Basic Information | |
---|---|
Family ID | F073467 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 40 residues |
Representative Sequence | DPLVELQVIEKLLSLGLITTEQAMEMTDLTPNGSEGIS |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 94.17 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (87.500 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (17.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.833 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.30% β-sheet: 0.00% Coil/Unstructured: 69.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF04586 | Peptidase_S78 | 78.33 |
PF05065 | Phage_capsid | 19.17 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 78.33 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 19.17 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 92.50 % |
Unclassified | root | N/A | 7.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_108874664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300002835|B570J40625_100955156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300003393|JGI25909J50240_1124036 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300003394|JGI25907J50239_1079804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 644 | Open in IMG/M |
3300003411|JGI25911J50253_10128597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300004763|Ga0007746_1255334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300004769|Ga0007748_11288972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300005942|Ga0070742_10111072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300006639|Ga0079301_1081532 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1008 | Open in IMG/M |
3300006802|Ga0070749_10308257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
3300006802|Ga0070749_10436998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300006805|Ga0075464_10117214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1544 | Open in IMG/M |
3300006805|Ga0075464_10733261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300006920|Ga0070748_1249541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300006920|Ga0070748_1273746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300006920|Ga0070748_1370155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300007519|Ga0105055_10798177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
3300007538|Ga0099851_1033908 | All Organisms → Viruses → Predicted Viral | 2038 | Open in IMG/M |
3300007540|Ga0099847_1135412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300007640|Ga0070751_1205353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300007973|Ga0105746_1219001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300008107|Ga0114340_1186953 | Not Available | 715 | Open in IMG/M |
3300008107|Ga0114340_1272071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300008108|Ga0114341_10374064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300008108|Ga0114341_10443403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300008116|Ga0114350_1142006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300008120|Ga0114355_1177917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300008120|Ga0114355_1221464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300008266|Ga0114363_1224499 | Not Available | 553 | Open in IMG/M |
3300008448|Ga0114876_1063372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300008450|Ga0114880_1183081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300009068|Ga0114973_10174845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1183 | Open in IMG/M |
3300009155|Ga0114968_10251059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
3300009160|Ga0114981_10552787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300009164|Ga0114975_10593740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300009180|Ga0114979_10204486 | Not Available | 1195 | Open in IMG/M |
3300009180|Ga0114979_10487283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300009180|Ga0114979_10526585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 681 | Open in IMG/M |
3300009180|Ga0114979_10600441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300009180|Ga0114979_10758665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300009183|Ga0114974_10430686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300009185|Ga0114971_10788243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300009419|Ga0114982_1075523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
3300009469|Ga0127401_1039075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1360 | Open in IMG/M |
3300010885|Ga0133913_10930527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2254 | Open in IMG/M |
3300011183|Ga0136713_1060788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300012707|Ga0157623_1206039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300012708|Ga0157595_1174923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1929 | Open in IMG/M |
3300012714|Ga0157601_1221749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1997 | Open in IMG/M |
3300012715|Ga0157599_1228618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1928 | Open in IMG/M |
3300012717|Ga0157609_1195330 | All Organisms → Viruses → Predicted Viral | 1816 | Open in IMG/M |
3300012725|Ga0157610_1150118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4246 | Open in IMG/M |
3300012757|Ga0157628_1180917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1886 | Open in IMG/M |
3300013005|Ga0164292_10214579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1361 | Open in IMG/M |
3300013005|Ga0164292_10314879 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
3300017701|Ga0181364_1004868 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
3300017761|Ga0181356_1205049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300017774|Ga0181358_1159552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300017777|Ga0181357_1070870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1341 | Open in IMG/M |
3300017777|Ga0181357_1299776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300017778|Ga0181349_1246757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300017780|Ga0181346_1196848 | Not Available | 729 | Open in IMG/M |
3300017785|Ga0181355_1302980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300017785|Ga0181355_1346232 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
3300020172|Ga0211729_10011837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300020498|Ga0208050_1015284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300021438|Ga0213920_1008874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3130 | Open in IMG/M |
3300021956|Ga0213922_1067683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
3300021962|Ga0222713_10361024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300024356|Ga0255169_1006623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2450 | Open in IMG/M |
3300024482|Ga0255265_1082688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300024552|Ga0256345_1058469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
3300024569|Ga0255243_1144818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300024573|Ga0256337_1095210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300025635|Ga0208147_1040759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1205 | Open in IMG/M |
3300025645|Ga0208643_1071701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300025896|Ga0208916_10021912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2531 | Open in IMG/M |
3300027285|Ga0255131_1075152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300027291|Ga0255139_1077043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 561 | Open in IMG/M |
3300027293|Ga0255132_1081847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
3300027365|Ga0209300_1068347 | Not Available | 549 | Open in IMG/M |
3300027621|Ga0208951_1130386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300027659|Ga0208975_1049904 | All Organisms → Viruses → Predicted Viral | 1287 | Open in IMG/M |
3300027710|Ga0209599_10105912 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
3300027721|Ga0209492_1128154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 890 | Open in IMG/M |
3300027721|Ga0209492_1299989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300027733|Ga0209297_1231798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300027734|Ga0209087_1352034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300027746|Ga0209597_1078109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1550 | Open in IMG/M |
3300027759|Ga0209296_1029346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3045 | Open in IMG/M |
3300027763|Ga0209088_10174195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300027770|Ga0209086_10283009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300027785|Ga0209246_10309924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027798|Ga0209353_10211488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 846 | Open in IMG/M |
3300027816|Ga0209990_10026321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3189 | Open in IMG/M |
3300027900|Ga0209253_10705528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300027972|Ga0209079_10188756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300031758|Ga0315907_10530002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300031951|Ga0315904_10882907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300031951|Ga0315904_11250642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300031952|Ga0315294_10888678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300031963|Ga0315901_10813009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300031999|Ga0315274_11464000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300032116|Ga0315903_10772693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300032116|Ga0315903_10905201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300032116|Ga0315903_11152081 | Not Available | 527 | Open in IMG/M |
3300032173|Ga0315268_10192149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1950 | Open in IMG/M |
3300033981|Ga0334982_0316219 | Not Available | 730 | Open in IMG/M |
3300033981|Ga0334982_0500484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300033994|Ga0334996_0428008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300033996|Ga0334979_0742228 | Not Available | 509 | Open in IMG/M |
3300033996|Ga0334979_0763436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
3300034062|Ga0334995_0656981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300034082|Ga0335020_0334196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300034093|Ga0335012_0447006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300034101|Ga0335027_0650399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300034102|Ga0335029_0619506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300034117|Ga0335033_0125733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1452 | Open in IMG/M |
3300034122|Ga0335060_0559548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.50% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 15.00% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.17% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.83% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.67% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.67% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.83% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.33% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.50% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.50% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.67% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.67% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.67% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.83% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.83% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.83% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.83% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.83% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012757 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300024356 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8d | Environmental | Open in IMG/M |
3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027285 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300027291 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1088746641 | 3300002408 | Freshwater | IDKTFLRTDPLAELLVIEKLLSLGLITTEQAMEMTDLTPNGSNGME* |
B570J40625_1009551562 | 3300002835 | Freshwater | TDPLQELAVIEKLLTLNLITPEQAMEMTDLTPNGNNGLV* |
JGI25909J50240_11240361 | 3300003393 | Freshwater Lake | RTDPLQELAVIEKLLSLDLITQEQAMGMTDLTPNGSYGMQ* |
JGI25907J50239_10798041 | 3300003394 | Freshwater Lake | NFLRTDPLVELAVIREMLDLQLITVEQAMGMTDLTPNGSHGMIYE* |
JGI25911J50253_101285972 | 3300003411 | Freshwater Lake | KQDPLVEIQVIEKLLTLGLITLEQAMEMTDLTPNGSEGMS* |
Ga0007746_12553341 | 3300004763 | Freshwater Lake | DTFLKQDPLVEIQVIEKLLTLGLITLEQAMEMTDLTPNGSEGMS* |
Ga0007748_112889721 | 3300004769 | Freshwater Lake | TDPLVELAVIREMIDLQLITVEQAMGMTDLTPNGSHGMIYE* |
Ga0070742_101110721 | 3300005942 | Estuarine | ANPMDELLVIEKLLALGLIDVSTAMEMTDLTPNGSNGMN* |
Ga0079301_10815321 | 3300006639 | Deep Subsurface | QDPLQELLVIEKLLALGLITVEQAMEMTDQTPNGNEGMTS* |
Ga0070749_103082571 | 3300006802 | Aqueous | LVEIQVLEKLLSLGLITTEQAMSMTDLTPNGLEGM* |
Ga0070749_104369981 | 3300006802 | Aqueous | HNPLDELAVIEKLLALELITSEQAMEMTDLTPNGKDGMLS* |
Ga0075464_101172141 | 3300006805 | Aqueous | ASFLRANPMDELLVIEKLLALGLIDQAQAMEMTDLTPNGSEGL* |
Ga0075464_107332611 | 3300006805 | Aqueous | PMAELAVIEKLLALGLITTEQAMEMTDLTPNGSEGLS* |
Ga0070748_12495412 | 3300006920 | Aqueous | DTFLKQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSEGL* |
Ga0070748_12737461 | 3300006920 | Aqueous | NFLRTDPLQELAVIEKLLSLDLITQEQAMGMTDLTPNGSQGME* |
Ga0070748_13701552 | 3300006920 | Aqueous | FDSFLKSDPLIELQVIEKLLTLGLITTEQAMEMTDLTPNGSEGMS* |
Ga0105055_107981772 | 3300007519 | Freshwater | QEPLTELAILEKLLALELITKDQAMRMTELTPNGMAE* |
Ga0099851_10339081 | 3300007538 | Aqueous | KNFLRTDPLEELAVIEKLLALNLVTPEQAMEMTDLTPNGSQGLL* |
Ga0099847_11354122 | 3300007540 | Aqueous | FDTFLKPDLPDKLQVIVKLLSLQLIPTEPALEMTDLTPNGSEGMS* |
Ga0070751_12053531 | 3300007640 | Aqueous | PMDELLVIEKMLSLGLITLEQAMEMTDLTPNGNEGM* |
Ga0105746_12190012 | 3300007973 | Estuary Water | LRANPMDELLVIEKLLGLGLITIEQAMEMTDLTPNGSEGMS* |
Ga0114340_11869531 | 3300008107 | Freshwater, Plankton | DKNFLRTDPLQELAVIEKLLSLGLVTTEQAMEMTDLSPNGSNGME* |
Ga0114340_12720711 | 3300008107 | Freshwater, Plankton | VFDTFLKNDPLVELQVLEKLLTLGLITTEQAMEMTDLTPNGSEGIS* |
Ga0114341_103740641 | 3300008108 | Freshwater, Plankton | LRTDPLQELAVIEKLLSLGLITTEQAMEMTDLSPNGSNGME* |
Ga0114341_104434032 | 3300008108 | Freshwater, Plankton | RTDPLQELAVIEKLLALNLVTQEQAMEMTDLTPNGSNGLE* |
Ga0114350_11420061 | 3300008116 | Freshwater, Plankton | KNYLRTDPLQELAVIREMLDLQLITQEQAMAMTDLTPNGSEGMI* |
Ga0114355_11779172 | 3300008120 | Freshwater, Plankton | MQELLVIEKLLSLGLITLEQAMEMTDQTPNGNGGM* |
Ga0114355_12214641 | 3300008120 | Freshwater, Plankton | TDTFLRQDPLAELAVIEKLLSLGLISPEQAMEMTDQTPNGNGGM* |
Ga0114363_12244992 | 3300008266 | Freshwater, Plankton | MQELLVIEKLLSLGLITLEQAMEMTDQTSNGNGGM* |
Ga0114876_10633721 | 3300008448 | Freshwater Lake | VELQVLEKLLTLGLISTEQAMEMTDLTPNGIEGMS* |
Ga0114880_11830811 | 3300008450 | Freshwater Lake | PLAELAVIREMLDLQLITQEQAMAMTDLTPNGSEGMI* |
Ga0114973_101748452 | 3300009068 | Freshwater Lake | VEIQVLEKLLTLGLITTEQAMAMTDLTPNGSEGL* |
Ga0114968_102510592 | 3300009155 | Freshwater Lake | GDTFLKQDPLVEIQVLEKLLTLGLITTEQAMSMTDLTPNGSEGIS* |
Ga0114981_105527871 | 3300009160 | Freshwater Lake | VGDTFLKQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSEGL* |
Ga0114975_105937402 | 3300009164 | Freshwater Lake | VELQIIRELLDLQLITQEQAMEMTDLTPNGSQGMQ* |
Ga0114979_102044861 | 3300009180 | Freshwater Lake | ANPMDELLVIEKLLTLGLIDINTAMEMTDLTPNGSNGME* |
Ga0114979_104872831 | 3300009180 | Freshwater Lake | SDTFLKQDPLVEIQVLEKLLTLGLITTEQAMAMTDLTPNGSAGI* |
Ga0114979_105265851 | 3300009180 | Freshwater Lake | FLKQDPMVELQVVEKLLTLGLITTEQAMEMTDLSPNGSEGIS* |
Ga0114979_106004411 | 3300009180 | Freshwater Lake | TFLKQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSEGL* |
Ga0114979_107586651 | 3300009180 | Freshwater Lake | PMEELAVIEKLLTLNLITPEQAMEMTDLTPNGSQGMQ* |
Ga0114974_104306862 | 3300009183 | Freshwater Lake | VGDTFLKQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSAGI* |
Ga0114971_107882431 | 3300009185 | Freshwater Lake | PLVELQVIEKLLALGLITTEQAMGMTDLTPNGSEGL* |
Ga0114982_10755231 | 3300009419 | Deep Subsurface | TFLKSDPMAELEVIEKMLTLGLISTEQAMEMTDLTPNGSEGMS* |
Ga0127401_10390751 | 3300009469 | Meromictic Pond | YDTFLKADPLVELAVIEKLLTLGLITTEQAMSMSDLTPNGSEGIS* |
Ga0133913_109305273 | 3300010885 | Freshwater Lake | DPMEELAVIEKLLSLNLITTEQAMAMTDLTPNGSQGMQ* |
Ga0136713_10607881 | 3300011183 | Freshwater | ELAVIEKLLALNLVTQEQAMEMTDLTPNGSNGLE* |
Ga0157623_12060391 | 3300012707 | Freshwater | QELAVIRELLDLQLITQEQAMEMTDLTPNGSEGMI* |
Ga0157595_11749231 | 3300012708 | Freshwater | LKNDPLVELQVIEKLLTLGLVTPEQAMEMTDLSPNGSEGIS* |
Ga0157601_12217491 | 3300012714 | Freshwater | FLKNDPLVELQVIEKLLTLGLVTPEQAMEMTDLSPNGSEGIS* |
Ga0157599_12286183 | 3300012715 | Freshwater | KNDPLVELQVIEKLLTLGLVTPEQAMEMTDLSPNGSEGIS* |
Ga0157609_11953301 | 3300012717 | Freshwater | VELQVIEKLLTLGLVTPEQAMEMTDLSPNGSEGIS* |
Ga0157610_11501181 | 3300012725 | Freshwater | DTFLKNDPLVELQVIEKLLTLGLVTPEQAMEMTDLSPNGSEGIS* |
Ga0157628_11809171 | 3300012757 | Freshwater | LVELQVIEKLLTLGLVTPEQAMEMTDLSPNGSEGIS* |
Ga0164292_102145791 | 3300013005 | Freshwater | PIAELTVIEKLLSLGLISTEQAMEMTDLTPNGSEGMS* |
Ga0164292_103148792 | 3300013005 | Freshwater | AVFDTFLKNDPLVELQVLEKLLTLGMVTPEQAMEMTDLTPNGSEGLS* |
Ga0181364_10048681 | 3300017701 | Freshwater Lake | KNFLRTDPLQELAVIEKLLSLDLITQEQAMGMTDLTPNGSYGMQ |
Ga0181356_12050491 | 3300017761 | Freshwater Lake | KNYLLPDQLHQIAVLETLLSLNLITQEQAMGMTDLTPNGSYGMQ |
Ga0181358_11595521 | 3300017774 | Freshwater Lake | TDPLVELAIIREMLDLQLITQEQAMSMTDLTPNGSHGMIYE |
Ga0181357_10708701 | 3300017777 | Freshwater Lake | VELAIIREMLDLQLITQEQAMSMTDLTPNGSHGIIYE |
Ga0181357_12997761 | 3300017777 | Freshwater Lake | NYLRTDPLKELSIIRELLDLQLITQEQAMEMTDLTPNGSEGMQ |
Ga0181349_12467571 | 3300017778 | Freshwater Lake | LQELAVIEKLLSLDLITQEQAMGMTDLTPNGSYGMQ |
Ga0181346_11968481 | 3300017780 | Freshwater Lake | DPLQELAVIRELLDLQLITQEQAMEMTDLTPNGSEGMI |
Ga0181355_13029801 | 3300017785 | Freshwater Lake | LRTDPLQELAVIEKLLSLDLITQEQAMGMTDLTPNGSYGMQ |
Ga0181355_13462322 | 3300017785 | Freshwater Lake | RTDPLVELAVIREMLDLQLITQEQAMGMTDLTPNGSQGMIYE |
Ga0211729_100118372 | 3300020172 | Freshwater | QELAVIEKLLSLNLITQEQAMKMTDLTPNGSQGLE |
Ga0208050_10152842 | 3300020498 | Freshwater | DPLAELAVIREMLDLQLITQEQAMAMTDLTPNGSEGMQ |
Ga0163149_102067521 | 3300020596 | Freshwater Microbial Mat | LMVIEKLLALELITTEQAQSMEQLSPNGESNVTNI |
Ga0213920_10088746 | 3300021438 | Freshwater | EELAVIEKLLALNLITPEQAMEMTDLTPNGSNGMA |
Ga0213922_10676831 | 3300021956 | Freshwater | FLKNDPLVELQVLEKLLSLGLISTEQAMEMTDLTPNGSEGMS |
Ga0222713_103610242 | 3300021962 | Estuarine Water | LRTDPLAELAVIEKLLSLGLVTTEQAMEMTDLSPNGSNGMA |
Ga0255169_10066231 | 3300024356 | Freshwater | DPLVELQVIEKLLSLGLITTEQAMEMTDLTPNGSEGIS |
Ga0255265_10826882 | 3300024482 | Freshwater | NDPLVELQVIEKLLSLGLITTEQAMEMTDLTPNGSEGIS |
Ga0256345_10584691 | 3300024552 | Freshwater | VELQVIEKLLSLGLITTEQAMEMTDLTPNGSEGIS |
Ga0255243_11448181 | 3300024569 | Freshwater | DALTRLQVTEKLLSLGLITIEQAREMEDLTPNGSEIIDV |
Ga0256337_10952102 | 3300024573 | Freshwater | AVFDTFLKNDPLVELQVIEKLLSLGLITTEQAMEMTDLTPNGSEGIS |
Ga0208147_10407592 | 3300025635 | Aqueous | NYLRTDPLVELQIIRELLDLQLITQEQAMEMTDLTPNGSQGMQ |
Ga0208643_10717012 | 3300025645 | Aqueous | GDTFLKQDPLVEIQVLEKLLSLGLITTEQAMSMTDLTPNGSEGL |
Ga0208916_100219121 | 3300025896 | Aqueous | EELAVIEKLLSLNLITTEQAMEMTDLTPNGSQGME |
Ga0255131_10751522 | 3300027285 | Freshwater | DPMVELQVIEKLLALGLITIEQAMEMTDLSPNGSEGIS |
Ga0255139_10770432 | 3300027291 | Freshwater | PMVELQVIEKLLALGLITIEQAMEMTDLSPNGSEGIS |
Ga0255132_10818471 | 3300027293 | Freshwater | FDTFLKEDPMVELQVIEKLLALGLITIEQAMEMTDLSPNGSEGIS |
Ga0209300_10683471 | 3300027365 | Deep Subsurface | LRTDPIVELQIIRELLDLQLITQDQAMEMTDLTPNGSGEMQ |
Ga0208951_11303862 | 3300027621 | Freshwater Lentic | KNYLRTDPLVELAVIREMLDLQLITQEQAMGMTDLTPNGSHGMIYE |
Ga0208975_10499041 | 3300027659 | Freshwater Lentic | DPLQELAVIEKLLSLDLITQEQAMGMTELTPNGSYGMQ |
Ga0209599_101059121 | 3300027710 | Deep Subsurface | TFLKSDPMAELEVIEKMLTLGLISTEQAMEMTDLTPNGSEGMS |
Ga0209492_11281541 | 3300027721 | Freshwater Sediment | QDPMVELQVVEKLLSLGLITTEQAMEMSDLTPNGSEGLS |
Ga0209492_12999891 | 3300027721 | Freshwater Sediment | RTDPLAELAVIREMLDLQLITQEQAMAMTDLTPNGSEGMI |
Ga0209297_12317981 | 3300027733 | Freshwater Lake | TDPMEELAVIEKLLSLNLITQEQAMGMTDLTPNGSQGMQ |
Ga0209087_13520342 | 3300027734 | Freshwater Lake | FCVGDTFLKQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSEGL |
Ga0209597_10781092 | 3300027746 | Freshwater Lake | PLVEIQVLEKLLTLGLITTEQAMAMTDLTPNGSEGL |
Ga0209296_10293466 | 3300027759 | Freshwater Lake | GDTFLKQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSEGL |
Ga0209088_101741951 | 3300027763 | Freshwater Lake | YLRTDPLVELSIIRELLDLQLITQDQAMAMTDLTPNGNGGMQ |
Ga0209086_102830092 | 3300027770 | Freshwater Lake | VEIQVLEKLLTLGLITTEQAMSMTDLTPNGSEGIS |
Ga0209246_103099242 | 3300027785 | Freshwater Lake | RTDPLKELSIIRELLDLQLITQEQAMEMTDLTPNGSEGMQ |
Ga0209353_102114881 | 3300027798 | Freshwater Lake | RTDPLAELAVIEKLLSLGLITTEQAMEMTDLSPNGSNGME |
Ga0209990_100263211 | 3300027816 | Freshwater Lake | QELAVIEKLLALNLVTQEQAMEMTDLTPNGSNGLE |
Ga0209253_107055281 | 3300027900 | Freshwater Lake Sediment | RFAVFDTFLKNDPLVELQVIEKLLTLGLVTPEQAMEMTDLTPNGSEGLS |
Ga0209079_101887561 | 3300027972 | Freshwater Sediment | DKTFLRTDPLAELAVIEKLLSLGLVTTEQAMEMTDLSPNGSNGMA |
Ga0315907_105300022 | 3300031758 | Freshwater | FLRTDPLQELAVIEKLLALNLVTQEQAMEMTDLTPNGSNGLE |
Ga0315904_108829072 | 3300031951 | Freshwater | NYLRTDPLAELAVIREMLDLQLITQEQAMAMTDLTPNGSEGMI |
Ga0315904_112506421 | 3300031951 | Freshwater | KELSIIRELLDLQLITQEQAMEMTDLTPNGSEGMQ |
Ga0315294_108886782 | 3300031952 | Sediment | DIDKNFLRTDPMQELAVIEKLLSLSLITQEQAMAMTDLTPNGNQGMI |
Ga0315901_108130091 | 3300031963 | Freshwater | LVELSIIREMLDLQLITQEQAMAMTDLTPNGSEGMQ |
Ga0315274_114640002 | 3300031999 | Sediment | TDPLQELAVIEKLLSLNLITQEQAMAMTDLTPNGSQGMI |
Ga0315903_107726932 | 3300032116 | Freshwater | FDTFLKSDPLVELQVIEKLLSLGLISTEQAMEMTDLTPNGSEGMS |
Ga0315903_109052012 | 3300032116 | Freshwater | MVELQVIEKLLTLGLITTEQAMEMTDLTPNGSEGMS |
Ga0315903_111520811 | 3300032116 | Freshwater | DPLAELAVIEKLLSLGLVTTEQTMEMTDLSPNGSNGME |
Ga0315268_101921491 | 3300032173 | Sediment | KQDPLVEIQVLEKLLSLGLITTEQAMAMTDLTPNGSEGL |
Ga0334982_0316219_550_660 | 3300033981 | Freshwater | MQELAVIEKLLALNLINQEQAMEMTDLTPNGSNGME |
Ga0334982_0500484_406_531 | 3300033981 | Freshwater | LRTDPLQELAVIEKLLTLELITQEQAMAMTDLTPNGSQGMQ |
Ga0334996_0428008_1_138 | 3300033994 | Freshwater | DKNYLRTDPLQELAVIRELLDLQLITQEQAMEMTDLTPNGSEGMI |
Ga0334979_0742228_2_112 | 3300033996 | Freshwater | LKELSIIRELLDLQLITQEQAMEMTDLTPNGSEGMQ |
Ga0334979_0763436_341_451 | 3300033996 | Freshwater | MDDLLVIEKMLALGLIDINQAMEMTDLTPNGNNGMS |
Ga0334995_0656981_464_574 | 3300034062 | Freshwater | MQELAVIEKLLQLELITQEQAMEMTDLTPNGSQGME |
Ga0335020_0334196_595_705 | 3300034082 | Freshwater | MQELAVIEKLLALNLVTQEQAMEMTDLTPNGSNGLE |
Ga0335012_0447006_457_567 | 3300034093 | Freshwater | MTELAVIEKLLSLGLITTEQAMEMTDLSPNGSEGIS |
Ga0335027_0650399_492_632 | 3300034101 | Freshwater | LDSNYLRTDPLKELSIIRELLDLQLITQEQAMEMTDLTPNGSEGMQ |
Ga0335029_0619506_462_602 | 3300034102 | Freshwater | IDKNFLRTDPLAELAVIEKLLALNLVTQEQAMEMTDLTPNGSNGLE |
Ga0335033_0125733_1337_1450 | 3300034117 | Freshwater | PLAELAVIEKLLSLGLVTTEQAMEMTDLSPNGSNGME |
Ga0335060_0559548_2_118 | 3300034122 | Freshwater | DPLVELSIIREMLDLQLITQEQAMAMTDLTPNGSEGMQ |
⦗Top⦘ |