Metagenome Family F073406

Basic Information
Family ID	F073406
Family Type	Metagenome
Number of Sequences	120
Average Sequence Length	41 residues
Representative Sequence	PVLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN
Number of Associated Samples	112
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	2.50 %
% of genes near scaffold ends (potentially truncated)	95.00 %
% of genes from short scaffolds (< 2000 bps)	90.83 %
Associated GOLD sequencing projects	108
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Bacteria (96.667 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.167 % of family members)
Environment Ontology (ENVO)	Unclassified (28.333 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (35.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 27.94% β-sheet: 0.00% Coil/Unstructured: 72.06%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF04392	ABC_sub_bind	15.00
PF01977	UbiD	13.33
PF07883	Cupin_2	7.50
PF13343	SBP_bac_6	7.50
PF02538	Hydantoinase_B	4.17
PF01547	SBP_bac_1	4.17
PF13416	SBP_bac_8	3.33
PF02201	SWIB	0.83
PF16277	DUF4926	0.83
PF01402	RHH_1	0.83
PF09084	NMT1	0.83
PF13379	NMT1_2	0.83
PF00528	BPD_transp_1	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	15.00
COG0043	3-polyprenyl-4-hydroxybenzoate decarboxylase	Coenzyme transport and metabolism [H]	13.33
COG0146	N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit	Amino acid transport and metabolism [E]	8.33
COG0715	ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.83
COG4521	ABC-type taurine transport system, periplasmic component	Inorganic ion transport and metabolism [P]	0.83
COG5531	DNA-binding SWIB/MDM2 domain	Chromatin structure and dynamics [B]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	96.67 %
Unclassified	root	N/A	3.33 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	96.67 %
Unclassified	root	N/A	3.33 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.67 %
Unclassified	root	N/A	3.33 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	67.50 %
Unclassified	root	N/A	3.33 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.83 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.83 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	64.17 %
Unclassified	root	N/A	3.33 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.83 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	64.17 %
Unclassified	root	N/A	3.33 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	64.17 %
Unclassified	root	N/A	3.33 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.83 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	64.17 %
Unclassified	root	N/A	3.33 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	0.83 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	64.17 %
Unclassified	root	N/A	3.33 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	0.83 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	64.17 %
Unclassified	root	N/A	3.33 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	0.83 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.83 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000559\|F14TC_100958756	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300000956\|JGI10216J12902_117704925	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1071	Open in IMG/M
3300003997\|Ga0055466_10256295	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	528	Open in IMG/M
3300004009\|Ga0055437_10150496	All Organisms → cellular organisms → Bacteria	721	Open in IMG/M
3300004013\|Ga0055465_10187734	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	673	Open in IMG/M
3300005093\|Ga0062594_103246699	All Organisms → cellular organisms → Bacteria	510	Open in IMG/M
3300005167\|Ga0066672_10523013	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	769	Open in IMG/M
3300005183\|Ga0068993_10096016	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	942	Open in IMG/M
3300005293\|Ga0065715_10026726	All Organisms → cellular organisms → Bacteria	2237	Open in IMG/M
3300005332\|Ga0066388_100172072	All Organisms → cellular organisms → Bacteria	2766	Open in IMG/M
3300005334\|Ga0068869_100743101	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	839	Open in IMG/M
3300005353\|Ga0070669_100027811	All Organisms → cellular organisms → Bacteria → Proteobacteria	4070	Open in IMG/M
3300005441\|Ga0070700_100962332	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	699	Open in IMG/M
3300005546\|Ga0070696_100208326	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1462	Open in IMG/M
3300005557\|Ga0066704_10318459	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1048	Open in IMG/M
3300005558\|Ga0066698_11059656	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	513	Open in IMG/M
3300005564\|Ga0070664_100641515	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	987	Open in IMG/M
3300005614\|Ga0068856_100646137	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1078	Open in IMG/M
3300005614\|Ga0068856_102556695	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	517	Open in IMG/M
3300005764\|Ga0066903_108691957	Not Available	516	Open in IMG/M
3300005829\|Ga0074479_11095935	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	595	Open in IMG/M
3300006058\|Ga0075432_10110469	All Organisms → cellular organisms → Bacteria	1024	Open in IMG/M
3300006755\|Ga0079222_10398365	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	957	Open in IMG/M
3300006797\|Ga0066659_11003847	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	697	Open in IMG/M
3300006844\|Ga0075428_102060800	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	590	Open in IMG/M
3300006854\|Ga0075425_101219422	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	855	Open in IMG/M
3300006969\|Ga0075419_10217016	All Organisms → cellular organisms → Bacteria	1270	Open in IMG/M
3300007004\|Ga0079218_11163021	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	795	Open in IMG/M
3300007076\|Ga0075435_101409010	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	611	Open in IMG/M
3300009012\|Ga0066710_104201049	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	538	Open in IMG/M
3300009053\|Ga0105095_10789407	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	531	Open in IMG/M
3300009094\|Ga0111539_10026297	All Organisms → cellular organisms → Bacteria → Proteobacteria	7117	Open in IMG/M
3300009094\|Ga0111539_10625703	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1253	Open in IMG/M
3300009098\|Ga0105245_11280418	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	782	Open in IMG/M
3300009101\|Ga0105247_11239764	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	596	Open in IMG/M
3300009137\|Ga0066709_101769839	All Organisms → cellular organisms → Bacteria	870	Open in IMG/M
3300009137\|Ga0066709_102585558	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	681	Open in IMG/M
3300009137\|Ga0066709_103315446	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	586	Open in IMG/M
3300009147\|Ga0114129_10295627	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2160	Open in IMG/M
3300009147\|Ga0114129_11229279	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	932	Open in IMG/M
3300009156\|Ga0111538_14126215	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	501	Open in IMG/M
3300009157\|Ga0105092_10652109	Not Available	610	Open in IMG/M
3300009167\|Ga0113563_12028070	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	688	Open in IMG/M
3300009553\|Ga0105249_10798299	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300009792\|Ga0126374_11888580	Not Available	502	Open in IMG/M
3300010043\|Ga0126380_11019734	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	699	Open in IMG/M
3300010046\|Ga0126384_11722922	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	593	Open in IMG/M
3300010047\|Ga0126382_10616480	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	896	Open in IMG/M
3300010047\|Ga0126382_12272450	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	523	Open in IMG/M
3300010304\|Ga0134088_10558205	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	567	Open in IMG/M
3300010358\|Ga0126370_11089434	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	735	Open in IMG/M
3300010362\|Ga0126377_10955679	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	922	Open in IMG/M
3300010398\|Ga0126383_10918270	All Organisms → cellular organisms → Bacteria	962	Open in IMG/M
3300010399\|Ga0134127_10683572	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1064	Open in IMG/M
3300010403\|Ga0134123_13184745	All Organisms → cellular organisms → Bacteria	528	Open in IMG/M
3300011442\|Ga0137437_1179476	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	734	Open in IMG/M
3300012200\|Ga0137382_10075736	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2169	Open in IMG/M
3300012205\|Ga0137362_10411964	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1170	Open in IMG/M
3300012355\|Ga0137369_10215535	All Organisms → cellular organisms → Bacteria	1474	Open in IMG/M
3300012358\|Ga0137368_10315580	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1051	Open in IMG/M
3300012474\|Ga0157356_1007812	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	673	Open in IMG/M
3300012506\|Ga0157324_1042875	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	561	Open in IMG/M
3300012582\|Ga0137358_10031357	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3487	Open in IMG/M
3300012899\|Ga0157299_10274487	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	546	Open in IMG/M
3300012922\|Ga0137394_10793295	All Organisms → cellular organisms → Bacteria	794	Open in IMG/M
3300012923\|Ga0137359_11675312	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	523	Open in IMG/M
3300012948\|Ga0126375_10367960	All Organisms → cellular organisms → Bacteria	1027	Open in IMG/M
3300012972\|Ga0134077_10380916	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300014154\|Ga0134075_10375373	All Organisms → cellular organisms → Bacteria	626	Open in IMG/M
3300014262\|Ga0075301_1022447	All Organisms → cellular organisms → Bacteria	1074	Open in IMG/M
3300014269\|Ga0075302_1063628	All Organisms → cellular organisms → Bacteria	768	Open in IMG/M
3300014271\|Ga0075326_1184611	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300014873\|Ga0180066_1092996	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300014884\|Ga0180104_1046758	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1152	Open in IMG/M
3300015258\|Ga0180093_1157864	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	576	Open in IMG/M
3300015259\|Ga0180085_1061091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1085	Open in IMG/M
3300015259\|Ga0180085_1141591	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	719	Open in IMG/M
3300015359\|Ga0134085_10584629	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	518	Open in IMG/M
3300015371\|Ga0132258_10106424	All Organisms → cellular organisms → Bacteria → Proteobacteria	6627	Open in IMG/M
3300015373\|Ga0132257_102344733	All Organisms → cellular organisms → Bacteria	692	Open in IMG/M
3300016294\|Ga0182041_10354444	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1234	Open in IMG/M
3300016404\|Ga0182037_10251203	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1399	Open in IMG/M
3300016422\|Ga0182039_11894411	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	547	Open in IMG/M
3300016445\|Ga0182038_10693113	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	886	Open in IMG/M
3300018000\|Ga0184604_10133557	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	804	Open in IMG/M
3300018052\|Ga0184638_1280857	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	566	Open in IMG/M
3300018064\|Ga0187773_10086886	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1516	Open in IMG/M
3300018074\|Ga0184640_10197231	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	908	Open in IMG/M
3300018075\|Ga0184632_10458919	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	527	Open in IMG/M
3300018078\|Ga0184612_10210159	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300018481\|Ga0190271_11111076	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	914	Open in IMG/M
3300021081\|Ga0210379_10418503	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	593	Open in IMG/M
3300022563\|Ga0212128_10378754	All Organisms → cellular organisms → Bacteria	878	Open in IMG/M
3300025315\|Ga0207697_10212685	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300025324\|Ga0209640_11179589	All Organisms → cellular organisms → Bacteria	577	Open in IMG/M
3300025910\|Ga0207684_11696309	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	509	Open in IMG/M
3300025932\|Ga0207690_11244968	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	622	Open in IMG/M
3300025937\|Ga0207669_10343022	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1151	Open in IMG/M
3300025937\|Ga0207669_11859078	All Organisms → cellular organisms → Bacteria	514	Open in IMG/M
3300025938\|Ga0207704_10150779	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1640	Open in IMG/M
3300025953\|Ga0210068_1076324	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	526	Open in IMG/M
3300025966\|Ga0210105_1043499	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	677	Open in IMG/M
3300026011\|Ga0208532_1009959	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	629	Open in IMG/M
3300026078\|Ga0207702_10611980	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1069	Open in IMG/M
3300026116\|Ga0207674_10787689	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	918	Open in IMG/M
3300027722\|Ga0209819_10248236	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	617	Open in IMG/M
3300027775\|Ga0209177_10003054	All Organisms → cellular organisms → Bacteria	3226	Open in IMG/M
3300027909\|Ga0209382_10118315	All Organisms → cellular organisms → Bacteria	3092	Open in IMG/M
3300028803\|Ga0307281_10199561	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	720	Open in IMG/M
3300028828\|Ga0307312_10147637	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1490	Open in IMG/M
3300031547\|Ga0310887_10767468	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	603	Open in IMG/M
3300031820\|Ga0307473_10248148	All Organisms → cellular organisms → Bacteria	1090	Open in IMG/M
3300031942\|Ga0310916_10715618	All Organisms → cellular organisms → Bacteria	847	Open in IMG/M
3300031946\|Ga0310910_11208973	All Organisms → cellular organisms → Bacteria	586	Open in IMG/M
3300031954\|Ga0306926_10204711	All Organisms → cellular organisms → Bacteria	2449	Open in IMG/M
3300032144\|Ga0315910_10530093	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	910	Open in IMG/M
3300032261\|Ga0306920_101706039	All Organisms → cellular organisms → Bacteria	892	Open in IMG/M
3300034148\|Ga0364927_0189266	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	603	Open in IMG/M
3300034150\|Ga0364933_053783	Not Available	998	Open in IMG/M
3300034354\|Ga0364943_0325385	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	585	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.00%
Host-Associated	Host-Associated	25.00%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.00%
Plants	Host-Associated → Plants	25.00%
Aquatic	Environmental → Aquatic	20.00%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.83%
Sediment	Environmental → Aquatic → Sediment	10.00%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.17%
Marine	Environmental → Aquatic → Marine	5.00%
Freshwater	Environmental → Aquatic → Freshwater	4.17%
Floodplain	Environmental → Terrestrial → Floodplain	2.50%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	10.00%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.67%
Loam	Environmental → Terrestrial → Soil → Loam	5.83%
Wetlands	Environmental → Aquatic → Marine → Wetlands	5.00%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.17%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.17%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.33%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.50%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.83%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	23.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.67%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	10.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	7.50%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.67%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	5.00%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.17%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.17%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.33%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.33%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	2.50%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	2.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.50%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	0.83%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.83%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	9.17%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	7.50%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.83%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	5.00%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	5.00%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	5.00%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.17%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.33%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.33%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	2.50%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.50%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.50%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.50%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	2.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.67%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.67%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.67%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.67%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.67%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.67%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.83%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.83%
Thermal Springs	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs	0.83%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.83%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.83%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.83%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.83%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.83%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000559	Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003997	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1	Environmental	Open in IMG/M
3300004009	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2	Environmental	Open in IMG/M
3300004013	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009167	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011442	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012474	Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610	Environmental	Open in IMG/M
3300012506	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610	Host-Associated	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012899	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014154	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015	Environmental	Open in IMG/M
3300014262	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1	Environmental	Open in IMG/M
3300014269	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1	Environmental	Open in IMG/M
3300014271	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2	Environmental	Open in IMG/M
3300014873	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300015258	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da	Environmental	Open in IMG/M
3300015259	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D	Environmental	Open in IMG/M
3300015359	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300016422	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111	Environmental	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018064	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018078	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300022563	OV2_combined assembly	Environmental	Open in IMG/M
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025953	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300025966	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026011	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300027722	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300031547	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4	Environmental	Open in IMG/M
3300031820	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300034148	Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17	Environmental	Open in IMG/M
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental	Open in IMG/M
3300034354	Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F073406

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F14TC_1009587562	3300000559	Soil	NRRLEGIKYLDTGKPEWIEMKPIIEVVNDALKAAGKN*
JGI10216J12902_1177049251	3300000956	Soil	LNRRLEGIKYLDTGKPEWIEMKPVIDVINDVLKAAGKS*
Ga0055466_102562951	3300003997	Natural And Restored Wetlands	DDVPFNSRRVEGVNYIDTSKPGWQNMKPVLQIMNEALKAAGKS*
Ga0055437_101504962	3300004009	Natural And Restored Wetlands	KEEVPLLGRRLDGIKYLDTGKPEWIEMKPIIDVVNEALKGAEKN*
Ga0055465_101877342	3300004013	Natural And Restored Wetlands	PFHARRVDGVNYIDTSKPEWQAMKPVLDIMNEALKGGGKS*
Ga0062594_1032466991	3300005093	Soil	EVPFQSRRLNGIKYLDTGRPEWIEMKPILDVVNEALKAAGKN*
Ga0066672_105230131	3300005167	Soil	KDDVPYLNRRLDGIKYLDTGKPEWIEMKPILDVVNEALKSARKN*
Ga0068993_100960162	3300005183	Natural And Restored Wetlands	MLGRRLDGIKYLDTGKPEWIEMKPIIDVVNEALRAAGKS*
Ga0065715_100267263	3300005293	Miscanthus Rhizosphere	FQSRRLDGVRYLDTGRPEWIEMKPILDLVNEALKAAGKN*
Ga0066388_1001720724	3300005332	Tropical Forest Soil	KDDVPYLNRRLDGIKYLDTGKPEWIEMKPIIEVVNEALKAAGN*
Ga0068869_1007431012	3300005334	Miscanthus Rhizosphere	VLNRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0070669_1000278114	3300005353	Switchgrass Rhizosphere	IPKDDVPVLQRRFDNVKYLDTSRPEWQDMKPILDVMNEALKAAGKQ*
Ga0070700_1009623322	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	VLQRRFDNVKYLDTSRPEWQDMKPILDVMNEALKAAGKQ*
Ga0070696_1002083261	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	PVLQRRFDNVKYLDTSRPEWQDMKPILDVMNEALKAAGKQ*
Ga0066704_103184592	3300005557	Soil	VPVLQRRFDGIKYLDTSRPEWQEMKPILDVMTEALKAAGKS*
Ga0066698_110596561	3300005558	Soil	RRLDGIKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0070664_1006415151	3300005564	Corn Rhizosphere	KDDVPVLQRRFDNVKYLDTSRPEWQDMKPILDVMNDALKSAGKN*
Ga0068856_1006461373	3300005614	Corn Rhizosphere	PMLVRRVEGVKYLDASNPEWLDMKPILKVMNEALKSPEKR*
Ga0068856_1025566952	3300005614	Corn Rhizosphere	IPKDDVPVLQRRFDNVKYLDTSRPEWQDMKPILDVMNDALKSAGKN*
Ga0066903_1086919572	3300005764	Tropical Forest Soil	DDVPYLNRRLDGIKYLDTGKPEWIEMKPIIEVVNEALKAARN*
Ga0074479_110959351	3300005829	Sediment (Intertidal)	DIPKDEVPILQRRFEGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0075432_101104692	3300006058	Populus Rhizosphere	PYLNRRLEGIKYLDTGKPEWIEMKPIIEVVNDALKAAGKN*
Ga0079222_103983653	3300006755	Agricultural Soil	LQRRFDNVKYLDTSRPEWQNMKPILEVMNEALKSAGKQ*
Ga0066659_110038472	3300006797	Soil	LQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0075428_1020608001	3300006844	Populus Rhizosphere	VPFEQRRLPDIKYLDTGKPEWIDMKPVLDVVNEALKAKGN*
Ga0075425_1012194221	3300006854	Populus Rhizosphere	PFEQRRLPDIKYLDTGKPEWMDMKPVLDVVNEALKAKGN*
Ga0075419_102170163	3300006969	Populus Rhizosphere	DVPYLNRRLEGIKYLDTGKPEWIEMKPIIEVVNDALKAAGKN*
Ga0079218_111630211	3300007004	Agricultural Soil	LNRRFDGVKYLDTSRPEWQEMKPVHDVMNEALKAAGKS*
Ga0075435_1014090102	3300007076	Populus Rhizosphere	RFDNVKYLDTSRPEWQDMKPILEVMNEALKAAGKQ*
Ga0066710_1042010491	3300009012	Grasslands Soil	RLDGIKYLDTSRPEWQEMKPILDVMNEALKAAGKS
Ga0105095_107894071	3300009053	Freshwater Sediment	IPKDDVPFLSRRIDGVNYIDTSKPGWQDMKPVLQIMNEALKAAGKS*
Ga0111539_100262971	3300009094	Populus Rhizosphere	IPKDEVPFEQRRLPDIKYLDTGKPEWIDMKPVLDVVNEALKTAGKN*
Ga0111539_106257031	3300009094	Populus Rhizosphere	VLQRRFDGVKYLDTSRPEWQDMKPILDVMNEALKAAGKN*
Ga0105245_112804181	3300009098	Miscanthus Rhizosphere	VPVLQRRFDNVKYLDTSRPEWQDMKPILDVMNEALRAAGKQ*
Ga0105247_112397642	3300009101	Switchgrass Rhizosphere	QSRRLDGIKYLDTGRPEWIEMKPILDVVNEALKAAGKN*
Ga0066709_1017698391	3300009137	Grasslands Soil	PYLNRRLDGIKYLDTGKPEWIEMKPILDVVNEALKSAGKN*
Ga0066709_1025855582	3300009137	Grasslands Soil	PKDEVPVLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKS*
Ga0066709_1033154461	3300009137	Grasslands Soil	DVPYLNRRLDGIKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0114129_102956273	3300009147	Populus Rhizosphere	PFEQRRLPDIKYLDTGKPEWIDMKPVLDVVNEALKAKGN*
Ga0114129_112292791	3300009147	Populus Rhizosphere	LQRRFDNVKYLDTSRPEWQDMRPIIDVMNEALKAAGKN*
Ga0111538_141262152	3300009156	Populus Rhizosphere	RFDGVKYLDTSRPEWQEMRPILDVINEALKAAGKN*
Ga0105092_106521093	3300009157	Freshwater Sediment	YLNRRLDNIKYLDTGKPEWIEMKPIIEVVNEALKAAGKN*
Ga0113563_120280701	3300009167	Freshwater Wetlands	AKEEVPYDNRRLEGIKYLDTGKPEWIEMKPIIDVVNEALKAAGKS*
Ga0105249_107982991	3300009553	Switchgrass Rhizosphere	VPLLGRRLDGIKYLDTGKPEWIEMKPIIDVVNDSLKDAGKK*
Ga0126374_118885801	3300009792	Tropical Forest Soil	PKEDVPYMNRRLDGIKYLDTGKPEWIEMKPIIEVVSEALNAAGKH*
Ga0126380_110197341	3300010043	Tropical Forest Soil	VPYLNRRLDGIKYLDTGKPEWIEMKPIIEVVNEALKAAGKN*
Ga0126384_117229222	3300010046	Tropical Forest Soil	RRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKS*
Ga0126382_106164802	3300010047	Tropical Forest Soil	PVLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKS*
Ga0126382_122724501	3300010047	Tropical Forest Soil	VLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKS*
Ga0134088_105582052	3300010304	Grasslands Soil	NRRLDGIKYLDTSRPEWQEMKPILDVMNEALKAAGKS*
Ga0126370_110894341	3300010358	Tropical Forest Soil	QRRFDGVKYLDTSRPEWQEMKPILDVMNEALRAAGKS*
Ga0126377_109556791	3300010362	Tropical Forest Soil	RRFDGVKYLDTSRPEWQEMKPILDVMNEALKAARKS*
Ga0126383_109182702	3300010398	Tropical Forest Soil	PYLNRRLEGVKYLDTGNPEWIEMKPIIDVVNEALKAAGKN*
Ga0134127_106835722	3300010399	Terrestrial Soil	NRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0134123_131847451	3300010403	Terrestrial Soil	RLPDIKYLDTGKPEWIDMKPVLDVVNEALKAAGKN*
Ga0137437_11794761	3300011442	Soil	LNRRFEGVKYLDTSRPEWQEMKPILEVMNEALKAAGKN*
Ga0137382_100757361	3300012200	Vadose Zone Soil	PFEQRRLPDIKYLDTGKPEWIDMKPVLDVVNEALKAAGKN*
Ga0137362_104119642	3300012205	Vadose Zone Soil	VPYLNRRLARIKYVDTGKPEWIEMAPIINVVNDALKAAGKN*
Ga0137369_102155354	3300012355	Vadose Zone Soil	EVPFEQRRLPDIKYLDTGKPEWIDMKPVLDVVNEALKAAGKN*
Ga0137368_103155802	3300012358	Vadose Zone Soil	PVLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN*
Ga0157356_10078122	3300012474	Unplanted Soil	EVPVLQRRFDGVKYLDTSRPEWQDMKPILDVMNEALKAAGKN*
Ga0157324_10428752	3300012506	Arabidopsis Rhizosphere	QRRFDNVKYLDTSRPEWQNMKPILDVMNDALKSAGKN*
Ga0137358_100313571	3300012582	Vadose Zone Soil	KDDVPVLQRRFDGIKYLDTSRPEWQEMKPILDVMTEALKAAGKS*
Ga0157299_102744871	3300012899	Soil	KDDVPMLVRRVEGVKYLDASNPEWLDMKPILKVMNEALKSPEKR*
Ga0137394_107932951	3300012922	Vadose Zone Soil	KDDVPYLNRRLEGIKYLDTGKPEWIEMKPIIEIVNDALKAARKN*
Ga0137359_116753122	3300012923	Vadose Zone Soil	VPVLQRRFDGVKYLDTSRPEWQEMRPILDVINEALKAAGKN*
Ga0126375_103679601	3300012948	Tropical Forest Soil	VPYLNRRLDGIKYLDTGKPEWIEMKPIIEVVNEALKAAGN*
Ga0134077_103809162	3300012972	Grasslands Soil	RRLEGIKYLDTGKPEWIEMKPIIEVVNDALKAAGKN*
Ga0134075_103753731	3300014154	Grasslands Soil	DVPLLNRRLEGIKYLDTGRPEWIEMKPILDVVNEALKAAGKN*
Ga0075301_10224471	3300014262	Natural And Restored Wetlands	IPKDEVPMLGRRLDGIKYLDTGKPEWIEMKPIIDVVNEALRAAGKS*
Ga0075302_10636281	3300014269	Natural And Restored Wetlands	DVPYDSRRLEGIKYLDTGKPEWIEMKPIIDVVNEALRAAGKS*
Ga0075326_11846111	3300014271	Natural And Restored Wetlands	LILISHQGLDGIKYLDTGRPEWIQMKPILDVVNEALKAAGKN*
Ga0180066_10929962	3300014873	Soil	TDIPKDEVPLLGRRLDGIKYLDTGKPEWVGMKPILDVVNEALKAAGKS*
Ga0180104_10467581	3300014884	Soil	VPLLGRRLDGIKYLDTGNPERIEMKPVLDVVNEALKVAGKN*
Ga0180093_11578642	3300015258	Soil	RRVDGIKYLDTSKPEWQDMKPVLDIMNEALKAAGKS*
Ga0180085_10610912	3300015259	Soil	ADIPKDEVPLLGRRLDGIKYLDTGNPERIEMKPVLDVVNEALKVAGKN*
Ga0180085_11415911	3300015259	Soil	ILSRRIDGLKYLDTSKPEWQEMKPILDVMNEALKAAGKN*
Ga0134085_105846291	3300015359	Grasslands Soil	PKDDVPVLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKS*
Ga0132258_101064242	3300015371	Arabidopsis Rhizosphere	VPYLNRRLDGAKYLDTSLPEWQEMKPIIDVMNEALKSAGKN*
Ga0132257_1023447331	3300015373	Arabidopsis Rhizosphere	DIPKDEVPFEQRRLPDIKYLDTGKPEWMDMKPVLDVVNEALKAAGKN*
Ga0182041_103544442	3300016294	Soil	LLQRRFDNVKYLDTSRPEWQDMKPILDVMNEALKGAGKS
Ga0182037_102512032	3300016404	Soil	PLLQRRFDNVKYLDPSRPEWQDMKPILDVMNEALKGAGKS
Ga0182039_118944111	3300016422	Soil	LRTDIPKEDVPYLNRRLEGIKYLDTGKPEWIEMKPIIDVVNEALKAAGRN
Ga0182038_106931131	3300016445	Soil	QRRFDGIKYLDTSRPEWQEMKPILDVMTEALKAAGKS
Ga0184604_101335571	3300018000	Groundwater Sediment	PKDEVPVLQRRFDGVKYLDTSRPEWQDMKPILDVMNEALKAAGKN
Ga0184638_12808571	3300018052	Groundwater Sediment	PFEQRRLPDIKYLDTGKPEWMDMKPVLDVVNEALKAAGKN
Ga0187773_100868861	3300018064	Tropical Peatland	QRRFDNVKYLDTSRPEWQEMKPILDVMNEALKAAGKN
Ga0184640_101972312	3300018074	Groundwater Sediment	LQRRFEGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN
Ga0184632_104589191	3300018075	Groundwater Sediment	PYLNRRLDDVKYLDTSLPEWQEMKPILDVMNEALKAAGKN
Ga0184612_102101593	3300018078	Groundwater Sediment	DNVPYLNRRLDGIKYLDTGKPEWIEMKPILSVVNDALKETGKN
Ga0190271_111110761	3300018481	Soil	AKEEVPYDNRRLEGIKYLDTGKPEWIEMKPIIDVVNEALKSAGKN
Ga0210379_104185032	3300021081	Groundwater Sediment	LPILSRRVDGVKYLDTSKPEWQEMKPILDAMNEALKAAGKN
Ga0212128_103787543	3300022563	Thermal Springs	KDDVPLLNRRLDGIKYLDTGKPEWIEMKPILDVVNEALKAAGKN
Ga0207697_102126852	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	SRRLDGIKYLDTGRPEWIEMKPILDVVNEALKAAGKN
Ga0209640_111795893	3300025324	Soil	RIEGVKYLDTSRPEWQDMKPILQVMNEALKQAGKQ
Ga0207684_116963091	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	DVPVLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKN
Ga0207690_112449682	3300025932	Corn Rhizosphere	PLQSRRLDGIKYLDTGRPEWIEMKPILDVVNEALKAAGKN
Ga0207669_103430222	3300025937	Miscanthus Rhizosphere	RLDGVRYLDTGRPEWIEMKRILDVVNEALKAARKN
Ga0207669_118590783	3300025937	Miscanthus Rhizosphere	DVPMLVRRVEGVKYLDASNPEWLDMKPILKVMNEALKSPEKR
Ga0207704_101507791	3300025938	Miscanthus Rhizosphere	RLDGVRYLDTGRPEWIEMKPILDVVNEALKAARKN
Ga0210068_10763241	3300025953	Natural And Restored Wetlands	KDDVPEINRRLDGIKYLDTGRPEWIQMKPILDVVNEALKAAGKN
Ga0210105_10434992	3300025966	Natural And Restored Wetlands	ISRRIDGVNYIDTSKPGWQDMKPVLQIMNEALKAAGKS
Ga0208532_10099592	3300026011	Rice Paddy Soil	VPFNSRRVEGVNYIDTSKPGWQNMKPVLQIMNEALKAAGKS
Ga0207702_106119801	3300026078	Corn Rhizosphere	VWAQDDVPMLVRRVEGVKYLDASNPEWLDMKPILKVMNEALKSPEKR
Ga0207674_107876892	3300026116	Corn Rhizosphere	YVQDDVPMLVRRVEGVKYLDASNPEWLDMKPILKVMNEALKSPEKR
Ga0209819_102482361	3300027722	Freshwater Sediment	VPYLNRRLEGIKYLDTGKPEWIEMKPIIEVVNEALKAAEKN
Ga0209177_100030541	3300027775	Agricultural Soil	PMLVRRVEGVKYLDASNPEWLDMKPILKVMNEAQKSTEKR
Ga0209382_101183154	3300027909	Populus Rhizosphere	SKDEVPFEQRRLPDIKYLDTGKPEWIDMKPVLDVVNEALKTAGKN
Ga0307281_101995611	3300028803	Soil	DIPVLNRRFEGVKYLDTSRPEWQEMKPILEVMNEALKAAGKN
Ga0307312_101476373	3300028828	Soil	RFDGVKYLDTSRPEWQDMKPILDVMNEALKAAGKN
Ga0310887_107674681	3300031547	Soil	SLRTDIPKEEVPYLNRRLEGIKYLDTGKPEWIEMKPIIDVVNDALKSAGKN
Ga0307473_102481482	3300031820	Hardwood Forest Soil	NRRLDGIKYLDTGKPEWIEMKPIIDVVNEALKSAGKN
Ga0310916_107156182	3300031942	Soil	IPKEDVPYLNRRLEGIKYLDTGKPEWIEMKSIIDVVNEALKAAGKN
Ga0310910_112089732	3300031946	Soil	YSSRRLDGIKYLDTGRPEWIEMKPILEVVNEALKAARKN
Ga0306926_102047111	3300031954	Soil	VSYSSRRLDGIKYLDTGRPEWIEMKPILEVVNEALKAARKN
Ga0315910_105300932	3300032144	Soil	LSRRVDGVKYIDTSKPGWQDMKPILQIMNEALKAAGKS
Ga0306920_1017060392	3300032261	Soil	LNRRLEGIKYLDTGKPEWIEMKPIIDVVNEALKAAGRN
Ga0364927_0189266_456_602	3300034148	Sediment	IDIPKDEIPRLQRRFDGVKYLDTSRPEWQEMKPILDVMNEALKAAGKS
Ga0364933_053783_891_998	3300034150	Sediment	RLDGIKYLDTGKPEWIEMKPIVEVVNEALKSAGKY
Ga0364943_0325385_466_585	3300034354	Sediment	YDNRRLEGIKYLDTGKPEWIEMKPIIDIVNEALKAAGKN

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign