NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074243

Metagenome / Metatranscriptome Family F074243

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074243
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 170 residues
Representative Sequence TGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Number of Associated Samples 85
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.87 %
% of genes near scaffold ends (potentially truncated) 89.08 %
% of genes from short scaffolds (< 2000 bps) 87.39 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.639 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(66.387 % of family members)
Environment Ontology (ENVO) Unclassified
(76.471 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(63.025 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.17%    β-sheet: 23.44%    Coil/Unstructured: 72.40%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF14559TPR_19 17.65
PF13714PEP_mutase 5.04
PF13432TPR_16 0.84



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.64 %
UnclassifiedrootN/A3.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002660|Ga0005454J37223_105546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium572Open in IMG/M
3300004135|Ga0058884_1402067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300004139|Ga0058897_10990819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium577Open in IMG/M
3300004139|Ga0058897_11091546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300004631|Ga0058899_11668757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium565Open in IMG/M
3300004631|Ga0058899_11798017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300005332|Ga0066388_101282046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1261Open in IMG/M
3300010366|Ga0126379_13288949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300010376|Ga0126381_100881761All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1287Open in IMG/M
3300010376|Ga0126381_102699647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium710Open in IMG/M
3300010376|Ga0126381_102710196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium708Open in IMG/M
3300010376|Ga0126381_103064360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium663Open in IMG/M
3300016270|Ga0182036_10005453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium6401Open in IMG/M
3300016270|Ga0182036_10228886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1380Open in IMG/M
3300016270|Ga0182036_10656433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium845Open in IMG/M
3300016294|Ga0182041_10609035All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium960Open in IMG/M
3300016294|Ga0182041_10630140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium945Open in IMG/M
3300016319|Ga0182033_10001891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium10569Open in IMG/M
3300016341|Ga0182035_10507140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1031Open in IMG/M
3300016341|Ga0182035_11270360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium659Open in IMG/M
3300016357|Ga0182032_12036072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300016371|Ga0182034_10002581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium9258Open in IMG/M
3300016387|Ga0182040_10320863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1191Open in IMG/M
3300016387|Ga0182040_10522540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium951Open in IMG/M
3300016404|Ga0182037_10005211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium7179Open in IMG/M
3300020581|Ga0210399_11096516All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300021938|Ga0213847_1138205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium624Open in IMG/M
3300022171|Ga0213857_1055202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300022507|Ga0222729_1040077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300022533|Ga0242662_10189967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300022722|Ga0242657_1135124All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300022722|Ga0242657_1138664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium632Open in IMG/M
3300022724|Ga0242665_10385008All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium509Open in IMG/M
3300030743|Ga0265461_12991115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300030916|Ga0075386_11445705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium625Open in IMG/M
3300030969|Ga0075394_10926513All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium571Open in IMG/M
3300031545|Ga0318541_10009795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4267Open in IMG/M
3300031546|Ga0318538_10580064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300031564|Ga0318573_10521436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300031572|Ga0318515_10202577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1064Open in IMG/M
3300031572|Ga0318515_10409438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium726Open in IMG/M
3300031572|Ga0318515_10784426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031573|Ga0310915_10015885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4485Open in IMG/M
3300031590|Ga0307483_1042591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300031640|Ga0318555_10158936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1212Open in IMG/M
3300031640|Ga0318555_10711554All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300031668|Ga0318542_10442445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium673Open in IMG/M
3300031679|Ga0318561_10044077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2210Open in IMG/M
3300031679|Ga0318561_10792978All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium520Open in IMG/M
3300031679|Ga0318561_10854295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300031680|Ga0318574_10435962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium766Open in IMG/M
3300031680|Ga0318574_10808178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M
3300031681|Ga0318572_10103146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1612Open in IMG/M
3300031681|Ga0318572_10722954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300031682|Ga0318560_10010123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium4030Open in IMG/M
3300031713|Ga0318496_10674628All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300031719|Ga0306917_10361808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1129Open in IMG/M
3300031719|Ga0306917_10957197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium669Open in IMG/M
3300031719|Ga0306917_11226021All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium582Open in IMG/M
3300031724|Ga0318500_10073624All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1506Open in IMG/M
3300031724|Ga0318500_10222698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium909Open in IMG/M
3300031744|Ga0306918_10074310All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2345Open in IMG/M
3300031751|Ga0318494_10214182All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1100Open in IMG/M
3300031751|Ga0318494_10912600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium515Open in IMG/M
3300031763|Ga0318537_10241274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300031770|Ga0318521_10150060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1323Open in IMG/M
3300031770|Ga0318521_10153215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1309Open in IMG/M
3300031770|Ga0318521_10366684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium855Open in IMG/M
3300031771|Ga0318546_11039027All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300031780|Ga0318508_1021998All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1557Open in IMG/M
3300031781|Ga0318547_10888955All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium556Open in IMG/M
3300031782|Ga0318552_10424603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium678Open in IMG/M
3300031792|Ga0318529_10253593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium819Open in IMG/M
3300031792|Ga0318529_10572354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031793|Ga0318548_10465886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium618Open in IMG/M
3300031796|Ga0318576_10627160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300031797|Ga0318550_10599519All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium529Open in IMG/M
3300031798|Ga0318523_10345293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium741Open in IMG/M
3300031821|Ga0318567_10061707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1962Open in IMG/M
3300031821|Ga0318567_10261647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium973Open in IMG/M
3300031832|Ga0318499_10366361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium553Open in IMG/M
3300031890|Ga0306925_10530518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1250Open in IMG/M
3300031893|Ga0318536_10527926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium592Open in IMG/M
3300031897|Ga0318520_10074295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1852Open in IMG/M
3300031910|Ga0306923_10286166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1884Open in IMG/M
3300031910|Ga0306923_11144259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium835Open in IMG/M
3300031942|Ga0310916_10154871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1893Open in IMG/M
3300031942|Ga0310916_10181579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1753Open in IMG/M
3300031945|Ga0310913_10841997All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium646Open in IMG/M
3300031946|Ga0310910_11115849All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300031947|Ga0310909_10297350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1352Open in IMG/M
3300031962|Ga0307479_10550455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1137Open in IMG/M
3300031981|Ga0318531_10268541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300032001|Ga0306922_12269334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
3300032010|Ga0318569_10354536All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium684Open in IMG/M
3300032035|Ga0310911_10131296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1398Open in IMG/M
3300032041|Ga0318549_10160615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1003Open in IMG/M
3300032044|Ga0318558_10013419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3156Open in IMG/M
3300032051|Ga0318532_10135707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium873Open in IMG/M
3300032051|Ga0318532_10353292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium522Open in IMG/M
3300032052|Ga0318506_10117206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1149Open in IMG/M
3300032059|Ga0318533_10237100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1314Open in IMG/M
3300032060|Ga0318505_10240839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium851Open in IMG/M
3300032063|Ga0318504_10420910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium637Open in IMG/M
3300032067|Ga0318524_10369610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium746Open in IMG/M
3300032089|Ga0318525_10681592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300032090|Ga0318518_10099771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1448Open in IMG/M
3300032091|Ga0318577_10221927All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300032094|Ga0318540_10266894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium826Open in IMG/M
3300032180|Ga0307471_101612125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium805Open in IMG/M
3300033289|Ga0310914_10037879All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium3903Open in IMG/M
3300033289|Ga0310914_10855297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium808Open in IMG/M
3300033289|Ga0310914_11214255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium656Open in IMG/M
3300033289|Ga0310914_11749073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300033290|Ga0318519_10892071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium549Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil66.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.49%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.20%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.52%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002660Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF103 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300004135Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021938Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - EE:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022171Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022527Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031590Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0005454J37223_10554613300002660Forest SoilTVTGVQIGDVRFDKTTAGAPLPNVLSKTNLTFLTLDVLSDEPNAPTFIDIDFWNESQATVAGSSSPSFEHLTSTFTEFVCWNQVPLSSLAGGNLTQAFQGTRKGVVIAGPAMKIPDGNAPADVSSPTAVTLIGLVETVEGTAANGFLERKYNFNLQTNGVPVATTFVPSPIFP*
Ga0058884_140206713300004135Forest SoilVRFDKTTPGAPLPNVLGRTAITFLTLDVLSNQPNDPTFINLNFWNESLGSAVGSTNPAFEHLTSTFREFVCWYQAPLSALAGGNLTQAFQGTRKGIVIAGPATKLADGNAPGDTPGPVTLIGVVETTEGTAANGFLERKYNFNMDTNGIPVGTAFVPLPIFP*
Ga0058897_1099081913300004139Forest SoilDGAPGHYTMITGVQYGDVKFDKTTTGAPLPNVLSRTALTLLTLDVLSSAPNSPTFVNLDFYNESQIQSGNANAFEHLTSTYREFVCWDQFPISALAGGALTQAFQGTRKGIVIAGPAVKMGDGNAPGDPPGPVTLIGLVETIEGTAANNFLERKYNFNMSNDGFPVPTAFVTLPRRHPPTAP*
Ga0058897_1109154613300004139Forest SoilPVPAAADGTLRFGVTGGYTTVTGVQIGDVRFDKTVAGAPLPNVLGRTAITFLTLDVLSNQPNDPTFINLNFWNESLGSAVGSTNPAFEHLTSSFTEFVCWVQAPLAALAGGNLTQAFQGTRKGIVIAGPAVKLADGNAPLDTPGAVTLIGVVETTEGTAANGFLERKYNFNMDT
Ga0058899_1166875713300004631Forest SoilATVTGVQIGDVRFDRITSSAAAAIAPNILGRTNLNFLTLDVLSNAPNDPTLVNLNFWNESLGTAVGSSNPAFEHLTSTSVEFVCWTQTPLSAVGGGNLTQVFQGTRKGILIAGPANKVQDGNAPGDDPGPVTLIGLVETIEGTAANGFLERKYNFNMDGNGIPVTTAFVPLPIFP*
Ga0058899_1179801713300004631Forest SoilGVAIGDVRFDKTTPGAPLPNVLSRTSLTLLTLDVLSDLPNNPTFVAMDFWNESLTNSIGSGSTLFEHLTSTFTEFVCWNQVPLSSLAGGNLTQAFQGTRKGVVIAGPAMKIPDGNAPADVSSPTAVTLIGLVETVEGTAANGFLERKYNFNLQTNGVPVATTFVPSPIFP*
Ga0066388_10128204613300005332Tropical Forest SoilTAPGAPLPNVLSKTALVLLTLDVNSNALNPFTNVNLDFYNESQIQSGNVNAFEHLTSTSTHFICWNQVPLANLAGGALTQAFQGTRKGIVIAGPATQAGGTGGGQATLIGLVETLEGTVANGFLERKYNFNMNTNGIPQPTAFVPLPAFP*
Ga0126379_1328894913300010366Tropical Forest SoilQIGDVRFDKTAAGNPLPNVLSKTALIFLNLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSASVEFLCWVQVPLSTLAGGNLTQAFQGTRKGVVIAGPAQKMRDGNAPGDTPGPVTLIGLVETIEGTTANSFEERKYNFNMSTNGVSQPIAFVPLPSFP*
Ga0126381_10088176113300010376Tropical Forest SoilGVQLGDVRFDRITSSSLAAIAPNILSKTALVFLTLDVLSSAPNDPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQTPLSAVGGGNLTQVFQGTRKGVVIAGPAHKMQDGNAPGDAPGPVTLIGLVETVEGTAPNGFLERKYNFNMSNDSNPVPTAFVP*
Ga0126381_10269964713300010376Tropical Forest SoilPAAGSSTAVSAYNAITFQANPAGPGLTTTSAVQIGDVRFDKTTPGSPLPNVLSKTSLIFLTMDVLANQPNDPVDLNLNFWNESLGSAVGSTNPAFEHLTSTFTEFVCWGQIPLSALAGASLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGRATLIGLVETTEGTAANGFLERKYNFNMSTNGIPQVTAFVPLPSFP*
Ga0126381_10271019623300010376Tropical Forest SoilIAPNILGRTSLNFLTLDVLSNAPNDPTLVNLNFWNESLGTAVGSTNPAFEHLTSTSVEFVCWTQTPLSAVGGGNLTQAFQGTRMGVLIAGPAHKVADGNAPGDPPGPVTLIGLIETVEGTAANGFLERKYNFNMSNDGVLVPTAFVP*
Ga0126381_10306436013300010376Tropical Forest SoilGVQIGDVRFDRTAVSTTAPPNVLGRTSLNLLTLDVNSNAVNPFTNVNLDFYNESQIQSGNVNAFEHLTSTSTHFICWNQVPLANLAGGALTQAFQGTRKGIVIAGPATQAGGTGGGQATLIGLVETLEGTVANGFLERKYNFNMDTNGIPQPTAFVPLPAFP*
Ga0150983_1194608713300011120Forest SoilYNAITIQADPALANLAAISPPFLSFDGAPGHYLALTGVAIGDVKFDKTTAGAPLPNVLSKTSLTLLTLDVLSDAPNNPTFVGIDFWNESNGAAVGSTVPTFEHLTSTFTSFVCWNQVPLSTLGGGNLTQAFQTTRKGVFIAGPAQKIADGNAPTDTTGNVTLIGLVETVEGTAANSFLERKYNFNTQDNSIVVTTSFVPLPVFP*
Ga0182036_1000545323300016270SoilMAAGSPPPNILGKTNFNFPTLDIRSNAPNSPTFVNLNFWNESLGIAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANDFLERKYNFNMSTDGVPVSTAFVP
Ga0182036_1022888613300016270SoilSTAAAIAPNILGRTNFNFLTLDVMSNRPNSPTFINLDFWNESLGLAVGSSNPAFEHLISSFTEFVCWTQVPLSALAGGSLTQTAQGTRKGVVSAGPANKIADGNAPADLPGPVTLLGLVETVEGTAANGFLERKYNFGMTHDGTPIAGEFVP
Ga0182036_1065643313300016270SoilKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIAGPATKIADGNAPADHPGPVTLLGLVETIEGTAANGFLERKYNFNMNSNGVPVAAAFVP
Ga0182041_1060903523300016294SoilVAGPNAGSSTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTLVNLTFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANSFLERKYNFNMSTNGIPQPIALVTLPSFP
Ga0182041_1063014013300016294SoilAPSTAAAIAPNILGRTNFNFLTLDVMSNRPNSPTFINLDFWNESLGLAVGSSNPAFEHLISSFTEFVCWTQVPLSALAGGSLTQTAQGTRKGVVSAGPANKIADGNAPADLPGPVTLLGLVETVEGTAANGFLERKYNFGMTHDGTPIAGEFVP
Ga0182033_10001891113300016319SoilMAVTGVQIGDVRFDKMAPGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANDFLERKYNFNMSTDGVPVSTAFVP
Ga0182035_1050714023300016341SoilSKTSLTFLTLNTLANQPNDPTLVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQSFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAVNGFLERKYNFNMSTNGIPQPIALVTLPSFP
Ga0182035_1127036013300016341SoilHAGSSTGLSAYTPITIAADPTLANLAPIADQPGPLLFDGTLGHYTQIAGVQIGDVRFDKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIAGPATKIADGNAPADHPGPVTLLGLVETIEGTAANGFLERKYNFNMNSNGVPVAAAFVP
Ga0182032_1203607213300016357SoilSSTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANSFLERKYNF
Ga0182034_1000258193300016371SoilMAVTGVQIGDVRFDKMAAGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANDFLERKYNFNMSTDGVPVSTAFVP
Ga0182040_1032086323300016387SoilSSTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTLVNLNFWNESLGNAVGSTNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQSFQGTRKGIVIAGPAQKVGDGNAPGDTAGPVTLIGLVETVEGTAANSFLERKYNFNMSTNGIPLPIALVTLPSFP
Ga0182040_1052254013300016387SoilLANLAPIANQPGPLLFDGAPGHYTQITGVQIGDVRFDRIAPSTAAAIAPNILGRTNFNFLTLDVMSNRPNSPTFINLDFWNESLGLAVGSSNPAFEHLISSFTEFVCWTQVPLSALAGGSLTQTAQGTRKGVVSAGPANKIADGNAPADLPGPVTLLGLVETVEGTAANGFLERKYNFGMTHDGTPIAGEFVP
Ga0182037_1000521123300016404SoilMAVTGVQIGDVRFDKMAAGSPPPNILGKTNFNFPTLDIRSNAPNSPTFVNLNFWNESLGIAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANDFLERKYNFNMSTDGVPVSTAFVP
Ga0210399_1109651613300020581SoilSTAVSAYQAITIQADTAITGVQIGDVKFDKTTAGDPLPNVFSKSSLIFLTLDVRAGQPNAPTFVNLDFSNESLGNGVGSTNPAFEHLTSTFLEFVCWSQVPLSDLAGGSLTQAFQRTRKGIVIAGPAEKLQDGNAPGDRPGPVTLIGMVETVEGTAANSFLERKYNFNMSTDGFPVQPTFLTLPRRH
Ga0213847_113820513300021938WatershedsGAAIANQPGPLAFDNSPGHYRAITSVAIGDVKYDKTVAGAPLPNVLSKTALVLLTLDVFSSAPNSPTLVNLDFWNESNGNAVGSTLPNFERLISSFREFVCWDQFPLSAVAGVNLTQAAYGTRKGIVIAGPAIKVSDGNAPLDVPPAQGVTLLGLVETIEGTAANGFMERKYNFNMDNDGFAVPTNFVPLTRRH
Ga0213857_105520213300022171WatershedsVAGAPLPNVLSKTALTLLTLDVLSSAPNSPTLVNLDFWNESNGNAVGSTLPNFERLISTFREFVCWDQFPLSAVAGGNLTQAAYGTRKGVVIAGPANKVFDGNAPQDPPGPVTLLGLVETIEGTVANNFMERKYNFNMSNDGFPVPTAFVPLTRRH
Ga0222729_104007713300022507SoilPALTFACFPGPATTDATGVLRFDGAPGHYTMITGVQYGDVKFDKTTTGAPLPNVLSRTALTLLTLDVLSSAPNSPTFVNLDFYNESQIQSGNANAFEHLTSTYREFVCWDQFPISALAGGALTQAFQGTRKGIVIAGPAQKMSDGNAPGDPARPVTLIGLVETIEGTAANNFLERKYNFNMSNDGFPVPTAFVTLPRRHPPTAP
Ga0242664_108709213300022527SoilGPGLVFDGAPGHYLALTGVAIGDVRFDKTTPGAPLPNVLSRTSLTLLTLDVLSDLPNNPTFVGIHFWNESLGSAVGSTNPAFEHLTSTFTSFVCWEQVSLAALGGGNLTQAFQQTRKGVFIAGPAQKEADGNAPNDHPIIGTDPSPFPVTLIALVETIEGTVANGFLERKYNFNTQNDSFVVPTTFVPLAVFP
Ga0242662_1018996713300022533SoilVFSKSSLIFLTLDVRAGQPNAPTFVNLDFSNESLGNGVGSTNPAFEHLTSTFLEFVCWSQVPLSDLAGGSLTQAFQRTRKGIVIAGPAEKLQDGNAPGDRPGPVTLIGLVETVEGTAANSFLERKYNFNMSTDGFPVQPTFLTLPRRH
Ga0242657_113512413300022722SoilAIANLAAVPAAQSGSLAFGVAGGYATVTGVQIGDVRFDRITSSAAAAIAPNILGRTNLNFLTLDVLSNAPNDPTLVNLNFWNESLGTAVGSSNPAFEHLTSTSVEFVCWTQTPLSAVGGGNLTQVFQGTRKGILIAGPANKVQDGNAPGDDPGPVTLIGLVETIEGTAANGFLERKYNFNMDGNGIPVTTAFVPLPIFP
Ga0242657_113866413300022722SoilTIQADAAIPTIQPPDSTAATTVPGAAVPAAADGILRFGVPGGYTTVSSVQIGDVRFDKTAPGTPLPNILGRTSITFLTLDINSNAPNSPVDLNLNFWNESNELAVGSTDPRFEHLQSTFTEFVCWEQVPLSALAGGALTQAFQGTRKGIVIAGPANKVSDGNAPQDPPGPVTLIGVVETTEGTVANNFLERKYNFNMSTNGVPQTTAFVP
Ga0242665_1038500813300022724SoilLRFDGAPGHYTMITGVQYGDVKFDKTTTGAPLPNVLSRTALTLLTLDVLSSAPNSPTFVNLDFYNESQIQSGNANAFEHLTSTYREFVCWDQFPISALAGGALTQAFQGTRKGIVIAGPAVKMGDGNAPGDPPGPVTLIGLVETIEGTAANNFLERKYNFNMSNDGFPV
Ga0265461_1299111513300030743SoilLTGVAIGDVRFDKTTSGAPLPNVLSKTSLTLLTLDVLSDAPNNPTFVGIDFWNESNGAAVGSTVPTFEHLTSTFTSFVCWNQVPLSTLGGGNLTQAFQGTRKGVFIAGPAEKIADGNAPGDTTGNVTLIGLVETTEGTAANSFLERKYNFNTQDNSIVVTTSFVPLPVFP
Ga0075386_1144570513300030916SoilALANLALIADQPGPLLFDGAPGHYTAITGVQIGDVKFDKTAPGAPLPNVLTRTNFNFLTLDVRSNQPNSPTFINLHFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALGGGSLTQASQGTRKGLVIAGPANKLADGNAPQDPPGPVTLIGLIETVEGTVANGFLERKYNFNMQNDSFPVNTTFFPRPGT
Ga0075394_1092651313300030969SoilVQIGNVKFDRIAPSALPAIAPNVLSRTNLNFLTLDVRSNAPNSPTFVNLDFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALGGGNLTQAFQGTRKGLVIAGPANKLADGNAPQDPPGPVTLIGLIETVEGTVANSFLERKYNFNMSHDGIPVPTAFEPLGSVVP
Ga0318541_1000979523300031545SoilPNILGKTNFNFPTLDIRSNAPNSPTFVNLNFWNESLGIAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318538_1058006413300031546SoilSDGTLGHYTQIAGVQIGDVRFDKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIAGPATKIADGNAPADHPGPVTLLGLVETIEGTAANGFLERKYNFNMNSNGVPVAAAFVP
Ga0318573_1052143613300031564SoilVIRNGNLVAGPNAGSSTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQSFQGTRKGIVIAGPAQKVGDGNAPGDTAGPVTLIGLVETVEGTAANSFLERKYNFNMSTNGIPLPIALVTLPSFP
Ga0318515_1020257713300031572SoilNLAPVPAASGGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318515_1040943813300031572SoilPTLANLAPIADQPGPLLFDGTLGHYTQIAGVQIGDVRFDKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIAGPATKIADGNAPADHPGPVTLLGLVETIEGTAANGFLERKYNFNMNSNGVPVAAAFVP
Ga0318515_1078442613300031572SoilLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRKGIVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANDFLERKYNFNMSTDGVPVSTAFVP
Ga0310915_1001588513300031573SoilMAVTGVQIGDVRFDKMAAGSPPPNILGKTNFNFPTLDIRSNAPNSPTFVNLNFWNESLGIAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0307483_104259113300031590Hardwood Forest SoilGDVRFDKTAPGAPLPNVLGRTSLTFLTLDVLSNQPNDPTFINLNFWNESLGSAVGSTNPAFEHLTSTFREFVCWDQAPLAALAGGNLTQAFQGTRKGIVIAGPAVKLADGNAPGDTPGPVTLIGVVETTEGTAANGFLERKYNFNMDTNGIPVGTAFVPLPIFP
Ga0318555_1015893623300031640SoilVQIGDVRFDRITSSSALAIAPNILSRTNLNFLTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318555_1071155413300031640SoilAALPGVEIGDVRFDKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIYNMYNDNSMVPTRFVPSD
Ga0318542_1044244513300031668SoilFDKMAAGSPPPNILGKTNFNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318561_1004407723300031679SoilMAVTGVQIGDVRFDKMAAGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318561_1079297813300031679SoilIAADPTLANLAPIADQPGPLLFDGTLGHYTQIAGVQIGDVRFDKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIAGPATKIADGNAPADHPGPVTLLGLVETIEGTAAN
Ga0318561_1085429513300031679SoilAIGSPLIFDGTNHYAALPGVEIGDVRFDKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIY
Ga0318574_1043596223300031680SoilIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAVNGFLERKYNFNMSTNGIPQPIALVTLPSFP
Ga0318574_1080817813300031680SoilPNILGKTNFNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318572_1010314613300031681SoilFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318572_1072295413300031681SoilTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSIEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0318560_1001012313300031682SoilNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318496_1067462813300031713SoilVRFDKTAAGDPLPNVLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0306917_1036180813300031719SoilKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIYNMYNDNSMVPTRFVPSD
Ga0306917_1095719713300031719SoilIPATAVDGSLHFGVTGGYTTITGVQIGDVRFDKTTAGDPLPNVLGTTSLVFLTLDVLSNRPNNPVFVNLNFWNESLGSTDDSTDPAFEHMISTFTEFVCWTQVPLANIAGGSLTQAFQGTRKGVLIAGPATKMASTGAPGDTVGPVTLIGLVQTIEGTSANAFMERGYIFTMVTNGVLVPTTFVP
Ga0306917_1122602113300031719SoilAVIRNGNLVAGPNAGSSTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAVNGFLERKYNFNMSTNGIPQPI
Ga0318500_1007362413300031724SoilVAGPNAGSSTGISAYQAITIQAGTGITGLQIGDVRFDKTAAGDPLPNVLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNQAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0318500_1022269813300031724SoilGTPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0306918_1007431023300031744SoilGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0306918_1030776433300031744SoilNSPTFVALNFWNESLGSAVGSTNPAFEHLTSTFREFVCWDQFPLSAVGGGNLTQAFQGTRKGVVIAGPATKIQDGNAPQDPPGPVTLIGMVETVEGSVANGFLERKYNFNMSDNGIPVPTAFAPLPIFP
Ga0318494_1021418223300031751SoilPLPSVLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0318494_1091260013300031751SoilDPALANLAPVPAASGGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANNF
Ga0318537_1024127413300031763SoilGLSAYNAVPIQADPALANLAPVPAASGGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318521_1015006023300031770SoilPPPNILGKTNFNFPTLDIRSNAPNSPTFVNLNFWNESLGIAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318521_1015321523300031770SoilRFDKTAAGDPLPNVLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0318521_1036668413300031770SoilPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318546_1103902713300031771SoilAYNAIPIQADPALANLAPIANQPGPLLFDGAPGHYTQITGVQIGDVRFDRIAPSTAAAIAPNILGRTNFNFLTLDVMSNRPNSPTFINLDFWNESLGLAVGSSNPAFEHLISSFTEFVCWTQVPLSALAGGSLTQTAQGTRKGVVSAGPANKIADGNAPADLPGPVTLLGLVETVEGTAANGFLERKYNFG
Ga0318508_102199823300031780SoilNRDRSLFDGAPGHYMAVTGVQIGDVRFDKMAAGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFV
Ga0318547_1088895513300031781SoilAGSSTGISAYQAITIQAGTGITGLQIGDVRFDKTAAGDPLPNVLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVP
Ga0318552_1042460313300031782SoilSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKIEDGNAPDDDAGPVTLIGLVETIEGTAANNFLERKYNFGMSTNGVPIGTEFVPLPIPVGTP
Ga0318529_1025359313300031792SoilTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0318529_1057235413300031792SoilVPAASGGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANNFLERKYNFNMSND
Ga0318548_1046588613300031793SoilDRSLFDGAPGHYMAVTGVQIGDVRFDKMAAGSPPPNILGKTNFNFPTLDIRSNAPNSPTFVNLNFWNESLGIAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318576_1062716013300031796SoilGYAIGSPLIFDGTNHYAALPGVEIGDVRFDKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIY
Ga0318550_1045421813300031797SoilPNLVAGPNAGMSTGLSAYNAIPIQADPALANLAPIANQPGPLLFDGAPGHYTQITGVQIGDVRFDRIAPSTAAAIAPNILGRTNFNFLTLDVMSNRPNSPTFINLDFWNESLGLAVGSSNPAFEHLISSFTEFVCWTQVPLSALAGGSLTQTAQGTRKGVVSAGPANKIADGNAPADLPGPVTLLGLVETVEGTAANGFLERKYN
Ga0318550_1059951913300031797SoilFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKIEDGHAPDDDAGPVTLIGLVETIEGTAANNFLERKYNFGMSTNGVPIGTEFVPLPIPSGGTP
Ga0318523_1034529313300031798SoilPAAADGTLRFGVANGYTTVTGVQIGDVRFDRITSSSALAIAPNILSRTNLNFLTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANNFLERKYNFNMSNDSNPVPTAFVP
Ga0318567_1006170733300031821SoilMAVTGVQIGDVRFDKMAPGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318567_1026164713300031821SoilNILSRTNLNFLTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318499_1036636113300031832SoilLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNQAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0306925_1053051823300031890SoilTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAVNGFLERKYNFNMSTNGIPQPIALVTLPSFP
Ga0318536_1052792613300031893SoilPNILSRTNLNFLTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKIEDGNAPDDDAGPVTLIGLVETIEGTAANNFLERKYNFNMNNNSVPVATDFVPLPSLGAPMP
Ga0318520_1007429523300031897SoilMAVTGVQIGDVRFDKMAAGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAMGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0306923_1028616623300031910SoilLFDGAPGHYTAVTGVQIADVRFDKMAAGSPPPNILGKTNFNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0306923_1114425923300031910SoilAPVPAASGGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVLSNAPNDPTFVNLDFWNESLGTAVGSTNPAFEHLTSTFREFVCWDQVPLSALAGGDLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0310916_1015487123300031942SoilRDRSLFDGAPGHYMAVTGVQIGDVRFDKMAPGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0310916_1018157923300031942SoilHYAALPGVEIGDVRFDKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIYNMYNDNSMVPTRFVPSD
Ga0310913_1084199713300031945SoilHYTQIAGVQIGDVRFDKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIGGPATKIADGNAPADHPGPVTLLGLVETIEGTAANGFLERKYNFNMNSNGVPVAAAFVP
Ga0310910_1111584913300031946SoilAPIANQPGPLLFDGAPGHYTQITGVQFGDVRFDRMTASSSPAIAPNLLGRTALIFLTLDVLSNRPNAPTFVNFEFSNESLGTAVGSSNPAFEHLTSTSVEFVCWNQMRLSDFGGGSLTQTFQGTRNGIVIAGPAEKIADGNAPADPSRPVTLIGQVETIEGTAANDFLERKYNFNMNNNSVPVATDFVPLPSLGAPMP
Ga0310909_1029735023300031947SoilSSALAIAPNILSRTNLNFLTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKIEDGHAPDDDAGPVTLIGLVETIEGTAANNFLERKYNFGMSTNGVPIGTEFVPLPIPVGTP
Ga0307479_1055045513300031962Hardwood Forest SoilITIQDGTAITGTQIGDVRFDKTTAGAPLPNVLGKTSLTFLTLNTLANQPNDPTLVNLNFWNESLGNAVGSTNPAFEHLTSTSVEFVCWTQVPLSALGGGNLTQSFQGTRKGIVIAGPAQKVRDGNAPADTPGPVTLIGLVETVEGTAANSFLERKYNFNMSTNGIPQPIALVTLPSFP
Ga0318531_1026854113300031981SoilPVWPQLPINRDRSLFDGAPGHYMAVTGVQIGDVRFDKMAPGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0306922_1226933413300032001SoilVAGPNAGSSTAVSAYQAITIQDGTTITGTQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAVNGFLERKY
Ga0318569_1035453613300032010SoilSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0310911_1013129613300032035SoilQIGDVRFDKTTAGAPLPNVLSKTSLTFLTLNTLANQPNDPTFVNLNFWNESLGNAVGSSNPAFEHLTSTFVEFVCWTQVPLSALGGGNLTQAFQGTRKGIVIAGPAQKVRDGNAPGDTPGPVTLIGLVETIEGTAANSFLERKYNFNMSTNGIPLPIALVTLPSFP
Ga0318549_1016061513300032041SoilTALLFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0318558_1001341913300032044SoilRHWPVWPQLPINRDRSLFDGAPGHYMAVTGVQIGDVRFDKMAAGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318532_1013570713300032051SoilTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKIEDGHAPDDDAGPVTLIGLVETIEGTAANNFLERKYNFGMSTNGVPIGTEFVPLPIPVGTP
Ga0318532_1035329213300032051SoilNPGYAIGSPLIFDGTNHYAALPGVEIGDVRFDKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIYNMYN
Ga0318506_1011720623300032052SoilGLSAYNAIAIQADPALANLAPIANQPGPLLFDGAPGHYTAVTGVQIGDVRFDKMAAGSPPPNILGKTNLNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318533_1023710013300032059SoilGVQIGDVRFDRITSSSALAIAPNILSRTNLNFLTLDVLSNQPNDPVFINLNFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318505_1024083913300032060SoilDKTTPGAPMPNVLGRTNLNFLTLNVLSNRPNNPTFVNLDFWNESLGSAVGSTNPAFEHRTSSFTEFVCWTQVPLSALAGGSLTQAFQGTRKGVVIGGPATKIADGNAPADHPGPVTLLGLVETIEGTAANGFLERKYNFNMNSNGVPVAAAFVP
Ga0318504_1042091013300032063SoilNAIAIPADPALANLAPIANQPGPLLFDGAPGHYTAVTGVQIADVRFDKMAAGSPPPNILGKTNFNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318524_1036961023300032067SoilTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0318525_1068159213300032089SoilVPIQADPALANLAPVPAASDGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAAN
Ga0318518_1009977123300032090SoilPIWPQLPINRDRSLFDGAPGHYMAVTGVQIGDVRFDKMAAGSPPPNILGKTNFNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0318577_1022192723300032091SoilAYRGITIQAANEAQPTFPNPGYAIGSPLIFDGTNHYAALPGVEIGDVRFDKTIAGAPLPNILGKTALTLLTLDVLSDAPNDPTFVNLNFWNESLGSAVGSSNPAFEHLTSTFTEFVCWTQVPLSALAGGNLTQAFQQTRTGVVIAGPATKIADGNAPGDVPGPATLVGLVETTEGTAANGFLERKYIYNMYNDNSMVPTRFVPSD
Ga0318540_1026689423300032094SoilVPAASGGSLPFGITGGYATVTGVQIGDVRFDKTAAGSPLPNILSRTNLNFLTLDVRSNAPNDPTFVNLDFWNESLGLAVGSSNPAFEHLTSTFREFVCWDQVPLSALAGGNLTQTFQGTRKGIVIAGPANKMRDGNAPGDAPGPVTLIGLVETIEGTAANDFLERKYNFNMSNDSNPVPTAFVP
Ga0307471_10161212513300032180Hardwood Forest SoilVLGKTSLTFLTLNTLANQPNDPTLVNLSFWNESLGNAVGSTNPAFEHLTSTSVEFVCWTQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKIADGNAPGDAPGPVTLIGLVETIEGTAPNAFMERKYNFNLYGEGLPVPTCLGAQGPCPPTLVLSSPPDSVNFCSTGPTAKARVT
Ga0310914_1003787923300033289SoilMAVTGVQIGDVRFDKMAAGSPPPNILGKTNFNFLTLDIRSNAPNSPTFVNLNFWNESLGSAVGSTNPAFEHLTSTAVEFVCWTQVPLSALGGGSLTQAFQGTRSGVVIAGPAGKIADGHAPGDLPGPATLIGLVETVEGTAANGFLERKYNFNMSTDGVPVSTAFVP
Ga0310914_1085529723300033289SoilVLSKTALIFLTLNVLANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSTSVEFLCWVQVPLSALAGGNLTQAFQGTRKGVVIAGPAQKVRDGNAPGDTPGPVTLIGLVETVEGTAANGFLERKYNFNMSTNGVPQPIAFVPLPNFP
Ga0310914_1121425513300033289SoilPALPTLAPIPLAAGGTLPLGVAGGYTGVAGVQIGDVRFDKTTAGDPLPNVLGTTSLVFLTLDVLSNRPNNPVFVNLNFWNESLGSTDDSTDPAFEHMISTFTEFVCWTQVPLANIAGGSLTQAFQGTRKGVLIAGPATKMASTGAPGDTVGPVTLIGLVQTIEGTSANAFMERGYIFTMVTNGVLVPTTFVP
Ga0310914_1174907313300033289SoilAITIQANTAITGGQIGDVRFDKTTAAAPLPNVLSRTSLIFLTLNVAANQPNDPTLVNLDFWNESLGNAVGSTNPAFEHLTSSSVEFVCWVQVPLSALAGGNLTQSFQGTRKGVVVAGPAQKLRDGHAPGDRPGPVTLIGLVETVEGTAANSFEERKYNFNMSANGALVPTRFVPL
Ga0318519_1089207113300033290SoilFDGAPGHYTQITGVQIGDVRFDRIAPSTAAAIAPNILGRTNFNFLTLDVMSNRPNSPTFINLDFWNESLGLAVGSSNPAFEHLISSFTEFVCWTQVPLSALAGGSLTQTAQGTRKGVVSAGPANKIADGNAPADLPGPVTLLGLVETVEGTAANGFLERKYNFGMTHDGTPIAGEFVP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.