Metagenome Family F073936

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F073936
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	37 residues
Representative Sequence	MTGRAFFAMLIFVGFVVAVMWFAVLPALTTFRPTLP
Number of Associated Samples	84
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	44.17 %
% of genes near scaffold ends (potentially truncated)	15.83 %
% of genes from short scaffolds (< 2000 bps)	61.67 %
Associated GOLD sequencing projects	77
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (98.333 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.667 % of family members)
Environment Ontology (ENVO)	Unclassified (39.167 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (60.000 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.75% β-sheet: 0.00% Coil/Unstructured: 56.25%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF00892	EamA	29.17
PF13602	ADH_zinc_N_2	21.67
PF08768	THAP4_heme-bd	10.83
PF02735	Ku	5.00
PF00106	adh_short	3.33
PF00571	CBS	2.50
PF07920	DUF1684	2.50
PF02574	S-methyl_trans	1.67
PF13683	rve_3	0.83
PF00005	ABC_tran	0.83
PF14329	DUF4386	0.83
PF10604	Polyketide_cyc2	0.83
PF14333	DUF4389	0.83
PF00682	HMGL-like	0.83
PF04607	RelA_SpoT	0.83
PF07690	MFS_1	0.83
PF01642	MM_CoA_mutase	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG1273	Non-homologous end joining protein Ku, dsDNA break repair	Replication, recombination and repair [L]	5.00
COG3358	Uncharacterized conserved protein, DUF1684 family	Function unknown [S]	2.50
COG0646	Methionine synthase I (cobalamin-dependent), methyltransferase domain	Amino acid transport and metabolism [E]	1.67
COG2040	Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)	Amino acid transport and metabolism [E]	1.67
COG1884	Methylmalonyl-CoA mutase, N-terminal domain/subunit	Lipid transport and metabolism [I]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	98.33 %
Unclassified	root	N/A	1.67 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	98.33 %
Unclassified	root	N/A	1.67 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	98.33 %
Unclassified	root	N/A	1.67 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	54.17 %
Unclassified	root	N/A	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	12.50 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	10.83 %
Unclassified	root	N/A	1.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	10.00 %
unclassified Actinobacteria	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria	3.33 %
Unclassified	root	N/A	1.67 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	10.00 %
Actinobacteria bacterium 13_1_40CM_2_65_8	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8	3.33 %
Unclassified	root	N/A	1.67 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001086\|JGI12709J13192_1000410	All Organisms → cellular organisms → Bacteria	7894	Open in IMG/M
3300001145\|JGI12682J13319_1008781	All Organisms → cellular organisms → Bacteria → Terrabacteria group	778	Open in IMG/M
3300001661\|JGI12053J15887_10007316	All Organisms → cellular organisms → Bacteria	5930	Open in IMG/M
3300002245\|JGIcombinedJ26739_100099628	All Organisms → cellular organisms → Bacteria	2719	Open in IMG/M
3300002245\|JGIcombinedJ26739_101591122	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	550	Open in IMG/M
3300002560\|JGI25383J37093_10137142	All Organisms → cellular organisms → Bacteria → Terrabacteria group	663	Open in IMG/M
3300005178\|Ga0066688_10005141	All Organisms → cellular organisms → Bacteria → Proteobacteria	5937	Open in IMG/M
3300005540\|Ga0066697_10008207	All Organisms → cellular organisms → Bacteria	5255	Open in IMG/M
3300005540\|Ga0066697_10014236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4184	Open in IMG/M
3300005540\|Ga0066697_10035323	All Organisms → cellular organisms → Bacteria	2787	Open in IMG/M
3300005540\|Ga0066697_10119880	All Organisms → cellular organisms → Bacteria	1542	Open in IMG/M
3300005542\|Ga0070732_10621494	All Organisms → cellular organisms → Bacteria → Terrabacteria group	656	Open in IMG/M
3300005552\|Ga0066701_10004941	All Organisms → cellular organisms → Bacteria	5459	Open in IMG/M
3300005552\|Ga0066701_10100507	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1688	Open in IMG/M
3300005552\|Ga0066701_10131392	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1492	Open in IMG/M
3300005554\|Ga0066661_10041842	All Organisms → cellular organisms → Bacteria	2589	Open in IMG/M
3300005554\|Ga0066661_10401013	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300005555\|Ga0066692_10201312	All Organisms → cellular organisms → Bacteria	1246	Open in IMG/M
3300005556\|Ga0066707_10116068	All Organisms → cellular organisms → Bacteria	1663	Open in IMG/M
3300005557\|Ga0066704_10049203	All Organisms → cellular organisms → Bacteria	2656	Open in IMG/M
3300005557\|Ga0066704_10342326	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1004	Open in IMG/M
3300005559\|Ga0066700_10055212	All Organisms → cellular organisms → Bacteria	2458	Open in IMG/M
3300005559\|Ga0066700_10701993	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8	694	Open in IMG/M
3300005561\|Ga0066699_10005982	All Organisms → cellular organisms → Bacteria	5479	Open in IMG/M
3300005574\|Ga0066694_10043045	All Organisms → cellular organisms → Bacteria	2041	Open in IMG/M
3300005598\|Ga0066706_10145674	All Organisms → cellular organisms → Bacteria	1776	Open in IMG/M
3300006041\|Ga0075023_100034695	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1505	Open in IMG/M
3300006173\|Ga0070716_100154266	All Organisms → cellular organisms → Bacteria	1481	Open in IMG/M
3300006173\|Ga0070716_101227659	All Organisms → cellular organisms → Bacteria → Terrabacteria group	603	Open in IMG/M
3300006804\|Ga0079221_10401861	All Organisms → cellular organisms → Bacteria → Terrabacteria group	849	Open in IMG/M
3300007258\|Ga0099793_10182755	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1002	Open in IMG/M
3300007258\|Ga0099793_10285645	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300007265\|Ga0099794_10306201	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	823	Open in IMG/M
3300007788\|Ga0099795_10306669	Not Available	700	Open in IMG/M
3300007982\|Ga0102924_1000958	All Organisms → cellular organisms → Bacteria	34416	Open in IMG/M
3300007982\|Ga0102924_1035847	All Organisms → cellular organisms → Bacteria	3166	Open in IMG/M
3300009038\|Ga0099829_10441092	All Organisms → cellular organisms → Bacteria	1078	Open in IMG/M
3300009038\|Ga0099829_11316755	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300009089\|Ga0099828_10128013	All Organisms → cellular organisms → Bacteria	2226	Open in IMG/M
3300009090\|Ga0099827_10007502	All Organisms → cellular organisms → Bacteria	6783	Open in IMG/M
3300009090\|Ga0099827_10011003	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	5853	Open in IMG/M
3300009090\|Ga0099827_10519831	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1023	Open in IMG/M
3300009090\|Ga0099827_11343004	All Organisms → cellular organisms → Bacteria → Terrabacteria group	622	Open in IMG/M
3300009137\|Ga0066709_104005499	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300010303\|Ga0134082_10006559	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4159	Open in IMG/M
3300011271\|Ga0137393_10102571	All Organisms → cellular organisms → Bacteria	2338	Open in IMG/M
3300011401\|Ga0153984_1058850	All Organisms → cellular organisms → Bacteria → Terrabacteria group	812	Open in IMG/M
3300012096\|Ga0137389_10096520	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2341	Open in IMG/M
3300012198\|Ga0137364_10226172	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1377	Open in IMG/M
3300012198\|Ga0137364_10332396	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1132	Open in IMG/M
3300012198\|Ga0137364_11415008	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	514	Open in IMG/M
3300012199\|Ga0137383_10224132	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1378	Open in IMG/M
3300012203\|Ga0137399_10228010	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1521	Open in IMG/M
3300012205\|Ga0137362_11785400	Not Available	502	Open in IMG/M
3300012206\|Ga0137380_10319637	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1388	Open in IMG/M
3300012208\|Ga0137376_10058164	All Organisms → cellular organisms → Bacteria	3182	Open in IMG/M
3300012208\|Ga0137376_10474732	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1085	Open in IMG/M
3300012209\|Ga0137379_10267272	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1622	Open in IMG/M
3300012210\|Ga0137378_10652718	All Organisms → cellular organisms → Bacteria → Terrabacteria group	963	Open in IMG/M
3300012354\|Ga0137366_10852713	All Organisms → cellular organisms → Bacteria	645	Open in IMG/M
3300012357\|Ga0137384_10960860	All Organisms → cellular organisms → Bacteria	687	Open in IMG/M
3300012683\|Ga0137398_10623467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	747	Open in IMG/M
3300012683\|Ga0137398_10843862	All Organisms → cellular organisms → Bacteria → Terrabacteria group	640	Open in IMG/M
3300012918\|Ga0137396_10141970	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8	1744	Open in IMG/M
3300012977\|Ga0134087_10430457	All Organisms → cellular organisms → Bacteria	649	Open in IMG/M
3300014150\|Ga0134081_10257394	All Organisms → cellular organisms → Bacteria → Terrabacteria group	613	Open in IMG/M
3300018431\|Ga0066655_10018671	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3189	Open in IMG/M
3300018431\|Ga0066655_10058711	All Organisms → cellular organisms → Bacteria	2014	Open in IMG/M
3300018431\|Ga0066655_10652902	All Organisms → cellular organisms → Bacteria → Terrabacteria group	711	Open in IMG/M
3300018431\|Ga0066655_10944435	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	592	Open in IMG/M
3300018433\|Ga0066667_10091226	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1997	Open in IMG/M
3300018433\|Ga0066667_10217137	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1421	Open in IMG/M
3300018468\|Ga0066662_10092908	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2108	Open in IMG/M
3300018468\|Ga0066662_10163080	All Organisms → cellular organisms → Bacteria	1706	Open in IMG/M
3300018468\|Ga0066662_10273616	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1398	Open in IMG/M
3300018482\|Ga0066669_11378638	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300019888\|Ga0193751_1261665	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	523	Open in IMG/M
3300020581\|Ga0210399_10396054	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1152	Open in IMG/M
3300021046\|Ga0215015_10108434	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	5141	Open in IMG/M
3300021046\|Ga0215015_10297238	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1611	Open in IMG/M
3300021046\|Ga0215015_10603066	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1333	Open in IMG/M
3300021046\|Ga0215015_10661355	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1348	Open in IMG/M
3300021432\|Ga0210384_10622372	All Organisms → cellular organisms → Bacteria → Terrabacteria group	969	Open in IMG/M
3300022557\|Ga0212123_10006365	All Organisms → cellular organisms → Bacteria	19728	Open in IMG/M
3300022557\|Ga0212123_10747326	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8	595	Open in IMG/M
3300025910\|Ga0207684_10000007	All Organisms → cellular organisms → Bacteria	612969	Open in IMG/M
3300025922\|Ga0207646_10000082	All Organisms → cellular organisms → Bacteria	127736	Open in IMG/M
3300025922\|Ga0207646_10007561	All Organisms → cellular organisms → Bacteria	11014	Open in IMG/M
3300025928\|Ga0207700_11611612	All Organisms → cellular organisms → Bacteria → Terrabacteria group	574	Open in IMG/M
3300026295\|Ga0209234_1144835	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
3300026296\|Ga0209235_1287037	All Organisms → cellular organisms → Bacteria → Terrabacteria group	503	Open in IMG/M
3300026298\|Ga0209236_1035286	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2629	Open in IMG/M
3300026300\|Ga0209027_1049529	All Organisms → cellular organisms → Bacteria	1577	Open in IMG/M
3300026315\|Ga0209686_1020332	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2645	Open in IMG/M
3300026318\|Ga0209471_1015345	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3929	Open in IMG/M
3300026318\|Ga0209471_1182322	All Organisms → cellular organisms → Bacteria → Terrabacteria group	825	Open in IMG/M
3300026323\|Ga0209472_1046489	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1891	Open in IMG/M
3300026328\|Ga0209802_1050336	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2066	Open in IMG/M
3300026332\|Ga0209803_1027317	All Organisms → cellular organisms → Bacteria	2743	Open in IMG/M
3300026332\|Ga0209803_1321035	All Organisms → cellular organisms → Bacteria → Terrabacteria group	533	Open in IMG/M
3300026334\|Ga0209377_1203319	All Organisms → cellular organisms → Bacteria → Terrabacteria group	661	Open in IMG/M
3300026499\|Ga0257181_1103614	All Organisms → cellular organisms → Bacteria → Terrabacteria group	504	Open in IMG/M
3300026530\|Ga0209807_1080154	All Organisms → cellular organisms → Bacteria	1447	Open in IMG/M
3300026551\|Ga0209648_10454483	All Organisms → cellular organisms → Bacteria	792	Open in IMG/M
3300027521\|Ga0209524_1013808	All Organisms → cellular organisms → Bacteria	1637	Open in IMG/M
3300027537\|Ga0209419_1001379	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3080	Open in IMG/M
3300027587\|Ga0209220_1000639	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	10956	Open in IMG/M
3300027633\|Ga0208988_1118277	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	651	Open in IMG/M
3300027645\|Ga0209117_1015918	All Organisms → cellular organisms → Bacteria	2478	Open in IMG/M
3300027651\|Ga0209217_1005373	All Organisms → cellular organisms → Bacteria	4265	Open in IMG/M
3300027651\|Ga0209217_1015644	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2463	Open in IMG/M
3300027667\|Ga0209009_1000019	All Organisms → cellular organisms → Bacteria	84700	Open in IMG/M
3300027674\|Ga0209118_1049748	All Organisms → cellular organisms → Bacteria	1241	Open in IMG/M
3300027727\|Ga0209328_10097168	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_40CM_2_65_8	900	Open in IMG/M
3300027846\|Ga0209180_10607042	All Organisms → cellular organisms → Bacteria	604	Open in IMG/M
3300027882\|Ga0209590_10011887	All Organisms → cellular organisms → Bacteria	4121	Open in IMG/M
3300028536\|Ga0137415_10006192	All Organisms → cellular organisms → Bacteria	11840	Open in IMG/M
3300031962\|Ga0307479_10000766	All Organisms → cellular organisms → Bacteria	29286	Open in IMG/M
3300031962\|Ga0307479_10022165	All Organisms → cellular organisms → Bacteria	6009	Open in IMG/M
3300031962\|Ga0307479_10081695	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	3128	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.17%
Host-Associated	Host-Associated	0.83%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	95.00%
Aquatic	Environmental → Aquatic	4.17%
Fungi	Host-Associated → Fungi	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	95.00%
Thermal Springs	Environmental → Aquatic → Thermal Springs	3.33%
Sediment	Environmental → Aquatic → Sediment	0.83%
Mycelium	Host-Associated → Fungi → Mycelium	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	76.67%
Loam	Environmental → Terrestrial → Soil → Loam	18.33%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	3.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.83%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	36.67%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.17%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	12.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.00%
Acidic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic	3.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.83%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	26.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	22.50%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	14.17%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	12.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.17%
Iron-Sulfur Acid Spring	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring	3.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.50%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.50%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.50%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.83%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001086	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3	Environmental	Open in IMG/M
3300001145	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300002560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm	Environmental	Open in IMG/M
3300005178	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005574	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300007982	Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300011401	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG	Host-Associated	Open in IMG/M
3300012096	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014150	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021046	Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300022557	Paint Pots_combined assembly	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026295	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026300	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026315	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental	Open in IMG/M
3300026499	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental	Open in IMG/M
3300027521	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027537	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)	Environmental	Open in IMG/M
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027633	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027645	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)	Environmental	Open in IMG/M
3300027651	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027667	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027674	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12709J13192_10004106	3300001086	Forest Soil	MTGRTFFAMLIFAGMIGAVMWFFVLPAMTTYRPALP*
JGI12682J13319_10087814	3300001145	Forest Soil	MYRGDEYVNGRTFFTMLLFAGMIGAVMWFFVLPAL
JGI12053J15887_100073163	3300001661	Forest Soil	MTGRAFFAMLIFVGFVVAVMWFAVLPALTTFRPTLP*
JGIcombinedJ26739_1000996285	3300002245	Forest Soil	MTXRTFFTMLIFVGFVVAVMWFAVLPALTTYRPTLP*
JGIcombinedJ26739_1015911222	3300002245	Forest Soil	MTGRTMFSMLIFVGIIVAAMWFFILPVLTTFKPTLP*
JGI25383J37093_101371422	3300002560	Grasslands Soil	VTDEMTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0066688_100051419	3300005178	Soil	LMWVQSGRRGSDMTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP*
Ga0066697_100082076	3300005540	Soil	MTGRTLVAMLTFGGIVVAVMWFFVLPALTTFKPTLP*
Ga0066697_100142364	3300005540	Soil	MTGRTLFAMLTFAGIVVAMMWFFVLPALTTFRPTLP*
Ga0066697_100353235	3300005540	Soil	MTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP*
Ga0066697_101198802	3300005540	Soil	MTGRTLIAMLTFAGIVVAVMWFFVLPALTTFRPTLP*
Ga0070732_106214942	3300005542	Surface Soil	LNSLGGSDMTGRSLFSMLIFAGIIVAVMWFFVLPALTTFRPTLP*
Ga0066701_100049413	3300005552	Soil	MTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0066701_101005072	3300005552	Soil	MTGRTLFAMLAFAGIVVGVMWFFVLPALTTFRPTLP*
Ga0066701_101313924	3300005552	Soil	MTARTFFAMVIFAGMIGAVMWFFVLPALTTYKPSLP*
Ga0066661_100418425	3300005554	Soil	MTGRPIFSMLIFVGIIVAAMWFFVLPALTTFRPALP*
Ga0066661_104010132	3300005554	Soil	MTGRAFFSMLIFVGFVVAIMWFAVLPSLTTFRPTLP*
Ga0066692_102013123	3300005555	Soil	DMTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP*
Ga0066707_101160682	3300005556	Soil	MTGRTFFTMLIFVGFVVLVMWFAVLPALTTFRPTLP*
Ga0066704_100492035	3300005557	Soil	MTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP*
Ga0066704_103423262	3300005557	Soil	MTGRTFFAMLMFAGMIGAVMWFFVLPALTTYRPSLP*
Ga0066700_100552121	3300005559	Soil	MTGRTLFAMLMFAGIVVAVMWFFVLPALTTFRPTLP*
Ga0066700_107019932	3300005559	Soil	MTGRAFFSMLIFVGFVVAVMWFAVLPALTTFRPTLP*
Ga0066699_100059827	3300005561	Soil	MTGRPLFSMLIFAGIIVAAMWFFVLPALTTFRPTLP*
Ga0066694_100430452	3300005574	Soil	MTGRAFFSMLIFVGFVVAVMWFVVLPSLTTFRPTLP*
Ga0066706_101456741	3300005598	Soil	VQSGRRGSDMTGRPIFSMLIFVGIIVAAMWFFVLPALTTFRPALP*
Ga0075023_1000346952	3300006041	Watersheds	VTSRTFFAMLMFAAIIGAVMWFFVLPALTTYRPSVP*
Ga0070716_1001542663	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	VTARTFFAMLIFAGIIGVVMWFLVLPALTTYRPSLP*
Ga0070716_1012276591	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MTARAFFSMLIFVGFVVFVMWFAVLPALTTFRPTLP*
Ga0079221_104018611	3300006804	Agricultural Soil	GRSLFSMLIFAGIIVAAMWFFVLPALTTYRPTLP*
Ga0099793_101827555	3300007258	Vadose Zone Soil	MTSRTFFAMLMFAGMIGAVMWFFVLPALTTYRPSLP*
Ga0099793_102856452	3300007258	Vadose Zone Soil	MTGRAFFSMLIFVGFVVVVMWFAVLPALTTLRPTLP*
Ga0099794_103062012	3300007265	Vadose Zone Soil	MTGRAFFSMLIFVGFVVAVMWFAVLPSLTTFRPTLP*
Ga0099795_103066691	3300007788	Vadose Zone Soil	MTSRTFFAMLMFAGLIGAVMWFFVLPALTVYRPGIP*
Ga0102924_100095818	3300007982	Iron-Sulfur Acid Spring	MTGRTFFAMLMFAGMIGAVIWFFVLPALTTYKPSLP*
Ga0102924_10358476	3300007982	Iron-Sulfur Acid Spring	MTGRAFFAMLIFAGLVVAVMWFAVLPSLTTFKPTLP*
Ga0099829_104410922	3300009038	Vadose Zone Soil	MTGRTFVTMLIFVGFVVVVMWFAVLPALTTFKPTLP*
Ga0099829_113167552	3300009038	Vadose Zone Soil	MTGRAFFSMLIFVAFVVFVMWLAVLPALTTFRPTLP*
Ga0099828_101280132	3300009089	Vadose Zone Soil	MTGRAFFSMLIFVAFVVFVMWFAVLPALTTFRPTLP*
Ga0099827_100075025	3300009090	Vadose Zone Soil	MTARTLFAMVIFAGMIGAVMWFFVLPALTTYKPSLP*
Ga0099827_100110037	3300009090	Vadose Zone Soil	MTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0099827_105198311	3300009090	Vadose Zone Soil	EMTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0099827_113430042	3300009090	Vadose Zone Soil	MTGRAFFAMLIFVGFVVAVMWFAVLPSLTTFRPTLP*
Ga0066709_1040054992	3300009137	Grasslands Soil	MTGRTFFTMLIFVGFVVVVMWFAVLPSLTTFRPTLP*
Ga0134082_100065597	3300010303	Grasslands Soil	DMTGRTLVAMLTFGGIVVAVTWFFVLPALTTFKPTLP*
Ga0137393_101025712	3300011271	Vadose Zone Soil	MTGRTFLTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0153984_10588502	3300011401	Attine Ant Fungus Gardens	VTTRTFFAMLIFAGIIGVVMWFLVLPALTTYRPSLP*
Ga0137389_100965204	3300012096	Vadose Zone Soil	MTGRAFFSMLIFVGFVVFVMWFAVLPALTTFRPTLP*
Ga0137364_102261723	3300012198	Vadose Zone Soil	MTGRTFFTMLIFVGFVVVVMWFAVLPALTSFRPTLP*
Ga0137364_103323963	3300012198	Vadose Zone Soil	FDITGRTLFAMLTFAGIVVAVMWFFVLPALTTFRPTVP*
Ga0137364_114150081	3300012198	Vadose Zone Soil	ERREMTGRAFFSMLIFVGFVVAVMWFVVLPSLTTFRPTLP*
Ga0137383_102241322	3300012199	Vadose Zone Soil	MTVRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0137399_102280102	3300012203	Vadose Zone Soil	MTGRAFFAMLIFAGFVVAVMWFAVLPSLTTFRPTLP*
Ga0137362_117854002	3300012205	Vadose Zone Soil	MTGRTFFAMLMFAGMIGAVMWFFVLPALTTYKPSLP*
Ga0137380_103196372	3300012206	Vadose Zone Soil	VTGRTLIAMRTFAGIVVAVMWFFVLPALTTFRPTLP*
Ga0137376_100581642	3300012208	Vadose Zone Soil	MTGRTLLAMLTFAGIVVAAMWFFVLPALTTFRPTLP*
Ga0137376_104747323	3300012208	Vadose Zone Soil	EMTGRAFFSMLIFVGFVVAIMWFAVLPSLTTFRPTLP*
Ga0137379_102672722	3300012209	Vadose Zone Soil	MTGRTFFTMLIFVGFVVVVMWFAVLPALTTYRPALP*
Ga0137378_106527181	3300012210	Vadose Zone Soil	REMTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0137366_108527132	3300012354	Vadose Zone Soil	MTGRTFFTMLIFVAFVVVVMWFAVLPALTTFRPTLP*
Ga0137384_109608602	3300012357	Vadose Zone Soil	MTGRAFFSMLIFVRFVVAIMWFAVLPSLTTFRPTLP*
Ga0137398_106234672	3300012683	Vadose Zone Soil	MTGRAFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP*
Ga0137398_108438621	3300012683	Vadose Zone Soil	MTSRTFFAMLMFAGMIGAVMWFFVLPALTVYRPGIP*
Ga0137396_101419702	3300012918	Vadose Zone Soil	MTGRAFFSMLIFVGFVVVVMWFAVLPALTTFRPTLP*
Ga0134087_104304571	3300012977	Grasslands Soil	MTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRQTLP*
Ga0134081_102573942	3300014150	Grasslands Soil	EIDMTGRTLVAMLTFGGIVVAVMWFFVLPALTTFKPTLP*
Ga0066655_100186714	3300018431	Grasslands Soil	MTGRTLVAMLTFGGIVVAVMWFFVLPALTTFKPTLP
Ga0066655_100587116	3300018431	Grasslands Soil	MTGRTLFAMLTFAGIVVAMMWFFVLPALTTFRPTLP
Ga0066655_106529021	3300018431	Grasslands Soil	ISVSPAQVTGRAFFAMLIFVGFVVVVMWFAVLPALTTFRPTLP
Ga0066655_109444352	3300018431	Grasslands Soil	MTGRTLIAMLTFAGIVVAVMWFFVLPALTTFRPTLP
Ga0066667_100912263	3300018433	Grasslands Soil	MTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP
Ga0066667_102171372	3300018433	Grasslands Soil	MTGRPIFSMLIFVGIIVAAMWFFVLPALTTFRPALP
Ga0066662_100929084	3300018468	Grasslands Soil	MTGRTLFAMLAFAGIVVGVMWFFVLPALTTFRPTLP
Ga0066662_101630803	3300018468	Grasslands Soil	ERREMTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP
Ga0066662_102736162	3300018468	Grasslands Soil	MTARTFFAMVIFAGMIGAVMWFFVLPALTTYKPSLP
Ga0066669_113786382	3300018482	Grasslands Soil	MTGRTFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP
Ga0193751_12616653	3300019888	Soil	MTARTFFAMLMFAGIIGVVMWFFVLPALTTYRPSVP
Ga0210399_103960542	3300020581	Soil	VTTRTFFAMLVFAGIIGVVMWFLVLPALTTYRPSLP
Ga0215015_101084344	3300021046	Soil	MTGRTFLTMLVFVGFVVVVMWFAVLPALTTFRPTLP
Ga0215015_102972384	3300021046	Soil	MTGRTLFAMLTFAGIVVAVMWFFVLPALTTFRPTLP
Ga0215015_106030662	3300021046	Soil	MTGRTFFAMLMFAGLIGIVMWFLVLPALTTYRPSVP
Ga0215015_106613552	3300021046	Soil	MYQRDEYVKSRTFFALLMFAGIIGAVMWFFVLPALSTYRPSVP
Ga0210384_106223722	3300021432	Soil	MYQGDEYVTSRTFFAMLMFAGVIGAVMWFFVLPALTTYRPSVP
Ga0212123_1000636518	3300022557	Iron-Sulfur Acid Spring	MTGRTFFAMLMFAGMIGAVIWFFVLPALTTYKPSLP
Ga0212123_107473262	3300022557	Iron-Sulfur Acid Spring	RYIQEMTGRAFFAMLIFAGLVVAVMWFAVLPSLTTFKPTLP
Ga0207684_10000007142	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MTGRPLFSMLIFAGIVVAVMWFFVLPALTTFKPTLP
Ga0207646_1000008267	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MTGRTFFAMLFFAGLIAIVMWLFILPALTTYRPTLA
Ga0207646_1000756115	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MTGRTFFIMLVFAGTIGTVMWFFILPALTVYRPALP
Ga0207700_116116122	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	VTARTFFAMLIFAGIIGVVMWFLVLPALTTYRPSLP
Ga0209234_11448352	3300026295	Grasslands Soil	MTGRAFFSMLIFVGFVVAIMWFAVLPSLTTFRPTLP
Ga0209235_12870372	3300026296	Grasslands Soil	VTDEMTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP
Ga0209236_10352862	3300026298	Grasslands Soil	MTGRAFFTMLIFVGFVVVVMWFAVLPALTTFRPTLP
Ga0209027_10495292	3300026300	Grasslands Soil	MTGRTFFAMLIFAGFVVVVMWLFVLPALTTYRPSLP
Ga0209686_10203326	3300026315	Soil	MTGRTLFAMLMFAGIVVAVMWFFVLPALTTFRPTLP
Ga0209471_10153455	3300026318	Soil	MTSRTFFAMLMFAGMIGAVMWFFVLPALTTYRPSLP
Ga0209471_11823222	3300026318	Soil	MTGRPLFSMLIFAGIIVAAMWFFVLPALTTFRPTLP
Ga0209472_10464893	3300026323	Soil	MTGRAFFSMLIFVGFVVAVMWFVVLPSLTTFRPTLP
Ga0209802_10503363	3300026328	Soil	MTGRTLFAMLTFAGIVVGVMWFFVLPALTTFRPTLP
Ga0209803_10273171	3300026332	Soil	EGIEMTGRTFFAMLIFVGFVVAIMWFAVLPSLTTFRPTLP
Ga0209803_13210351	3300026332	Soil	RSEFEMTGRTLFAMLMFAGIVVAVMWFFVLPALTTFRPTLP
Ga0209377_12033191	3300026334	Soil	DMTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP
Ga0257181_11036142	3300026499	Soil	MTGRTFLTMLIFVGFVVVVMWFAVLPALRTFRPTLP
Ga0209807_10801541	3300026530	Soil	MTGRPIFSMVIFVGIIVAAMWFFVLPALTTFRPALP
Ga0209648_104544831	3300026551	Grasslands Soil	MTSRAFFAMLIFVGFVVAVMWFAVLPSLTTFRPTLP
Ga0209524_10138085	3300027521	Forest Soil	MTGRTFFAMLIFAGMIGAVMWFFVLPAMTTYRPALP
Ga0209419_10013793	3300027537	Forest Soil	VTGRTFFTMLLFAGMIGAVMWFFILPALTTYRPSLP
Ga0209220_10006395	3300027587	Forest Soil	MTGRAFFSMLIFLGFVVGVMWFAILPALTTFRPTLP
Ga0208988_11182772	3300027633	Forest Soil	MTGRAFFAMLIFVGFVVAVMWFAVLPALTTFRPTLP
Ga0209117_10159185	3300027645	Forest Soil	MTSRAFFAMLIFAGMIGAVMWFFVLPALTVYQPAIP
Ga0209217_10053733	3300027651	Forest Soil	MTGRAFFSMLIFVGFVVGVMWFAILPALTTFRPTLP
Ga0209217_10156444	3300027651	Forest Soil	MTGRAFFAMLIFVGFVVAVMWFAVLPSLTTFRPTLP
Ga0209009_100001941	3300027667	Forest Soil	MYRGDEYVNGRTFFTMLLFAGMIGAVMWFFILPALTTYRPSLP
Ga0209118_10497482	3300027674	Forest Soil	MTGRAFFAMLVFVGFVVAVMWFAVLPSLTTFRPTLP
Ga0209328_100971682	3300027727	Forest Soil	MTGRAFFSMLIFVAFVVVVMWFAVLPALTTFRPTLP
Ga0209180_106070422	3300027846	Vadose Zone Soil	MTGRTFVTMLIFVGFVVVVMWFAVLPALTTFKPTLP
Ga0209590_100118877	3300027882	Vadose Zone Soil	MTARTLFAMVIFAGMIGAVMWFFVLPALTTYKPSLP
Ga0137415_1000619210	3300028536	Vadose Zone Soil	MTSRTFFAMLMFAGLIGAVMWFFVLPALTVYRPGIP
Ga0307479_100007667	3300031962	Hardwood Forest Soil	MTGRTMFSMLIFAGIIVAAMWFFILPVLTTFKPTLP
Ga0307479_100221657	3300031962	Hardwood Forest Soil	MTGRSLFSMLIFAGIIVTVMWFFVLPALTTFRPTLP
Ga0307479_100816952	3300031962	Hardwood Forest Soil	MTARAFFSMLIFVGFVVFVMWFAVLPALTTFRPTLP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F073936

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences