Basic Information | |
---|---|
Family ID | F073876 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 44 residues |
Representative Sequence | VSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKL |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 39.81 % |
% of genes near scaffold ends (potentially truncated) | 84.17 % |
% of genes from short scaffolds (< 2000 bps) | 83.33 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (69.167 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF13193 | AMP-binding_C | 25.83 |
PF03729 | DUF308 | 12.50 |
PF00067 | p450 | 11.67 |
PF01434 | Peptidase_M41 | 4.17 |
PF02423 | OCD_Mu_crystall | 3.33 |
PF04972 | BON | 2.50 |
PF01594 | AI-2E_transport | 1.67 |
PF13459 | Fer4_15 | 1.67 |
PF13396 | PLDc_N | 0.83 |
PF00378 | ECH_1 | 0.83 |
PF12323 | HTH_OrfB_IS605 | 0.83 |
PF07719 | TPR_2 | 0.83 |
PF11239 | DUF3040 | 0.83 |
PF02424 | ApbE | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 12.50 |
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 11.67 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 4.17 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 3.33 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.67 |
COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 69.17 % |
All Organisms | root | All Organisms | 30.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003219|JGI26341J46601_10060688 | Not Available | 1161 | Open in IMG/M |
3300004474|Ga0068968_1004657 | Not Available | 534 | Open in IMG/M |
3300004972|Ga0072325_1302511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 647 | Open in IMG/M |
3300005363|Ga0008090_10055814 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
3300005434|Ga0070709_10876565 | Not Available | 708 | Open in IMG/M |
3300005435|Ga0070714_100228690 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
3300005435|Ga0070714_102408461 | Not Available | 511 | Open in IMG/M |
3300005436|Ga0070713_100897302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 852 | Open in IMG/M |
3300005436|Ga0070713_101414695 | Not Available | 674 | Open in IMG/M |
3300005437|Ga0070710_10311173 | Not Available | 1031 | Open in IMG/M |
3300005439|Ga0070711_101423542 | Not Available | 603 | Open in IMG/M |
3300005471|Ga0070698_100726781 | Not Available | 935 | Open in IMG/M |
3300005564|Ga0070664_102133478 | Not Available | 532 | Open in IMG/M |
3300006028|Ga0070717_11046396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 743 | Open in IMG/M |
3300006028|Ga0070717_11644396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria buriramensis | 582 | Open in IMG/M |
3300006174|Ga0075014_100701887 | Not Available | 588 | Open in IMG/M |
3300006804|Ga0079221_10558456 | Not Available | 760 | Open in IMG/M |
3300006804|Ga0079221_10656485 | Not Available | 720 | Open in IMG/M |
3300006903|Ga0075426_10873559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 678 | Open in IMG/M |
3300009098|Ga0105245_11251868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
3300009520|Ga0116214_1031716 | Not Available | 1904 | Open in IMG/M |
3300009520|Ga0116214_1316857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella | 600 | Open in IMG/M |
3300009551|Ga0105238_11672013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300009672|Ga0116215_1116349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
3300009672|Ga0116215_1300073 | Not Available | 698 | Open in IMG/M |
3300009683|Ga0116224_10578339 | Not Available | 536 | Open in IMG/M |
3300009698|Ga0116216_10447543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 782 | Open in IMG/M |
3300010329|Ga0134111_10333320 | Not Available | 638 | Open in IMG/M |
3300010361|Ga0126378_10545041 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
3300010376|Ga0126381_103460183 | Not Available | 620 | Open in IMG/M |
3300010379|Ga0136449_103558240 | Not Available | 592 | Open in IMG/M |
3300010379|Ga0136449_104458000 | Not Available | 515 | Open in IMG/M |
3300013105|Ga0157369_10614082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1122 | Open in IMG/M |
3300014325|Ga0163163_12506646 | Not Available | 574 | Open in IMG/M |
3300014969|Ga0157376_10508830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1185 | Open in IMG/M |
3300015265|Ga0182005_1283164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 520 | Open in IMG/M |
3300015373|Ga0132257_103683686 | Not Available | 558 | Open in IMG/M |
3300016341|Ga0182035_11660893 | Not Available | 577 | Open in IMG/M |
3300016371|Ga0182034_10979828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
3300017821|Ga0187812_1192457 | Not Available | 652 | Open in IMG/M |
3300017821|Ga0187812_1225960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
3300017822|Ga0187802_10390563 | Not Available | 550 | Open in IMG/M |
3300017823|Ga0187818_10430596 | Not Available | 588 | Open in IMG/M |
3300017924|Ga0187820_1237232 | Not Available | 581 | Open in IMG/M |
3300017926|Ga0187807_1297331 | Not Available | 536 | Open in IMG/M |
3300017928|Ga0187806_1183505 | Not Available | 703 | Open in IMG/M |
3300017932|Ga0187814_10066364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1324 | Open in IMG/M |
3300017932|Ga0187814_10287582 | Not Available | 627 | Open in IMG/M |
3300017937|Ga0187809_10083297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
3300017937|Ga0187809_10436070 | Not Available | 504 | Open in IMG/M |
3300017942|Ga0187808_10076156 | Not Available | 1443 | Open in IMG/M |
3300017943|Ga0187819_10554467 | Not Available | 653 | Open in IMG/M |
3300017943|Ga0187819_10647863 | Not Available | 597 | Open in IMG/M |
3300017955|Ga0187817_10363060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 924 | Open in IMG/M |
3300017955|Ga0187817_10845166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 585 | Open in IMG/M |
3300017955|Ga0187817_10937001 | Not Available | 554 | Open in IMG/M |
3300017972|Ga0187781_10320100 | Not Available | 1101 | Open in IMG/M |
3300017995|Ga0187816_10370976 | Not Available | 634 | Open in IMG/M |
3300018046|Ga0187851_10364228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 831 | Open in IMG/M |
3300018058|Ga0187766_10147292 | Not Available | 1460 | Open in IMG/M |
3300018058|Ga0187766_10474874 | Not Available | 838 | Open in IMG/M |
3300018086|Ga0187769_10197298 | Not Available | 1488 | Open in IMG/M |
3300021178|Ga0210408_11006755 | Not Available | 644 | Open in IMG/M |
3300021403|Ga0210397_11408585 | Not Available | 541 | Open in IMG/M |
3300021405|Ga0210387_10495861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1085 | Open in IMG/M |
3300021407|Ga0210383_10064089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3068 | Open in IMG/M |
3300025906|Ga0207699_11345188 | Not Available | 529 | Open in IMG/M |
3300025915|Ga0207693_11273642 | Not Available | 551 | Open in IMG/M |
3300025916|Ga0207663_10154416 | Not Available | 1613 | Open in IMG/M |
3300026078|Ga0207702_11193679 | Not Available | 755 | Open in IMG/M |
3300027010|Ga0207839_1007834 | Not Available | 1295 | Open in IMG/M |
3300027680|Ga0207826_1078757 | Not Available | 908 | Open in IMG/M |
3300027812|Ga0209656_10064054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2024 | Open in IMG/M |
3300027824|Ga0209040_10265593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 853 | Open in IMG/M |
3300027824|Ga0209040_10301421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 780 | Open in IMG/M |
3300030494|Ga0310037_10433116 | Not Available | 540 | Open in IMG/M |
3300030940|Ga0265740_1010740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300031543|Ga0318516_10556303 | Not Available | 656 | Open in IMG/M |
3300031713|Ga0318496_10099025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1562 | Open in IMG/M |
3300031765|Ga0318554_10189120 | Not Available | 1171 | Open in IMG/M |
3300031765|Ga0318554_10466986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
3300031771|Ga0318546_10659334 | Not Available | 736 | Open in IMG/M |
3300031779|Ga0318566_10660169 | Not Available | 507 | Open in IMG/M |
3300031798|Ga0318523_10066571 | Not Available | 1725 | Open in IMG/M |
3300031798|Ga0318523_10538643 | Not Available | 576 | Open in IMG/M |
3300031846|Ga0318512_10158655 | Not Available | 1094 | Open in IMG/M |
3300031860|Ga0318495_10061912 | Not Available | 1663 | Open in IMG/M |
3300031879|Ga0306919_11525407 | Not Available | 503 | Open in IMG/M |
3300031890|Ga0306925_11792737 | Not Available | 588 | Open in IMG/M |
3300031896|Ga0318551_10571227 | Not Available | 651 | Open in IMG/M |
3300031912|Ga0306921_10713159 | Not Available | 1152 | Open in IMG/M |
3300031947|Ga0310909_11471956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
3300032025|Ga0318507_10216652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
3300032065|Ga0318513_10291473 | Not Available | 792 | Open in IMG/M |
3300032089|Ga0318525_10287730 | Not Available | 844 | Open in IMG/M |
3300032160|Ga0311301_10395118 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2122 | Open in IMG/M |
3300032160|Ga0311301_11071671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1053 | Open in IMG/M |
3300032828|Ga0335080_11744840 | Not Available | 609 | Open in IMG/M |
3300032829|Ga0335070_10459873 | Not Available | 1210 | Open in IMG/M |
3300032829|Ga0335070_11236512 | Not Available | 685 | Open in IMG/M |
3300032893|Ga0335069_10844735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1028 | Open in IMG/M |
3300032955|Ga0335076_10755218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae | 854 | Open in IMG/M |
3300032955|Ga0335076_11303130 | Not Available | 611 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.33% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 15.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.17% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.83% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.67% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004474 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004972 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 42 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_103420382 | 3300001356 | Peatlands Soil | VPPQPQGRFARLLKAAERRHVPLLTIVVTVAIVAATYVAGKLIYRLR |
JGI26341J46601_100606881 | 3300003219 | Bog Forest Soil | VKEPSAPRSRFARLLKAAERRHVPLLTILVTVGVVAATYLVGKLLYRLRD |
Ga0068968_10046573 | 3300004474 | Peatlands Soil | MSYEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYL |
Ga0062388_1016906362 | 3300004635 | Bog Forest Soil | VTGEAPADEAATPEGRLARLLKAADRRRVPLLTIVTTVAIVAATYLAGKLI |
Ga0072325_13025112 | 3300004972 | Peatlands Soil | MSYEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYLAGKLSTCCGTSCC* |
Ga0008090_100558141 | 3300005363 | Tropical Rainforest Soil | VNEEPPRSRFGRMLRAAERRHVPLLTILVTVGVVAATYLAGKLLYR |
Ga0070709_108765651 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VNEEPPPRSRFERLQRAAERRHVPLLTILVTVGVVVAVYLTGKLLYRIKDIV |
Ga0070714_1002286903 | 3300005435 | Agricultural Soil | MLGDVTDQPPPQGRLARLWQYADLRHVPLRTIVVTVAVVAAAYLA |
Ga0070714_1024084611 | 3300005435 | Agricultural Soil | MSYERPPRGRLARLFTAADRRHVPLRTILVTVAVVVATYLAGKLIYRL |
Ga0070713_1008973021 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYERPPPGRLARLFTAADRRHVPLRTILVTVAVVVATYLA |
Ga0070713_1014146952 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VNEEPPPRSRFGRLQRAAERRHVPLLTILVTVGVVVAVYLTGKLLYRIKDI |
Ga0070710_103111732 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDPSPPQGRLARLYRYADVRHVPLRTIVVTVAVVAGTYLAGK |
Ga0070711_1014235422 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYERPPRGRLARLFTAADRRHVPLRTILVTVAVVVATYLAGK |
Ga0070698_1007267812 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VKEEPPPRSRFGRLLQAADRRHVPLLTILVTVGVVAATYLA |
Ga0070664_1021334781 | 3300005564 | Corn Rhizosphere | MSYEQPPRGRLARLSEAADRRHVPLRTILVTVAVVV |
Ga0070717_110463961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHEEPPRGRLARLFEAAGRRGVPLRTILVTVAVVAAAYLTGQLI |
Ga0070717_116443961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VSDEQPPRGRLARLFGAADRCHVPLRTILVTVAVVVATYLA |
Ga0075014_1007018871 | 3300006174 | Watersheds | MSYEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYLAGKL |
Ga0075021_107265352 | 3300006354 | Watersheds | VNDEPPPLQGQPPQGRLARLWKAAELRNVPLRTIVVTVA |
Ga0079221_105584562 | 3300006804 | Agricultural Soil | VKEESPPRGRFGRLLQRAERRHVPLLTILVTVGVVAATYLTGKLLYRLKDI |
Ga0079221_106564852 | 3300006804 | Agricultural Soil | MLGHVTDQPPPQGRLARLWRYAEVRHVPLRTIVVTVAVV |
Ga0075426_108735592 | 3300006903 | Populus Rhizosphere | MSHEEPPRGRLARLFEAAGRRGVPLRTILVTVAVVAAAYLTG |
Ga0105245_112518682 | 3300009098 | Miscanthus Rhizosphere | MSYEQPPRGRLARLSEAADRRHVPLRTILVTVAVVVATYLA |
Ga0116214_10317164 | 3300009520 | Peatlands Soil | VTDQPPPQGRLARLWAYADARHVPLRTIVVTVAVVAA |
Ga0116214_13168571 | 3300009520 | Peatlands Soil | VTDQPPPQGRLARLFRYADARHVPLRTILVTVAVVAGPYLAGQLIY |
Ga0105238_116720132 | 3300009551 | Corn Rhizosphere | MSYEQPPRGRLARLSEAADRRHVPLRTILVTVAVVVATY |
Ga0116215_11163491 | 3300009672 | Peatlands Soil | MSYEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYLAGKLIY |
Ga0116215_13000732 | 3300009672 | Peatlands Soil | MSYEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYLAGK |
Ga0116224_105783391 | 3300009683 | Peatlands Soil | MSFEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYLAGK |
Ga0116216_104475433 | 3300009698 | Peatlands Soil | MSDEQPRGRLARLFQAADRRHVPLRTILVTVAVVVVTYLAGKLIY |
Ga0116216_107503962 | 3300009698 | Peatlands Soil | VNDEPPPPQGQPPQGRLARLWKAAELRNVPLRTIVVTVAVVAATYLAGKLIY |
Ga0134111_103333201 | 3300010329 | Grasslands Soil | VTEEPPPRSRFQRLLRAADRRHVPLLTILVTVGVVAATYLTGILVYRLRGILL |
Ga0126378_105450413 | 3300010361 | Tropical Forest Soil | VKQQPPPRSRFQRLLRAAERRNVPLLTILVTVGVVAATYLAG |
Ga0126381_1034601833 | 3300010376 | Tropical Forest Soil | MSYEQPPRGRLARLFEATDRRHVPLRTILVTVAVVVATYLAG |
Ga0136449_1035582402 | 3300010379 | Peatlands Soil | VTDQPPPQSRLARLFRYADARHVPLRTIVVTVAVVAATYLAGLL |
Ga0136449_1044580003 | 3300010379 | Peatlands Soil | MSYEQPRGRLARLFQAADRRHVPLRTILVTAGVVVATYLAGK |
Ga0126361_110430491 | 3300010876 | Boreal Forest Soil | MLGRVTEPTPPQGRLARMFRYADARRVPLRTILVTVAVVAGTYLAGLL |
Ga0157369_106140822 | 3300013105 | Corn Rhizosphere | MSYKQPPRGRLARLSEAADRRHVPLRTILVTVAVVVATY |
Ga0163163_125066461 | 3300014325 | Switchgrass Rhizosphere | VTDPSPPQGRLARLYRYADARHVPLRTIVVTVGVVAATYLA |
Ga0157376_105088301 | 3300014969 | Miscanthus Rhizosphere | MSYEQPPRGRLARLSEAADRRHVPLRTILVTVAVVVATYLAGKLIYRL |
Ga0182005_12831641 | 3300015265 | Rhizosphere | MSYEQPPRGRLARLFQAADRRHVPLRTILVTVAVVAAS* |
Ga0132257_1036836862 | 3300015373 | Arabidopsis Rhizosphere | VNEEPPPRGRFGRLLRAAERRHVPLLTILVTVGVVVAVYLTGKLLYRIKDIVLLI |
Ga0182035_116608931 | 3300016341 | Soil | VKEEPPRSRFGRLLRAAERRHVPLLTILVTVGVVAATYLTGKLL |
Ga0182034_109798282 | 3300016371 | Soil | RRLARLFEAADRRHVPLRTILVTVAVVVATYLAGKLL |
Ga0187812_11924571 | 3300017821 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGK |
Ga0187812_12259602 | 3300017821 | Freshwater Sediment | MNDEQLPRGRLARLFEAADRRHVPLRTILVTVAVVVATYLAGKLLY |
Ga0187802_103905631 | 3300017822 | Freshwater Sediment | MSYEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKLLYLLR |
Ga0187818_104305961 | 3300017823 | Freshwater Sediment | MSYEQPPRGRLARLFEAADRRHVPLRTILVTVGVVAAAY |
Ga0187820_12372321 | 3300017924 | Freshwater Sediment | MSYEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKLI |
Ga0187807_12973311 | 3300017926 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKLM |
Ga0187806_11835053 | 3300017928 | Freshwater Sediment | MSYEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKLM |
Ga0187814_100663641 | 3300017932 | Freshwater Sediment | MSCEQPPRGRLAGLFEAADRRHVPLRTILVTVGVVVAAYL |
Ga0187814_102875821 | 3300017932 | Freshwater Sediment | MSYEQPPRGRLARLFKAADRRHVPLRTILVTAGVVV |
Ga0187809_100832972 | 3300017937 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVAVAAYL |
Ga0187809_104360701 | 3300017937 | Freshwater Sediment | MNDEQPPRGRLARLFQAADRRHVPLRTILVTVAVVVATYL |
Ga0187808_100761561 | 3300017942 | Freshwater Sediment | VTDQPPPQGRLARLWAYADARHVPLRTIVVTVAVVAAAYL |
Ga0187819_105544672 | 3300017943 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLA |
Ga0187819_106478631 | 3300017943 | Freshwater Sediment | VTDQPPPQGRLARLWAYADARHVPLRTIVVTVAVVAATYLGGK |
Ga0187817_103630602 | 3300017955 | Freshwater Sediment | MSYEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKL |
Ga0187817_104494012 | 3300017955 | Freshwater Sediment | MLGQVRDVPPQPQGRLARLWKAAELRHVPLRTIVVTVAVVTATYLAGKLIYR |
Ga0187817_108451661 | 3300017955 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVATYLAGKLIY |
Ga0187817_109370011 | 3300017955 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKL |
Ga0187781_103201002 | 3300017972 | Tropical Peatland | VTEPPPPQGRLARLWAYADARHVPLRTIVVTVAVVAA |
Ga0187816_103709761 | 3300017995 | Freshwater Sediment | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKLMYLLRDIV |
Ga0187851_103642281 | 3300018046 | Peatland | MSHEQQPRGRLARLFEAADRRHVPLRTILVTAGVVVAAYLAGKL |
Ga0187766_101472921 | 3300018058 | Tropical Peatland | VSDQPPPRSRLERLWAYADVRHVPLRTIVVTVAVV |
Ga0187766_104748742 | 3300018058 | Tropical Peatland | VKDEPPQPRGRLARLFQAADRRGVPLRTIVVTVAVVAA |
Ga0187772_107384411 | 3300018085 | Tropical Peatland | MDEPPKPPPGQQPQGRLARVLRAADRRHVPLLTILVTVAVVAATYLAGKLIYRLRDIVLLII |
Ga0187769_101972981 | 3300018086 | Tropical Peatland | VTDEPPRPEGRLARLWKAADVRHVPLRTILVTVAVVAV |
Ga0210408_110067551 | 3300021178 | Soil | VTDQSPPPGRLARLFRYADTRHVPLRTIVVTVAVVA |
Ga0210397_114085852 | 3300021403 | Soil | VSHEQPPRGRLARLFQAADRRHVPLRTILVAVAVVVATYLL |
Ga0210387_104958612 | 3300021405 | Soil | VSHEQPPRGRLARLFQAADRRHVPLRTILVAVAVVVATYLLG |
Ga0210387_116239792 | 3300021405 | Soil | VTDQPPPQGRLARLFRYADTRRVPLRTIVVTVAVVAGTYLAGILIYRLRTLF |
Ga0210383_100640891 | 3300021407 | Soil | MLGQMTEPTPPQGRLARMFRYADARHVPLRTIVVAVAVVA |
Ga0179591_12254361 | 3300024347 | Vadose Zone Soil | VKEEPPPPRGRLDRLWRAAELRNVPLRTIVVTVAVVAAT |
Ga0207699_113451881 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYEQPPRGRLARLSEAADRRHVPLRTILVTVAVVVATYLAGKL |
Ga0207693_112736422 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKEEPPPRSRFGRLLQAADRRHVPLLTILVTVGVVAATYLAGKLIY |
Ga0207663_101544162 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VNEEPLPRSRFGRLLRAAERRHVPLLTILVTVGVVVAVYLTGKLLYRIKDILLLIVVA |
Ga0207702_111936792 | 3300026078 | Corn Rhizosphere | VNEEPPPRSRFGRLQRAAERRHVPLLTILVTVGVVVAVYLTGKLLYRIK |
Ga0207839_10078342 | 3300027010 | Tropical Forest Soil | MSCEQPPQGRLARLFEAADRRHVPLRTILVTVAVVAAAYLA |
Ga0207826_10787571 | 3300027680 | Tropical Forest Soil | MSCEQPPQGRLARLFEAADRRHVPLRTILVTVAVVAAAYLAGKLMYLL |
Ga0209656_100640546 | 3300027812 | Bog Forest Soil | VSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKLM |
Ga0209040_102655931 | 3300027824 | Bog Forest Soil | VSCEQPPRGRLARLFEAADRRHVPLRTILVTVGVVVATYLAGKL |
Ga0209040_103014212 | 3300027824 | Bog Forest Soil | VSYEQPPRGRLARLFDAADRRHVPLRTILVTVGVV |
Ga0310037_101493713 | 3300030494 | Peatlands Soil | VKDEPPPPQGRLARLWQAADRRHVPLRTIVVTVAVVAATYLAGKLI |
Ga0310037_103047283 | 3300030494 | Peatlands Soil | MLGGVRDVPPQPRGRLARLWKAAEVRNIPLRTIVTTVAIVAATYLAGK |
Ga0310037_104331162 | 3300030494 | Peatlands Soil | MSYEQPRGRLARLFEAADRRHVPLRTILVTAGVVV |
Ga0265740_10107404 | 3300030940 | Soil | VSYEQPRGRLARLFEAADRRHVPLRTILVTVAVVVA |
Ga0318516_105563031 | 3300031543 | Soil | VNEEPPPPRSRFERLLRDAERRRVPLLTILVTVGVVVAVYLAGKLLYRI |
Ga0310686_1043470211 | 3300031708 | Soil | VNDQATDEPPLPEGRLPRLWKAADLRGVPLRTIVVTIALVAITYLA |
Ga0310686_1115646332 | 3300031708 | Soil | VTDEAPLPEGRLSRLWKAAELRHVPLRTIVASVAVVAVTYLAG |
Ga0310686_1182013731 | 3300031708 | Soil | MTWHADHVSEQPPPQGRLARLFRYADARHVPLRTIVVTVAVVAATYLAG |
Ga0318496_100990251 | 3300031713 | Soil | VNEEPPPPRSRFERLLRDAERRRVPLLTILVTVGVVVAVYLAGKLLYRIKDIVLLIL |
Ga0318554_101891201 | 3300031765 | Soil | VNEEPPPPRSRFERLLRDAERRHVPLLTILVTVGV |
Ga0318554_104669861 | 3300031765 | Soil | MTTQSADPPRGRLARLFEAADRRRVPLRTILVTVGVVVATYLAG |
Ga0318546_106593342 | 3300031771 | Soil | VKQQPPPRSRFGRLLRAAERRRVPLLTILVTVGVVAATYLAGKLI |
Ga0318566_103631262 | 3300031779 | Soil | VTDAPPRPEGRLARLWKAADVRHIPLRTIVVTVAVVAATYLAGKLIYRLRDIVLLIV |
Ga0318566_106601691 | 3300031779 | Soil | VNEEPPPRSRFERMLRDAERRHVPLLTILVTVGVVVAVY |
Ga0318523_100665711 | 3300031798 | Soil | VTDQPPPQGRLARLWAYADARHVPLRTIVVTVAVVAATYLVGKLIY |
Ga0318523_105386431 | 3300031798 | Soil | VNEEPPPPRSRFERLLRDAERRHVPLLTILVTVGVVVAVYLAGRLLYRIKDI |
Ga0318497_106493372 | 3300031805 | Soil | VTEQPPPQGRLARLFRYADARHVPLRTIVVTVAVVAAAYLAWLLIYRL |
Ga0318512_101586551 | 3300031846 | Soil | VKEEPPRSRFGRLLRAAERRHVPLLTILVTVGVVAATYLTGKL |
Ga0318495_100619121 | 3300031860 | Soil | VKEEPPRSRFGRLLRAAERRHVPLLTILVTVGVVAATY |
Ga0306919_115254071 | 3300031879 | Soil | VNEQPPPRSRFERLLRDAERRHVPLLTILVTVGVVVAVYLAGQLLYRIK |
Ga0306925_117927372 | 3300031890 | Soil | VTDESPPRGRLARLLDAADRRRVPLRTILVTVAVVAAT |
Ga0318551_105712271 | 3300031896 | Soil | VTDQPAPQGRLARLLQAADQRHVPLRTILVTVAVVAVTYLTGQLLY |
Ga0306921_107131592 | 3300031912 | Soil | VNEEPPPPRSRFERLLRDAERRHVPLLTILVTVGVV |
Ga0310909_114719562 | 3300031947 | Soil | MSDEQPRGRLAHLFEVADRRHIPLRTILVTVGVVVATYLA |
Ga0318507_102166521 | 3300032025 | Soil | MTTQSADPPRGRLARLFEAADRRRVPLRTILVTVGVVVATYLAGKLL |
Ga0318513_102914732 | 3300032065 | Soil | VNEEPPPPRSRFERLLRDAERRHVPLLTILVTVGVVVAVYLAGRLLYRIKDIVLLI |
Ga0318525_102877302 | 3300032089 | Soil | VNEEPPPPRSRFERLLRDAERRHVPLLTILVTVGVVVAVYLAGRLLYRIKD |
Ga0311301_103951181 | 3300032160 | Peatlands Soil | MSCEQPPRGRLARLFEAADRRHVPLRTILVTVAVVVATYLADKLL |
Ga0311301_110716711 | 3300032160 | Peatlands Soil | MSCEQPPRGRLARLFEAADRRHVPLRTILVTAGVVVA |
Ga0335080_117448402 | 3300032828 | Soil | VKEEPPRSRFGRLLRAADRRHVPLLTILVTVGVVAVTYLAGKL |
Ga0335070_104598731 | 3300032829 | Soil | VNEEPPPPRSRFERLLRDAERRRVPLLTILVTVGVVVAVYLAGKLLYRIKDIVLLILVAGFIA |
Ga0335070_112365122 | 3300032829 | Soil | VSDEQPPRGRLARLFQAADRRHVPLRTILVTVAVVVATYL |
Ga0335081_110364791 | 3300032892 | Soil | VKEQPPSSPGRLARLWQAAELRNVPLRTIVVTVLVVAATYLAGKLIY |
Ga0335069_108447352 | 3300032893 | Soil | MSHEQPPRGRLARLFEAAGRRGVPLRTILVTVAVVAP |
Ga0335076_107552183 | 3300032955 | Soil | MSYEQPPRGRLARLFEATDRRHVPLRTILVTVAVVVATYLTGQLIY |
Ga0335076_113031302 | 3300032955 | Soil | MLGDVRDVPPRPQGRLARLWKAAEVRNIPLRTIVTTVAIVAATYLAGKLIYRLRDI |
⦗Top⦘ |