NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072783

Metagenome / Metatranscriptome Family F072783

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072783
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 39 residues
Representative Sequence TSREAHTEHTNTPHFLRWNARKDALLASREATFWKQIA
Number of Associated Samples 108
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 89.26 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.174 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(23.967 % of family members)
Environment Ontology (ENVO) Unclassified
(28.926 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.107 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.52%    β-sheet: 0.00%    Coil/Unstructured: 48.48%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF13673Acetyltransf_10 14.88
PF13519VWA_2 6.61
PF03641Lysine_decarbox 4.96
PF00881Nitroreductase 4.13
PF00092VWA 4.13
PF12840HTH_20 3.31
PF04250DUF429 1.65
PF01512Complex1_51K 0.83
PF13180PDZ_2 0.83
PF07715Plug 0.83
PF02371Transposase_20 0.83
PF01547SBP_bac_1 0.83
PF12867DinB_2 0.83
PF06537DHOR 0.83
PF13508Acetyltransf_7 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 4.96
COG2410Predicted nuclease (RNAse H fold)General function prediction only [R] 1.65
COG1894NADH:ubiquinone oxidoreductase, NADH-binding 51 kD subunit (chain F)Energy production and conversion [C] 0.83
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.83
COG3547TransposaseMobilome: prophages, transposons [X] 0.83
COG4656Na+-translocating ferredoxin:NAD+ oxidoreductase RNF, RnfC subunitEnergy production and conversion [C] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.17 %
UnclassifiedrootN/A0.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04XLUVQAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300001431|F14TB_102670138All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300005175|Ga0066673_10348464All Organisms → cellular organisms → Bacteria → Acidobacteria864Open in IMG/M
3300005180|Ga0066685_10358103All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300005181|Ga0066678_10116113All Organisms → cellular organisms → Bacteria → Acidobacteria1638Open in IMG/M
3300005445|Ga0070708_100423852All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300005542|Ga0070732_10983663All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300005568|Ga0066703_10207373All Organisms → cellular organisms → Bacteria → Acidobacteria1190Open in IMG/M
3300005569|Ga0066705_10025018All Organisms → cellular organisms → Bacteria3141Open in IMG/M
3300005602|Ga0070762_10109868All Organisms → cellular organisms → Bacteria → Acidobacteria1607Open in IMG/M
3300005602|Ga0070762_10311882All Organisms → cellular organisms → Bacteria → Acidobacteria994Open in IMG/M
3300005610|Ga0070763_10510097All Organisms → cellular organisms → Bacteria → Acidobacteria689Open in IMG/M
3300005764|Ga0066903_105333683All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300006050|Ga0075028_100273469All Organisms → cellular organisms → Bacteria → Acidobacteria934Open in IMG/M
3300006059|Ga0075017_101261786All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300006163|Ga0070715_10571657All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300006174|Ga0075014_100393144All Organisms → cellular organisms → Bacteria754Open in IMG/M
3300006237|Ga0097621_100211695All Organisms → cellular organisms → Bacteria → Acidobacteria1686Open in IMG/M
3300006354|Ga0075021_10821575All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300006755|Ga0079222_11065331All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300006806|Ga0079220_10850190All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300006914|Ga0075436_100033889All Organisms → cellular organisms → Bacteria3519Open in IMG/M
3300006914|Ga0075436_100060788All Organisms → cellular organisms → Bacteria2610Open in IMG/M
3300007258|Ga0099793_10287113All Organisms → cellular organisms → Bacteria → Acidobacteria798Open in IMG/M
3300009089|Ga0099828_10139106All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2137Open in IMG/M
3300009090|Ga0099827_11462513All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009137|Ga0066709_101374044All Organisms → cellular organisms → Bacteria → Acidobacteria1029Open in IMG/M
3300009519|Ga0116108_1191730All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300009614|Ga0116104_1005970All Organisms → cellular organisms → Bacteria → Acidobacteria4443Open in IMG/M
3300010048|Ga0126373_12575365All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010326|Ga0134065_10181142All Organisms → cellular organisms → Bacteria → Acidobacteria753Open in IMG/M
3300010336|Ga0134071_10698860All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300010339|Ga0074046_10364765All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300010343|Ga0074044_10178112All Organisms → cellular organisms → Bacteria → Acidobacteria1417Open in IMG/M
3300010358|Ga0126370_10615503All Organisms → cellular organisms → Bacteria → Acidobacteria940Open in IMG/M
3300010361|Ga0126378_11474585All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300011269|Ga0137392_10828998All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300011269|Ga0137392_11121340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300012189|Ga0137388_10098170All Organisms → cellular organisms → Bacteria2510Open in IMG/M
3300012202|Ga0137363_10666342All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300012203|Ga0137399_11386781All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012205|Ga0137362_11515174All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300012209|Ga0137379_10685727All Organisms → cellular organisms → Bacteria → Acidobacteria930Open in IMG/M
3300012361|Ga0137360_10654982All Organisms → cellular organisms → Bacteria → Acidobacteria901Open in IMG/M
3300012363|Ga0137390_11590006All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300012582|Ga0137358_10791502All Organisms → cellular organisms → Bacteria → Acidobacteria630Open in IMG/M
3300012917|Ga0137395_10024731All Organisms → cellular organisms → Bacteria → Acidobacteria3549Open in IMG/M
3300012923|Ga0137359_11252096All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300012927|Ga0137416_10335971All Organisms → cellular organisms → Bacteria → Acidobacteria1262Open in IMG/M
3300012927|Ga0137416_11596565All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300012929|Ga0137404_10565597All Organisms → cellular organisms → Bacteria → Acidobacteria1020Open in IMG/M
3300012929|Ga0137404_11197645All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium698Open in IMG/M
3300012931|Ga0153915_12115063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300012944|Ga0137410_10158595All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1729Open in IMG/M
3300012971|Ga0126369_11598282All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300014150|Ga0134081_10034691All Organisms → cellular organisms → Bacteria → Acidobacteria1472Open in IMG/M
3300014638|Ga0181536_10421450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300015052|Ga0137411_1098072All Organisms → cellular organisms → Bacteria1953Open in IMG/M
3300015242|Ga0137412_10254100All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300015264|Ga0137403_11319151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300016404|Ga0182037_10371547All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300017822|Ga0187802_10265808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300018012|Ga0187810_10203101All Organisms → cellular organisms → Bacteria → Acidobacteria806Open in IMG/M
3300020022|Ga0193733_1078073All Organisms → cellular organisms → Bacteria → Acidobacteria929Open in IMG/M
3300020579|Ga0210407_10643340All Organisms → cellular organisms → Bacteria → Acidobacteria825Open in IMG/M
3300020579|Ga0210407_10848656All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300020583|Ga0210401_10987344All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium701Open in IMG/M
3300021086|Ga0179596_10113815All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300021088|Ga0210404_10004872All Organisms → cellular organisms → Bacteria5398Open in IMG/M
3300021088|Ga0210404_10073414All Organisms → cellular organisms → Bacteria → Acidobacteria1668Open in IMG/M
3300021168|Ga0210406_10505594All Organisms → cellular organisms → Bacteria → Acidobacteria955Open in IMG/M
3300021168|Ga0210406_10559971All Organisms → cellular organisms → Bacteria → Acidobacteria897Open in IMG/M
3300021180|Ga0210396_10186004All Organisms → cellular organisms → Bacteria → Acidobacteria1859Open in IMG/M
3300021403|Ga0210397_10362179All Organisms → cellular organisms → Bacteria → Acidobacteria1077Open in IMG/M
3300021405|Ga0210387_10865280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium796Open in IMG/M
3300021432|Ga0210384_11511306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300021475|Ga0210392_10426718All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300021476|Ga0187846_10482269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300021479|Ga0210410_11602518All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300021559|Ga0210409_10204399All Organisms → cellular organisms → Bacteria1798Open in IMG/M
3300021559|Ga0210409_11418285All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300022533|Ga0242662_10052970All Organisms → cellular organisms → Bacteria → Acidobacteria1054Open in IMG/M
3300022726|Ga0242654_10193966All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300026295|Ga0209234_1022200All Organisms → cellular organisms → Bacteria → Acidobacteria2402Open in IMG/M
3300026309|Ga0209055_1147035All Organisms → cellular organisms → Bacteria → Acidobacteria823Open in IMG/M
3300026313|Ga0209761_1221686All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300026515|Ga0257158_1033907All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300026529|Ga0209806_1282935All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300026548|Ga0209161_10305037All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300026557|Ga0179587_10752817All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300027548|Ga0209523_1119496All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300027562|Ga0209735_1075336All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300027562|Ga0209735_1083723All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium693Open in IMG/M
3300027729|Ga0209248_10057225All Organisms → cellular organisms → Bacteria → Acidobacteria1192Open in IMG/M
3300027737|Ga0209038_10267205All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300027846|Ga0209180_10377585All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300027846|Ga0209180_10585190All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300027862|Ga0209701_10141033All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes1478Open in IMG/M
3300028047|Ga0209526_10207955Not Available1353Open in IMG/M
3300028381|Ga0268264_11831106All Organisms → cellular organisms → Bacteria → Acidobacteria617Open in IMG/M
3300028536|Ga0137415_10085375All Organisms → cellular organisms → Bacteria → Acidobacteria3014Open in IMG/M
3300028906|Ga0308309_10447725All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1112Open in IMG/M
3300031122|Ga0170822_12675789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium740Open in IMG/M
3300031231|Ga0170824_117911943All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium909Open in IMG/M
3300031474|Ga0170818_109847839All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300031668|Ga0318542_10131019All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1234Open in IMG/M
3300031720|Ga0307469_11067434All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300031744|Ga0306918_10889207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300031793|Ga0318548_10375650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300031942|Ga0310916_11039340All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031945|Ga0310913_11291049All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300031947|Ga0310909_10044627All Organisms → cellular organisms → Bacteria → Acidobacteria3372Open in IMG/M
3300031962|Ga0307479_11000283All Organisms → cellular organisms → Bacteria → Acidobacteria805Open in IMG/M
3300032035|Ga0310911_10137374All Organisms → cellular organisms → Bacteria → Acidobacteria1368Open in IMG/M
3300032035|Ga0310911_10229338All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1061Open in IMG/M
3300032205|Ga0307472_100031729All Organisms → cellular organisms → Bacteria3074Open in IMG/M
3300032261|Ga0306920_101175276All Organisms → cellular organisms → Bacteria → Acidobacteria1109Open in IMG/M
3300032783|Ga0335079_10142265All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2696Open in IMG/M
3300032783|Ga0335079_11646140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300032893|Ga0335069_12251885All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300033289|Ga0310914_11566585All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil23.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.31%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.31%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.31%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.48%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.65%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.65%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.83%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.83%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.83%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300020022Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027562Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_021889202070309004Green-Waste CompostRDAHTEHSHTPHFLRWNARKDALLASRDGTFWKQVV
F14TB_10267013813300001431SoilWETREHHTAHTKTDHFLRWNARKDALISSREVGFWKQIA*
Ga0066673_1034846423300005175SoilVWASREAHTEHTQTRHFLRWNARKDSLLASREANFWKQIV*
Ga0066685_1035810313300005180SoilEVWATRDAHTEHMHTPHFLRWNAGKDALLASRDGTFWQQIA*
Ga0066678_1011611313300005181SoilWASRAAHTEHMHTSHFLRWDARKDALLTSRDGTFWRQIA*
Ga0070708_10042385223300005445Corn, Switchgrass And Miscanthus RhizosphereWESRAHHTAHTKTDHFTRWNARKDSLLASRDVGFWKQIA*
Ga0070732_1098366313300005542Surface SoilDHTRHTNTPHFLRWNALKDALLASREVGFWKQVV*
Ga0066703_1020737323300005568SoilREAHTEHTHTPHFLRWNARKDALLASREANFWTQVA*
Ga0066705_1002501813300005569SoilEAHTEHTQTRHFLRWNARKDALLASREANFWKQIV*
Ga0070762_1010986823300005602SoilLHEVWASRQYHQAHYQTPHFLRWNARKDSLIASRDASFWQQMDH*
Ga0070762_1031188213300005602SoilWATREAHSKHTNTPHFLRWNARKDALLTSREVTYWKQVL*
Ga0070763_1051009713300005610SoilWASREAHSRHTNTPHFLRWNARKDSLLASRDVTYWKQVV*
Ga0066903_10533368323300005764Tropical Forest SoilEAHNKHRNLPHFLRYNARKDALLLSREATFWKQIL*
Ga0075028_10027346923300006050WatershedsGALLLHEVWVTREAHAEHTRLPHFLRWNARKDALLATREANFWKQVV*
Ga0075017_10126178623300006059WatershedsFLLHEVWGAREDHTAHTRTPHFLRWNARKDALLASREAAFWHQLA*
Ga0070715_1057165713300006163Corn, Switchgrass And Miscanthus RhizosphereWASREHHRAHTQTPHFIRWNARQDALLASRDATFWKQVL*
Ga0075014_10039314423300006174WatershedsMLHEVWATREAHAEHTRLPHFLRWNARKDALLASREANFWKQVV*
Ga0097621_10021169513300006237Miscanthus RhizosphereEIWQSRAHHAAHTKTDHFTRWNARKDSLLASREVGFWKQIA*
Ga0075021_1082157523300006354WatershedsVWATREAHAEHTRLPHFLRWNARKDALLATREANFWKQVV*
Ga0079222_1106533123300006755Agricultural SoilEVWASREHHTAHMKTRHFLRWDARKDALLASRDATFWTRLA*
Ga0079220_1085019023300006806Agricultural SoilSREDHTRHTNTPHFLRWNARKDALLASLERGFWKQVL*
Ga0075436_10003388913300006914Populus RhizosphereAHTEHMHTPHFLRWNARKDALLTSRDGTFWQQIA*
Ga0075436_10006078813300006914Populus RhizosphereHEVWTSREAHTEHTHTPHFLRWNARKDALLASREGTFWKQVA*
Ga0099793_1028711323300007258Vadose Zone SoilREAHTEHTHSPHFLRWNARKDALLAARDATFWKHIA*
Ga0099828_1013910633300009089Vadose Zone SoilDAHTDHMHTPHFLRWNAGKDALITSRDGTFWKQIA*
Ga0099827_1146251323300009090Vadose Zone SoilASREHHARHRQTPHFMRWNARKDALLASRDASFWKLVV*
Ga0066709_10137404413300009137Grasslands SoilTSREAHTEHTHTPHFLRWNARKDALLASRDGTFWTQVA*
Ga0116108_119173013300009519PeatlandTDLTCQFFLHEVCETREHHTAHTRTPHFLRWNARKDSLLAAREATFWQQIA*
Ga0116104_100597063300009614PeatlandVWESREHHTAHTRTSHFLRWNAREDALLAAREATFWQQIA*
Ga0126373_1257536523300010048Tropical Forest SoilWASREHHAAHTRTPHFLRWNAREDALLASRDSAFWQQIV*
Ga0134065_1018114223300010326Grasslands SoilASRDAHTEHMHTPHFLRWNAGKDALLASRDGTFWKQIA*
Ga0134071_1069886013300010336Grasslands SoilREHHTKHTKTPHFLRWDARKDALLASREAAFWKQIA*
Ga0074046_1036476513300010339Bog Forest SoilTREHHTAHTRTPHFLRWNARKDALLAAREVTFWQQIA*
Ga0074044_1017811223300010343Bog Forest SoilREHHAAHTRTQHFLRWNARKDSLLASKESAFWQQIS*
Ga0126370_1061550323300010358Tropical Forest SoilLLHEVWASRAAHTEHMHTLHFLRWNARKDALLTARDGTFWTQIA*
Ga0126378_1147458513300010361Tropical Forest SoilAAHTEHMHTPHFLRWNAGKDALLASRDGTFWHQIA*
Ga0137392_1082899823300011269Vadose Zone SoilAFLLHEVWASRDAHTEHMHTAHYLRWNARKDALLVSREVTFWKQVM*
Ga0137392_1112134013300011269Vadose Zone SoilVWASRDAHTEHMHTPHFLRWNAGKDALLTSRDGTFWKQIA*
Ga0137388_1009817043300012189Vadose Zone SoilVTREHHRLHTKTPHFLRWDARKDALLATRDATFWQQLA*
Ga0137363_1066634223300012202Vadose Zone SoilWETREHHTAHTKTDHFLRWNARKDGLLASREVGFWKQIA*
Ga0137399_1138678113300012203Vadose Zone SoilHEVWATRDHHRSHLKTAHFLRWDACKDALLASREATFWSQIA*
Ga0137362_1151517413300012205Vadose Zone SoilHEVWGAREDHTAHTRTPHFLRWNARKDALLASREVGFWKQIA*
Ga0137379_1068572723300012209Vadose Zone SoilEVWASREAHTEHMHTPHFLRWNARKDALLASREANFWKQIV*
Ga0137360_1065498223300012361Vadose Zone SoilYVRYEVWASRDAHTEHTHTRHFLRWNARKDALIASRDANFWKQIA*
Ga0137390_1159000613300012363Vadose Zone SoilTSREAHTEHTNTPHFLRWNARKDALLASREATFWKQIA*
Ga0137358_1079150213300012582Vadose Zone SoilHEVWTTREAHTEHSHTPHFLRWNARKDALLTSRDANFWKQIG*
Ga0137395_1002473113300012917Vadose Zone SoilVWATREAHTEHSHTPHFLRWNARKDALLASRDANFWKQIV*
Ga0137359_1125209613300012923Vadose Zone SoilWATREHHRLHTQTPHFLRWDARKDALLASREVSFWSQIA*
Ga0137416_1033597123300012927Vadose Zone SoilRDAHTEHTHSPHFLRWNARKDALLAGRDATFWRQVV*
Ga0137416_1159656523300012927Vadose Zone SoilAHTEHTHSPHFLRWNARKDALLAGRDATFWKQVV*
Ga0137404_1056559733300012929Vadose Zone SoilWATRDHHRSHTKTAHFLRWDARKDALLAGREATFWSQIA*
Ga0137404_1119764513300012929Vadose Zone SoilETREHHTAHTRTPHYLRWNARKDALLASRESAFWHHLA*
Ga0153915_1211506333300012931Freshwater WetlandsSREDHARHTKTPHFLRWNARKDAVLASRESAFWKQIA*
Ga0137410_1015859513300012944Vadose Zone SoilDHTAHTRTPHFLRWNARKDALLASREAAFWHQLT*
Ga0126369_1159828223300012971Tropical Forest SoilAHTEHMHTPHFLRWNAGKDALLASRDGTFWHQIA*
Ga0134081_1003469113300014150Grasslands SoilMHVFSREAHTEHMHTPHFLRWDARKDALLTSRDGSFWKQIA*
Ga0181536_1042145013300014638BogHHTAHTRTPHFLRWNARKDALLAAREVTFWQQIA*
Ga0137411_109807233300015052Vadose Zone SoilVWESREAHTEHSHSPHFLRWNARKDALLAGRDANFWKQIV*
Ga0137412_1025410023300015242Vadose Zone SoilLFFEIWSSREAHAEHKRTPHFLRWNARKDTLLAAREATFWKKIS*
Ga0137403_1131915113300015264Vadose Zone SoilREHHTAHTKTDHFLRWNARKDALLASRESGFWKQIV*
Ga0182037_1037154713300016404SoilEIWATREDHTAHTKTDHFLRWNARKDALLASREVGFWKQIA
Ga0187802_1026580813300017822Freshwater SedimentSREHHAAHTRTPHFLRWNARKDSLLASKESAFWQQIA
Ga0187810_1020310113300018012Freshwater SedimentEHHAAHTRTPHFLRWNARKDSLLATRESTFWQQIA
Ga0193733_107807313300020022SoilVAHLLHEVWASREAHTEHTHTRHFLRWNARKDALLASREANFWKQIV
Ga0210407_1064334023300020579SoilWASRDAHTEHTHTRHFLRWNARKDALIASRDANFWKQIA
Ga0210407_1084865623300020579SoilWGARESHTAHTRTPHFLRWNARKDALLASREAAFWHQLA
Ga0210401_1098734413300020583SoilEVWGAREDHTAHTRTAHFLRWNARKDALLAFRESAFWHQLA
Ga0179596_1011381543300021086Vadose Zone SoilEVWATRDHHRSHTKTAHFLRWDARKDALLAGREATFWSQIA
Ga0210404_1000487213300021088SoilGGFLLHEVWATREHHRLHTKTSHFLRWDARKDALLANRDATFWSHLA
Ga0210404_1007341433300021088SoilWATREHHRLHTKTPHFLRWDARKDSLLAARDATFWQHLV
Ga0210406_1050559423300021168SoilSREAHRAHTQTPHFIRWNARKDALLLSRESAFWTQIL
Ga0210406_1055997113300021168SoilVWASREHHRLHTQTPHFIRWDARKDALLASRDLTFWKQVV
Ga0210396_1018600413300021180SoilIWASREAHADHKQTPHFLRWNARKDTLLASRESTFWKKIA
Ga0210397_1036217923300021403SoilREAHTEHTYTPHFLRWNARKDALLASREANFWKQIS
Ga0210387_1086528023300021405SoilHEVWGDREDHTAHTRTPHFLRWNARKDALLASREAAFWHQLA
Ga0210384_1151130613300021432SoilEAREHHTAHTRTPHYLRWNARKDALLASRESAFWHQLA
Ga0210392_1042671813300021475SoilHEVWGAREDHTAHTRTPHFLRWNARKDALLASREAAFWHQLA
Ga0187846_1048226913300021476BiofilmDAHTDHMHTPHFLRWNAGKDSLLTSRDGTFWKQIA
Ga0210410_1160251823300021479SoilSREAHADHKQTPHFLRWNARKDTLLASRESTFWKKIA
Ga0210409_1020439913300021559SoilEHHRLHTQTPHFIRWNARKDALLASRDVTFWKQVV
Ga0210409_1141828513300021559SoilDAHTQHTKTPHFLRWNARKDSLLASRESAFWHQIA
Ga0242662_1005297013300022533SoilEIWASREAHSRHTNTPHFLRWNARKDSLLASRDLTYWKQVV
Ga0242654_1019396613300022726SoilSREAHSRHTNTPHFLRWNARKDSLLASRDVTHWRHVV
Ga0209234_102220033300026295Grasslands SoilEVWASREAHTEHTHTPHFLRWNARKDALLASRDANFWKQIA
Ga0209055_114703523300026309SoilREAHTEHTHTSHFLRWNARKDALLASRDANFWKQIA
Ga0209761_122168623300026313Grasslands SoilEVWETREAHTEHTHSPHFLRWNARKDALLAGRDATFWRQVV
Ga0257158_103390713300026515SoilREAHTEHIHTRHFLRWNASKDMLLASRDANFWKQIS
Ga0209806_128293523300026529SoilREAHTEHTHTPHFLRWNARKDALLASREANFWTQVA
Ga0209161_1030503723300026548SoilEVWASREHHTKHTKTPHFLRWDARKDALLASREAAFWKQIA
Ga0179587_1075281723300026557Vadose Zone SoilEVWSSREAHTEHTHTPHFLRWNARKDVLLASSDRNFWKQIV
Ga0209523_111949613300027548Forest SoilEIWETREHHTAHTKTDHFLRWNARKDALLASRESGFWKQIV
Ga0209735_107533613300027562Forest SoilEVWASREAHSRHTGTPHFLRWNARKDSLLATRDVTYWKQVV
Ga0209735_108372323300027562Forest SoilHEVWATREHHRLHTKTPHFLRWDARKDALLAARDATFWQQLA
Ga0209248_1005722523300027729Bog Forest SoilEVWASREAHSRHTNTPHFLRWNARKDALLASRDVTYWKQIV
Ga0209038_1026720523300027737Bog Forest SoilASREAHSRHTSTPHFLRWNARKDSLLASRDVTYWKQVI
Ga0209180_1037758513300027846Vadose Zone SoilEHHARHRQTPHFLRWNARKDALLASRDASFWKLVV
Ga0209180_1058519013300027846Vadose Zone SoilVWATREAHTEHSHTPHFLRWNARKDALLASRDANFWKQIV
Ga0209701_1014103333300027862Vadose Zone SoilREAHTGHTHTPHFLRWNARKDALLASRDADFWKKIA
Ga0209526_1020795523300028047Forest SoilFLLHEIWATREHHRLHTKTPHFLRWDARKDALLAARDATFWSHLA
Ga0268264_1183110613300028381Switchgrass RhizosphereIWESRNHHTAHTKTDHFLRWNARKDSLLASREVGFWKQIA
Ga0137415_1008537513300028536Vadose Zone SoilLHEVWATREHHRLHTKTPHFLRWNARKDALLAGREATFWQQLA
Ga0308309_1044772533300028906SoilHEVWGAREDHTAHTRTPHFLRWNARKDALLASRESAFWHQLA
Ga0170822_1267578913300031122Forest SoilLLHEVWGAREDHTAHTRTSHFLRWNARKDALLASREAAFWHQLA
Ga0170824_11791194313300031231Forest SoilLHEVWGAREDHTAHTRTPHFLRWNARKDALLASREAAFWHQLA
Ga0170818_10984783923300031474Forest SoilASRDHHAEHKRTPHFLRWNARKDTLLAARESTFWRKLA
Ga0318542_1013101913300031668SoilVWASRDDHGAHTRTPHFLRWNARKDALISSRESAFYRQIA
Ga0307469_1106743413300031720Hardwood Forest SoilIWESRAHHTAHTKTDHFTRWNARKDSLLASRDVGFWKQIA
Ga0306918_1088920713300031744SoilIWKSRAHHAAHTKTDHFLRWNARKDSLLTSRDAAFWKQIG
Ga0318548_1037565043300031793SoilHEVWASREHHAAHTRTPHFLRWNARKDALLASRDSAFWQQIV
Ga0310916_1103934013300031942SoilVWASREHHAAHTRTPHFLRWNARKDALLASRDSAFWQQIA
Ga0310913_1129104913300031945SoilEHHAAHTRTPHFLRWNARKDSLLASKESAFWQQIA
Ga0310909_1004462743300031947SoilREHHAAHTKTDHFLRWNARKDSLLTVREAGNWTQIA
Ga0307479_1100028313300031962Hardwood Forest SoilEVWASREHHRLHMQTRHFLRWNALKDAVLASRDATFWKQIR
Ga0310911_1013737423300032035SoilRNHHTAHTKSDHFLRWNARKDSLLAGREAGFWKQIA
Ga0310911_1022933833300032035SoilEVWASRDDHGAHTRTPHFLRWNARKDALISSRESAFYRQIA
Ga0307472_10003172913300032205Hardwood Forest SoilASREHHRLHTQTRHFLRWSAGKDALLASREAGFWKQIS
Ga0306920_10117527633300032261SoilEHHAAHTRTPHFLRWNARKDALLASRDSAFWQQIV
Ga0335079_1014226543300032783SoilSREHHGAHTRTPHFLRWNARKDALLATREAAFYLQIA
Ga0335079_1164614023300032783SoilWASREHHLAHTRTPHFLRWNARKDALLASRESAFYHQIA
Ga0335069_1225188523300032893SoilEHHTAHTRTPHFLRWNARKDSLLASREAAFWQQLA
Ga0310914_1156658523300033289SoilEHHTAHTRTPHFLRWNARKDALLASRDSAFWQQIA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.