK |
Ga0315274_114953671 | 3300031999 | Sediment | QAKCKDATNRTKKTQMWCNALRNITAEDIVVASRKAMELEENK |
Ga0315272_102298032 | 3300032018 | Sediment | GGLPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVKESK |
Ga0315289_110531771 | 3300032046 | Sediment | QAKCKDASNKTPKTQYWCNALRNITAEDIVVASRKAMELEEK |
Ga0315284_119471862 | 3300032053 | Sediment | TNKTPKTQYWCNALRNITAEDIVVASHKAMELEEK |
Ga0315284_120501482 | 3300032053 | Sediment | LPQAKCKDATNRTKKTQMWCNALRNITAEDIVEAAKKVMELGEKQHEEKK |
Ga0315903_106047812 | 3300032116 | Freshwater | PHAGLPQAKCKDATNKTKGTQYWCNALRNITDQDIVEAAKKAMELEG |
Ga0315286_104216433 | 3300032342 | Sediment | RTKKTQMWCNALRNITAEDIVEAAKKVVKLEEVKESK |
Ga0334722_110959073 | 3300033233 | Sediment | PCRPHAGLPQAKCKDASNKTPKTQYWCNALRNITAQDIVEASKKAMELGA |
Ga0335010_0242041_14_133 | 3300034092 | Freshwater | MCKDATNKTKGTQYWCNALRHINAQDIVEAAKKAVELNG |
Ga0335036_0728535_2_148 | 3300034106 | Freshwater | HAGLPQAKCKDATNKTPKTQYWCNALRNITAQDIVEASKKAMELGANG |
⦗Top⦘ |