NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073508

Metagenome / Metatranscriptome Family F073508

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073508
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 46 residues
Representative Sequence MFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR
Number of Associated Samples 101
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.33 %
% of genes near scaffold ends (potentially truncated) 31.67 %
% of genes from short scaffolds (< 2000 bps) 84.17 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.167 % of family members)
Environment Ontology (ENVO) Unclassified
(28.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(34.167 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01814Hemerythrin 40.00
PF05532CsbD 15.00
PF01028Topoisom_I 5.83
PF00149Metallophos 1.67
PF04545Sigma70_r4 1.67
PF01566Nramp 1.67
PF13466STAS_2 0.83
PF14907NTP_transf_5 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 15.00
COG3569DNA topoisomerase IBReplication, recombination and repair [L] 5.83
COG1914Mn2+ or Fe2+ transporter, NRAMP familyInorganic ion transport and metabolism [P] 1.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.00 %
UnclassifiedrootN/A10.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_8773747All Organisms → cellular organisms → Bacteria1531Open in IMG/M
2140918013|NODE_4801_length_1319_cov_10.363153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1351Open in IMG/M
2199352025|deepsgr__Contig_137048All Organisms → cellular organisms → Bacteria904Open in IMG/M
2228664021|ICCgaii200_c0895273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11095918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1198Open in IMG/M
3300002155|JGI24033J26618_1042721Not Available636Open in IMG/M
3300002459|JGI24751J29686_10049758All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300003213|JGI26313J46564_100242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2065Open in IMG/M
3300004157|Ga0062590_102148953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium583Open in IMG/M
3300004479|Ga0062595_100686526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium819Open in IMG/M
3300004479|Ga0062595_100698203All Organisms → cellular organisms → Bacteria → Proteobacteria814Open in IMG/M
3300004480|Ga0062592_100857209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300004480|Ga0062592_100865617All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300004480|Ga0062592_102178970Not Available552Open in IMG/M
3300005093|Ga0062594_102627473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium556Open in IMG/M
3300005168|Ga0066809_10009987Not Available1764Open in IMG/M
3300005294|Ga0065705_10179126All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300005294|Ga0065705_10185898All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300005294|Ga0065705_10938103Not Available564Open in IMG/M
3300005345|Ga0070692_10872728All Organisms → cellular organisms → Bacteria → Terrabacteria group620Open in IMG/M
3300005441|Ga0070700_100045987All Organisms → cellular organisms → Bacteria2695Open in IMG/M
3300005444|Ga0070694_100135241All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300005444|Ga0070694_100157480All Organisms → cellular organisms → Bacteria1664Open in IMG/M
3300005444|Ga0070694_101396331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300005471|Ga0070698_100725326All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300005545|Ga0070695_101736317All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300005841|Ga0068863_100013956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7744Open in IMG/M
3300006581|Ga0074048_10724220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300006880|Ga0075429_100355982All Organisms → cellular organisms → Bacteria → Terrabacteria group1282Open in IMG/M
3300009011|Ga0105251_10061638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1763Open in IMG/M
3300009094|Ga0111539_10079014All Organisms → cellular organisms → Bacteria3869Open in IMG/M
3300009100|Ga0075418_11226715All Organisms → cellular organisms → Bacteria → Terrabacteria group813Open in IMG/M
3300009148|Ga0105243_10563211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1091Open in IMG/M
3300009811|Ga0105084_1003895All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300009818|Ga0105072_1070441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium680Open in IMG/M
3300010147|Ga0126319_1312471All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300010399|Ga0134127_10183162All Organisms → cellular organisms → Bacteria1933Open in IMG/M
3300010400|Ga0134122_10296153All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300010999|Ga0138505_100006551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1244Open in IMG/M
3300011119|Ga0105246_10270302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1359Open in IMG/M
3300011119|Ga0105246_12010403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium558Open in IMG/M
3300012204|Ga0137374_10430699All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300012355|Ga0137369_10138637All Organisms → cellular organisms → Bacteria1944Open in IMG/M
3300012938|Ga0162651_100003461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1601Open in IMG/M
3300013306|Ga0163162_12527142All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria591Open in IMG/M
3300014325|Ga0163163_10019310All Organisms → cellular organisms → Bacteria6399Open in IMG/M
3300014745|Ga0157377_10320661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1029Open in IMG/M
3300015077|Ga0173483_10476004All Organisms → cellular organisms → Bacteria → Terrabacteria group660Open in IMG/M
3300015201|Ga0173478_10552356All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300015372|Ga0132256_102171123All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300015374|Ga0132255_100133920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3429Open in IMG/M
3300017965|Ga0190266_11366925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium502Open in IMG/M
3300017997|Ga0184610_1032227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1477Open in IMG/M
3300017997|Ga0184610_1172327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300018027|Ga0184605_10117184All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300018028|Ga0184608_10096872All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1227Open in IMG/M
3300018028|Ga0184608_10461448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300018031|Ga0184634_10300496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium737Open in IMG/M
3300018031|Ga0184634_10442538All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300018031|Ga0184634_10444730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium585Open in IMG/M
3300018054|Ga0184621_10045915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1444Open in IMG/M
3300018072|Ga0184635_10174506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium858Open in IMG/M
3300018073|Ga0184624_10019557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2507Open in IMG/M
3300018075|Ga0184632_10479635Not Available512Open in IMG/M
3300018078|Ga0184612_10068687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1848Open in IMG/M
3300018465|Ga0190269_10100415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1417Open in IMG/M
3300018469|Ga0190270_10031116All Organisms → cellular organisms → Bacteria3471Open in IMG/M
3300018469|Ga0190270_11195170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300019259|Ga0184646_1305775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium870Open in IMG/M
3300019263|Ga0184647_1085675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300019269|Ga0184644_1688809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1130Open in IMG/M
3300019269|Ga0184644_1778192Not Available501Open in IMG/M
3300019767|Ga0190267_10063290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1326Open in IMG/M
3300020005|Ga0193697_1008141All Organisms → cellular organisms → Bacteria2550Open in IMG/M
3300020016|Ga0193696_1014272All Organisms → cellular organisms → Bacteria2150Open in IMG/M
3300020080|Ga0206350_10105488Not Available879Open in IMG/M
3300021082|Ga0210380_10373652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300021082|Ga0210380_10580539Not Available514Open in IMG/M
3300022195|Ga0222625_1546156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1041Open in IMG/M
3300022195|Ga0222625_1639365Not Available564Open in IMG/M
3300022756|Ga0222622_10218107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1276Open in IMG/M
3300025735|Ga0207713_1047288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1742Open in IMG/M
3300025908|Ga0207643_10007419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium5882Open in IMG/M
3300025920|Ga0207649_10777212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium746Open in IMG/M
3300025925|Ga0207650_10024966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4254Open in IMG/M
3300025926|Ga0207659_10123268All Organisms → cellular organisms → Bacteria1989Open in IMG/M
3300025972|Ga0207668_10742138Not Available866Open in IMG/M
3300026075|Ga0207708_10073373All Organisms → cellular organisms → Bacteria2622Open in IMG/M
3300026088|Ga0207641_10285642All Organisms → cellular organisms → Bacteria1553Open in IMG/M
3300026758|Ga0207559_100564All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300027454|Ga0207623_101340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300028589|Ga0247818_10665512Not Available720Open in IMG/M
3300028711|Ga0307293_10039044All Organisms → cellular organisms → Bacteria1455Open in IMG/M
3300028717|Ga0307298_10157214All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028722|Ga0307319_10019737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2064Open in IMG/M
3300028784|Ga0307282_10042249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2010Open in IMG/M
3300028796|Ga0307287_10132666All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300028803|Ga0307281_10112968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium924Open in IMG/M
3300028812|Ga0247825_10479778All Organisms → cellular organisms → Bacteria → Terrabacteria group884Open in IMG/M
3300028814|Ga0307302_10297255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300028828|Ga0307312_10284963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1074Open in IMG/M
3300028889|Ga0247827_10793674All Organisms → cellular organisms → Bacteria → Terrabacteria group626Open in IMG/M
3300030829|Ga0308203_1047000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300030830|Ga0308205_1035158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300030902|Ga0308202_1012586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1212Open in IMG/M
3300030902|Ga0308202_1076575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium658Open in IMG/M
3300030903|Ga0308206_1085608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium686Open in IMG/M
3300031091|Ga0308201_10160657All Organisms → cellular organisms → Bacteria → Terrabacteria group712Open in IMG/M
3300031547|Ga0310887_10033546All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300031547|Ga0310887_10277602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300031847|Ga0310907_10041999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1724Open in IMG/M
3300031847|Ga0310907_10867898All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300031854|Ga0310904_10108570Not Available1540Open in IMG/M
3300031858|Ga0310892_10141896All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300031892|Ga0310893_10091009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1102Open in IMG/M
3300032003|Ga0310897_10125009All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300032013|Ga0310906_10026592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2572Open in IMG/M
3300032017|Ga0310899_10035536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1735Open in IMG/M
3300032075|Ga0310890_11079359All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300032211|Ga0310896_10530358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment10.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil8.33%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment6.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.50%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.67%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.67%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300003213Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10K4-12EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026758Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K4-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027454Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G09K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_024474602088090015SoilMFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAI
Iowa-Corn-GraphCirc_035877002140918013SoilMFIGRVEETGVIEPLVLPRIVFPRATPADEPVPPTTGSDEPVPEPAAAM
deepsgr_022247902199352025SoilMFIGQVEETGVIEPLVFPRVVPVDEPVTQESEPDEPVLDPAAAR
ICCgaii200_089527312228664021SoilMFIGEVEETGVIEPVVFPQVLADXPLPSXXETXDPVLXPAAT
ICChiseqgaiiFebDRAFT_1109591823300000363SoilMFIGRVEETGVIEPLVLPRIVFPRATPADEPVPPTTGSDEPVPEPAAAM*
JGI24033J26618_104272123300002155Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPV
JGI24751J29686_1004975833300002459Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEP
JGI26313J46564_10024243300003213SoilMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPXAAR*
Ga0062590_10214895323300004157SoilMFIGQVEETGVIEPVVFPRVVPADEPMVPSTEPEEPVLEPAAAM*
Ga0062595_10068652623300004479SoilMFIGEVEETGVIEPVVFPQVLADEPLPSASETVDPVLEPAAT*
Ga0062595_10069820323300004479SoilMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR*
Ga0062592_10085720933300004480SoilKEAVMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPAAAM*
Ga0062592_10086561733300004480SoilFIGEVEETGVIEPVVFPQVLADEPLPSASETEDPVLEPAAT*
Ga0062592_10217897023300004480SoilMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR*
Ga0062594_10262747323300005093SoilMFMGQVEETGVIEPPVFPRVVAAAEPVAPQAEPDEPVMEPAAAR*
Ga0066809_1000998713300005168SoilMAVGIDTTALEEALMFIGEVEDTGVIEPVVFPRVVPADELVYSAETDDPILEPAAAV*
Ga0065705_1017912633300005294Switchgrass RhizosphereVDPTWWVNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETKPEEPVLEPAAAR*
Ga0065705_1018589833300005294Switchgrass RhizosphereMFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAT*
Ga0065705_1093810323300005294Switchgrass RhizosphereMIFIGQVEETGVIEPVVFPSVVPADEPRVPSTEPDEPAPEPAAAM*
Ga0070692_1087272823300005345Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAM*
Ga0070700_10004598763300005441Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPAAAM*
Ga0070694_10013524113300005444Corn, Switchgrass And Miscanthus RhizosphereMFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT*
Ga0070694_10015748013300005444Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPA
Ga0070694_10139633113300005444Corn, Switchgrass And Miscanthus RhizosphereFIGQVEETGVIEPLVFPRALPADEPVAPQTEPDEPVLEPAAAR*
Ga0070698_10072532623300005471Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPLRFPLVAPADQPVSPQTESGEPILEPAAAR*
Ga0070695_10173631723300005545Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT*
Ga0068863_10001395673300005841Switchgrass RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEAVLEPAAAR*
Ga0074048_1072422023300006581SoilALEEALMFIGEVEDTGVIEPVVFPQVVPADELVYSAETDDPILEPAAAV*
Ga0075429_10035598233300006880Populus RhizosphereMFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVPEPAAT*
Ga0105251_1006163853300009011Switchgrass RhizosphereGRCDPTVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR*
Ga0111539_1007901423300009094Populus RhizosphereMFIGQVEEIGLIEPLVFPRVVPADEPVSPPTESDEPILEPTAAG*
Ga0075418_1122671523300009100Populus RhizosphereMFIGEVEETGVIEPVVFPQVLADEPLPSTTETEVRIPEPAAAT*
Ga0105243_1056321133300009148Miscanthus RhizosphereMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLE
Ga0105084_100389533300009811Groundwater SandMFIGEVEETGVIEPVVFPQVLADEPLPSASETEDPVLEPAAT*
Ga0105072_107044113300009818Groundwater SandSTPQTEEAVMFIGEVEETGFIEPVVFPQVVADEPVPSTTETEDPVLEPAAT*
Ga0126319_131247143300010147SoilMFIGQVEETGVIEPVVFPRAVPADEPVTPPTEPDDPLLEPAAAM*
Ga0134127_1018316233300010399Terrestrial SoilMFIGQVEETGVIEPLVFPLVAPADQPVSPQTESGEPILEPAAAR*
Ga0134122_1029615313300010400Terrestrial SoilMFIGQVEETGIIEPVVFPRVVLADEPIVPSTEPDELAPEPAAAM*
Ga0138505_10000655123300010999SoilMFIGEVEETGVIEPVVFPQVLADELLPSATETEDPVLEPAAT*
Ga0105246_1027030233300011119Miscanthus RhizosphereVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR*
Ga0105246_1201040323300011119Miscanthus RhizosphereMFIGQVEETGVIEPLVFPRVVPADEPVSPQTESDEPILEPAAAR*
Ga0137374_1043069933300012204Vadose Zone SoilMFIGEVEETGVIEPVVFPQILADEPRPSTTETEDPVLEPAAT*
Ga0137369_1013863753300012355Vadose Zone SoilVVFIGEVEETGVIEPVVFPQILADEPRPSTTETEDPVLEPAAT*
Ga0162651_10000346143300012938SoilTGVIEPVVFPQILADEPLPSATETEDPVLEPAAT*
Ga0163162_1252714223300013306Switchgrass RhizosphereVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR*
Ga0163163_1001931013300014325Switchgrass RhizosphereAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPHTEPDEPILEPAAAR*
Ga0157377_1032066113300014745Miscanthus RhizosphereVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAT*
Ga0173483_1047600413300015077SoilMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDES
Ga0173478_1055235623300015201SoilMLIGRVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR*
Ga0132256_10217112313300015372Arabidopsis RhizosphereKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR*
Ga0132255_10013392083300015374Arabidopsis RhizosphereVDPTWWGNHTADAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETKPEEPVLEPAAAR*
Ga0190266_1136692523300017965SoilMFIGEVEETGVIEPVVFPQVLADDPLHSTTETEDPVLEPAAT
Ga0184610_103222713300017997Groundwater SedimentGYRHRRPEEAVMFIGEVEETGVIEPVVFPQVVADEPDPSRTETEDPVPDPRQPCDV
Ga0184610_117232723300017997Groundwater SedimentMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV
Ga0184605_1011718423300018027Groundwater SedimentMLIGEVEETGVIEPVVFPRVVPADEPSVPSTEPDEPVLEPAAAM
Ga0184608_1009687243300018028Groundwater SedimentMFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCDV
Ga0184608_1046144813300018028Groundwater SedimentMLIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLEPAAAM
Ga0184634_1030049613300018031Groundwater SedimentMFIGQVEETGVIEPLVFPRAVLADEPVTPTTGSGEPAPEPAVAK
Ga0184634_1044253813300018031Groundwater SedimentMFIGEVEETGVIEPVVFPQVLADEPLPSASATEDPVLEPAAT
Ga0184634_1044473023300018031Groundwater SedimentGYRHRRPEETVMFIGEVEETGVIEPVVFPQVLADEPVPSRTETEDPVPDPRQPCDV
Ga0184621_1004591523300018054Groundwater SedimentMFIGEVEQTGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV
Ga0184635_1017450613300018072Groundwater SedimentAVMFIGEVEETGVIEPVVFPQVVADEPDPSRTETEDPVPDPRQPCDV
Ga0184624_1001955733300018073Groundwater SedimentMFIGEVEETGVIEPVVFPQVVADEPDPSRTETEDPVPDPRQPCDV
Ga0184632_1047963513300018075Groundwater SedimentMFIGEVEETGVIEPVVFPQVLADEPVPSRTETEDPVPDPRQPCDV
Ga0184612_1006868713300018078Groundwater SedimentIGEVEETGVIEPVVFPQVLADEPLPSASATEDPVLEPAAT
Ga0190269_1010041533300018465SoilMFIGEVEETGVIEPVVFPQVLADDPLPSTTETEDPVLEPAAT
Ga0190270_1003111653300018469SoilMFIGEVVETGVIEPVVFPQVLADEPLPCTTETEVPVPESAAAT
Ga0190270_1119517013300018469SoilMFIGQVEDTGVIEPLVFPRVVAADEPMTPQTEPDGPVLEPAAAR
Ga0184646_130577513300019259Groundwater SedimentVMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV
Ga0184647_108567513300019263Groundwater SedimentMFIGQVEETGVIEPVVFPRVVLADEPMVPSTEPDEPAPEPAAAM
Ga0184644_168880923300019269Groundwater SedimentMFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCDA
Ga0184644_177819223300019269Groundwater SedimentGYRHRRPEEAVMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPAAAV
Ga0190267_1006329023300019767SoilMFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDSVLEPAAT
Ga0193697_100814143300020005SoilMEPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM
Ga0193696_101427273300020016SoilHTMEPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM
Ga0206350_1010548823300020080Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR
Ga0210380_1037365223300021082Groundwater SedimentVDPKEAVMFIGEVEETGVIEPVVFPRVVPADEPADAATGIEDPVLEPAAAM
Ga0210380_1058053913300021082Groundwater SedimentGRPESGVVDPTVVGSPHRDAKEAVMFIGQVEETGVIEPLLFPRVVPADEPVTPATEPDEPVLEPAAAR
Ga0222625_154615623300022195Groundwater SedimentMFIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLEPAAAM
Ga0222625_163936523300022195Groundwater SedimentMFIGEVVETGVIEPVVFPQVLADEPLPCTTETEVPVPEPAAAT
Ga0222622_1021810723300022756Groundwater SedimentMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM
Ga0207713_104728813300025735Switchgrass RhizosphereTVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR
Ga0207643_1000741943300025908Miscanthus RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPVAAR
Ga0207649_1077721223300025920Corn RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTKPDEPVLEPAAAR
Ga0207650_1002496643300025925Switchgrass RhizosphereMFIGEVEETGVIEPVVFPQVLADEPLPSTTETEDPVLEPAAT
Ga0207659_1012326843300025926Miscanthus RhizosphereVVGNHTADAKEAVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR
Ga0207668_1074213823300025972Switchgrass RhizosphereVDPTARVNHTADAKEAVMFMGQVEETGVIEPPVFPRVVGAAEPVAPQAEPDEPVMESAAA
Ga0207708_1007337323300026075Corn, Switchgrass And Miscanthus RhizosphereMFIGQVEETGVIEPILFPRTVPADEPKVPSTEPDESVLEPAAAM
Ga0207641_1028564233300026088Switchgrass RhizosphereMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEAVLEPAAAR
Ga0207559_10056433300026758SoilMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDE
Ga0207623_10134023300027454SoilMFIGEVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR
Ga0247818_1066551223300028589SoilMIFIGQVEETGVIEPVVFPSVVPADEPRVPSTEPDEPAPEPAAAR
Ga0307293_1003904433300028711SoilMFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT
Ga0307298_1015721413300028717SoilMFIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLE
Ga0307319_1001973743300028722SoilMFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCD
Ga0307282_1004224933300028784SoilMFIGEVVETGVIEPVVFPRAVPADEPVPSRTEAEDPIPQPAAAT
Ga0307287_1013266623300028796SoilVGIHHTMDPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM
Ga0307281_1011296833300028803SoilVDPKEAVMFIGEVEETGVIEPVVFPRVVPADEPAHAATEIEDPVLEPAAAM
Ga0247825_1047977823300028812SoilVDPTWWVNHTADAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPVLEPAAA
Ga0307302_1029725523300028814SoilMDPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM
Ga0307312_1028496333300028828SoilQGGVMFIGEVVETGVIEPVVFPRAVPADEPVPSRTEAEDPIPQPAAAT
Ga0247827_1079367423300028889SoilMFMEQVEETGVIEPPVFPRVVAAAEPVAPQAEPDEPVMEPAAAR
Ga0308203_104700013300030829SoilDGTGYRHRRPEEAVMFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT
Ga0308205_103515823300030830SoilVMFIGEVEETGVIEPVVFPQVVADEPVPSRTETEDPVPDPRQPCDV
Ga0308202_101258613300030902SoilVMFIGEVEETGIIEPVVFPRVEPADEPVPSRTEAEDPVPEPEAAV
Ga0308202_107657523300030902SoilVMFIGEVEETGVIEPVVFPQVLADEPLPSATETEDPVLEPAAT
Ga0308206_108560823300030903SoilVDPKEAVMFIGQVEETGVIEPVVFPRVVPADEPRVPSTEPDEPVLEPAAAM
Ga0308201_1016065713300031091SoilMFIGEVEETGVIEPGVFPRVEPADEPVPSSTEAEVPILGPAAAR
Ga0310887_1003354643300031547SoilVDPTWWVNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETKPEEPVLEPAAA
Ga0310887_1027760213300031547SoilVEETGVLEPLVFPRVVPADEPVTQETEPDEPVLEPAAAR
Ga0310907_1004199913300031847SoilNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPVLEPAAAR
Ga0310907_1086789813300031847SoilMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEP
Ga0310904_1010857033300031854SoilVDPTWWVNHTADAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPDEPVLEPAAA
Ga0310892_1014189623300031858SoilVDPTWWVNHTAYAKEAVMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPALEPAAA
Ga0310893_1009100923300031892SoilMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPEEPVLEPAAAR
Ga0310897_1012500913300032003SoilMFIGQVEETGVIEPLVFPRALPADEPVTPHTEPDEPILEPAAAR
Ga0310906_1002659243300032013SoilMFIGQVEETGVLEPLVFPRVVPADEPVTQETEPDEPVLEPAAAR
Ga0310899_1003553623300032017SoilVDPTWWVNHTAYAKEAVMFIGQVEETGVIEPLVFPRVVPANEPVTPQTEPDEPVLEPAAA
Ga0310890_1107935913300032075SoilMFIGKVEETGVIEPVVFPRVVPADEPMVPTTEPQEPVLEPAAAM
Ga0310896_1053035823300032211SoilVMFIGQVEETGVIEPLVFPRALPADEPVTPQTEPDEPVLEPAAAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.