NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072762

Metagenome Family F072762

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072762
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 64 residues
Representative Sequence MNEFLGFWIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Number of Associated Samples 77
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 49.58 %
% of genes near scaffold ends (potentially truncated) 32.23 %
% of genes from short scaffolds (< 2000 bps) 85.95 %
Associated GOLD sequencing projects 64
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.868 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(47.934 % of family members)
Environment Ontology (ENVO) Unclassified
(88.430 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.686 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 66.32%    β-sheet: 0.00%    Coil/Unstructured: 33.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF01807zf-CHC2 3.31
PF04664OGFr_N 3.31
PF07661MORN_2 2.48
PF00239Resolvase 1.65
PF05199GMC_oxred_C 1.65
PF03372Exo_endo_phos 1.65
PF13408Zn_ribbon_recom 0.83
PF01435Peptidase_M48 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0358DNA primase (bacterial type)Replication, recombination and repair [L] 3.31
COG2849Antitoxin component YwqK of the YwqJK toxin-antitoxin moduleDefense mechanisms [V] 2.48
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 1.65
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 1.65
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 1.65

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.87 %
UnclassifiedrootN/A4.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001354|JGI20155J14468_10053422All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1690Open in IMG/M
3300004097|Ga0055584_102566975All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26513Open in IMG/M
3300004279|Ga0066605_10373625All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26515Open in IMG/M
3300004280|Ga0066606_10242476All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26645Open in IMG/M
3300005239|Ga0073579_1006258All Organisms → cellular organisms → Bacteria → Proteobacteria1315Open in IMG/M
3300005239|Ga0073579_1252618All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium818Open in IMG/M
3300005239|Ga0073579_1659039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5633Open in IMG/M
3300005404|Ga0066856_10325864All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26660Open in IMG/M
3300005522|Ga0066861_10339197All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26508Open in IMG/M
3300006164|Ga0075441_10014679All Organisms → cellular organisms → Bacteria → Proteobacteria3287Open in IMG/M
3300006164|Ga0075441_10069870All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261369Open in IMG/M
3300006190|Ga0075446_10128818All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26729Open in IMG/M
3300006190|Ga0075446_10152919All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26657Open in IMG/M
3300006191|Ga0075447_10057176Not Available1424Open in IMG/M
3300006191|Ga0075447_10068763All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261270Open in IMG/M
3300006191|Ga0075447_10314092All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26503Open in IMG/M
3300006193|Ga0075445_10266121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26585Open in IMG/M
3300006352|Ga0075448_10101532All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26902Open in IMG/M
3300006621|Ga0101441_129742All Organisms → cellular organisms → Bacteria3447Open in IMG/M
3300006947|Ga0075444_10063830All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261697Open in IMG/M
3300009071|Ga0115566_10243891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261079Open in IMG/M
3300009071|Ga0115566_10721623All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26551Open in IMG/M
3300009104|Ga0117902_1087883All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3478Open in IMG/M
3300009172|Ga0114995_10243089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26995Open in IMG/M
3300009193|Ga0115551_1066195All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1739Open in IMG/M
3300009420|Ga0114994_10184483All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261407Open in IMG/M
3300009420|Ga0114994_10523349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26780Open in IMG/M
3300009420|Ga0114994_11118621All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26508Open in IMG/M
3300009422|Ga0114998_10329779All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26714Open in IMG/M
3300009425|Ga0114997_10063652All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin262331Open in IMG/M
3300009425|Ga0114997_10106266All Organisms → cellular organisms → Bacteria1707Open in IMG/M
3300009425|Ga0114997_10244787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261012Open in IMG/M
3300009425|Ga0114997_10249890All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300009425|Ga0114997_10265180All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium962Open in IMG/M
3300009425|Ga0114997_10587534All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26588Open in IMG/M
3300009436|Ga0115008_10261393All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261231Open in IMG/M
3300009443|Ga0115557_1238105All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26700Open in IMG/M
3300009443|Ga0115557_1251323All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26677Open in IMG/M
3300009445|Ga0115553_1110871All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261159Open in IMG/M
3300009472|Ga0115554_1146313All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26979Open in IMG/M
3300009476|Ga0115555_1041038All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin262135Open in IMG/M
3300009497|Ga0115569_10521221All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26500Open in IMG/M
3300009498|Ga0115568_10325057All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26676Open in IMG/M
3300009512|Ga0115003_10174897All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261297Open in IMG/M
3300009526|Ga0115004_10135392All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261495Open in IMG/M
3300009526|Ga0115004_10152152All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium1398Open in IMG/M
3300009526|Ga0115004_10304138All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26946Open in IMG/M
3300009526|Ga0115004_10916284All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26524Open in IMG/M
3300009705|Ga0115000_10671774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26641Open in IMG/M
3300009705|Ga0115000_10686702All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26633Open in IMG/M
3300009785|Ga0115001_10085338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin262070Open in IMG/M
3300010883|Ga0133547_11010153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261608Open in IMG/M
3300010883|Ga0133547_11521439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261255Open in IMG/M
3300010883|Ga0133547_11889224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261099Open in IMG/M
3300010883|Ga0133547_11890485All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261099Open in IMG/M
3300010883|Ga0133547_11934884All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261083Open in IMG/M
3300012954|Ga0163111_11355198All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria699Open in IMG/M
3300020372|Ga0211683_10120604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26847Open in IMG/M
3300020419|Ga0211512_10455632All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium573Open in IMG/M
3300020431|Ga0211554_10483771All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26567Open in IMG/M
3300020452|Ga0211545_10257768All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium800Open in IMG/M
3300021087|Ga0206683_10465313Not Available626Open in IMG/M
(restricted) 3300022933|Ga0233427_10427857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26529Open in IMG/M
(restricted) 3300023109|Ga0233432_10423512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26576Open in IMG/M
3300025694|Ga0209406_1198849All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26602Open in IMG/M
3300025719|Ga0209252_1159429All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26720Open in IMG/M
3300025722|Ga0209660_1128487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26861Open in IMG/M
3300025830|Ga0209832_1177803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26609Open in IMG/M
3300025886|Ga0209632_10219523All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26992Open in IMG/M
3300025897|Ga0209425_10360059All Organisms → cellular organisms → Bacteria → Proteobacteria708Open in IMG/M
3300027522|Ga0209384_1004810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria5553Open in IMG/M
3300027522|Ga0209384_1082149All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26797Open in IMG/M
3300027668|Ga0209482_1022986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin262650Open in IMG/M
3300027668|Ga0209482_1097615All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium948Open in IMG/M
3300027668|Ga0209482_1107528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26883Open in IMG/M
3300027686|Ga0209071_1225223All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26519Open in IMG/M
3300027687|Ga0209710_1003497All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria10564Open in IMG/M
3300027687|Ga0209710_1008112All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium6211Open in IMG/M
3300027687|Ga0209710_1130539All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26940Open in IMG/M
3300027687|Ga0209710_1225949All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26621Open in IMG/M
3300027704|Ga0209816_1050610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261875Open in IMG/M
3300027714|Ga0209815_1093727All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261008Open in IMG/M
3300027714|Ga0209815_1120250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26859Open in IMG/M
3300027714|Ga0209815_1208322Not Available601Open in IMG/M
3300027752|Ga0209192_10113778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261104Open in IMG/M
3300027752|Ga0209192_10120396All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261064Open in IMG/M
3300027779|Ga0209709_10043025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster2677Open in IMG/M
3300027779|Ga0209709_10094303All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261585Open in IMG/M
3300027779|Ga0209709_10104167All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261479Open in IMG/M
3300027779|Ga0209709_10147090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261161Open in IMG/M
3300027779|Ga0209709_10150119All Organisms → cellular organisms → Bacteria1144Open in IMG/M
3300027780|Ga0209502_10205959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26902Open in IMG/M
3300027791|Ga0209830_10297607All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26717Open in IMG/M
3300027827|Ga0209035_10254627All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26874Open in IMG/M
3300028197|Ga0257110_1036956All Organisms → cellular organisms → Bacteria2153Open in IMG/M
3300031510|Ga0308010_1325414All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26521Open in IMG/M
3300031519|Ga0307488_10479709All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium748Open in IMG/M
3300031588|Ga0302137_1100333All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261106Open in IMG/M
3300031594|Ga0302131_1292998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26512Open in IMG/M
3300031596|Ga0302134_10261035All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26674Open in IMG/M
3300031621|Ga0302114_10353477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26561Open in IMG/M
3300031622|Ga0302126_10152318All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium858Open in IMG/M
3300031637|Ga0302138_10141292All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26836Open in IMG/M
3300031637|Ga0302138_10159273All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium773Open in IMG/M
3300031637|Ga0302138_10223258All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26622Open in IMG/M
3300031638|Ga0302125_10086357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261039Open in IMG/M
3300031644|Ga0308001_10088146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin261313Open in IMG/M
3300031659|Ga0307986_10279626All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26708Open in IMG/M
3300031675|Ga0302122_10089571All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1306Open in IMG/M
3300031676|Ga0302136_1010850All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium3480Open in IMG/M
3300031676|Ga0302136_1120838All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26831Open in IMG/M
3300031696|Ga0307995_1037095All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin262106Open in IMG/M
3300031700|Ga0302130_1128305All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26800Open in IMG/M
3300031721|Ga0308013_10234337All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26665Open in IMG/M
3300031721|Ga0308013_10305066All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26558Open in IMG/M
3300032073|Ga0315315_11655629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26549Open in IMG/M
3300032151|Ga0302127_10231136All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26797Open in IMG/M
3300032151|Ga0302127_10311826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26634Open in IMG/M
3300032151|Ga0302127_10323389All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium BACL1 MAG-120619-bin26616Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine47.93%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.49%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine9.92%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine4.13%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.31%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.65%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.65%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.65%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.83%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.83%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.83%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005404Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205EnvironmentalOpen in IMG/M
3300005522Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257EnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006191Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006621Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ07 time pointEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009104Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2umEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300020372Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020452Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078)EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300025694Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 (SPAdes)EnvironmentalOpen in IMG/M
3300025719Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025722Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027668Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027686Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031588Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCMEnvironmentalOpen in IMG/M
3300031594Marine microbial communities from Western Arctic Ocean, Canada - CB9_20mEnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031637Marine microbial communities from Western Arctic Ocean, Canada - CBN3_32.1EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031644Marine microbial communities from water near the shore, Antarctic Ocean - #5EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031675Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCMEnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M
3300031721Marine microbial communities from water near the shore, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032151Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCMEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI20155J14468_1005342233300001354Pelagic MarineMGFSMLVVIMACMAWIWRKLKDIETQLNERDLVQQKHNKDIESYLSSLSQEAVNRE
Ga0055584_10256697513300004097Pelagic MarineMAWIWRKLKDIETHLKEKDLVQEKHNKDVASYLAGISQRAINEEWERKFKAQQEDR*
Ga0066605_1037362523300004279MarineMDEFMGFSIVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNKDVESYLSLLSQEAVNQEWERKNKD*
Ga0066606_1024247613300004280MarineKTMNEFLGFWIIIIIATCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERNNKE*
Ga0073579_100625823300005239MarineMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD*
Ga0073579_125261813300005239MarineKTSSSHSWSIETLELLMNEFISFWFVVVIVVCMAWIWRKLKDIETHLKERDLEQGKHNKTVESYLAGISQRAVNEEWERKFKAEQEEED*
Ga0073579_165903943300005239MarineMNELLGFWIIIIIATCMAWIWRKLKDIETHLKERDLVQEKHNKDVASYLSSLSQEAINKEWERNNKD*
Ga0066856_1032586423300005404MarineMNEFVGFWFVVIIVVCMAWIWRKLKDIETHLKERDLEQNKHNKTVESYLAGISQRAVNEEWERKFKAEQEEED*
Ga0066861_1033919723300005522MarineMNEFVGFWFVVIIVVCMAWIWRKLKDIETHLKERDLEQNKHNKTVESYLAGISQRAV
Ga0075441_1001467973300006164MarineMDEFMGFWFVVVIVVCMAWIWRKLKDIETHLKERDLLQDKHNEHVSSELSAISHDAMNQEWERNNKD*
Ga0075441_1006987023300006164MarineMDEFTGFWFVVVIIVCMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0075446_1012881833300006190MarineMAWIWRKLKDIETHLKERDLVQDKHNEHVSSELSAISHDAMNQEWERNNKD*
Ga0075446_1015291913300006190MarineMDEFTGFWFVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0075447_1005717623300006191MarineMAWIWRKLKDLEALIKNKDLIQQKHNKDVAASLSVITQELINQEWERKYKAESEDKSP*
Ga0075447_1006876333300006191MarineMNEFLGFYIVITIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDISAYLSSISQEAINQEWERKNKD*
Ga0075447_1031409223300006191MarineMDEFTGFWFVVVIIACMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0075445_1026612113300006193MarineVVCMAWIWRKLKDIETHLKERDLVQEKHNKDISAYLSSISQEAINQEWERKNKD*
Ga0075448_1010153233300006352MarineMGFWFGVVIVVCMAWIWRKLKDIETHLKERDLLQDKHNEHVSSELSAISHDAMNQEWERNNKD*
Ga0101441_12974283300006621Marine Surface WaterMNEFIGFWFVVVIVVCMAWIWRKLKDIETHLKERDLEQYKHNKTVESYLAGISQRAVNEEWERKFKAEQE
Ga0075444_1006383013300006947MarineMNEFLGFWIVIIIATCMAWIWRKLKDIETHLKERDLVQQKHNKDVKSYLSSLSQEAVNQDWERNNKD*
Ga0115566_1024389133300009071Pelagic MarineMNEFLGFWVVIIIVVCMAWIWRKLKDIEAHLKERDLVQQKHNKDVESYLSLLSQEAVNQDWERKNKD*
Ga0115566_1072162313300009071Pelagic MarineMVCMAWIWRKLKDIETHLKERDLAQEKHNKSVASYLAGISQRAINEEWERKFKAQQEDR*
Ga0117902_108788363300009104MarineMNEFIGFWFAVVIAVCMAWIWRKLKDIETHLKERDLEQNKHNKTVESYLAGISQRAVNEEWERKFKAEQEEED*
Ga0114995_1024308943300009172MarineMNEFLGFWVVIIIVVCMAWIWRKLKDIETHIKERDLVQQKHNKDVESYLSSLSQEAVNQDWERKNKD*
Ga0115551_106619533300009193Pelagic MarineMDEFMGFSMLVVIMACMAWIWRKLKDIETQLNERDLVQQKHNKDIESYLSSLSQEAVNQDWERKNKD*
Ga0114994_1018448333300009420MarineMNEFLGFWIVIIIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD*
Ga0114994_1052334933300009420MarineMDEFMGFSIVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0114994_1111862113300009420MarineMDEFMGFSMLVVIIACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD*
Ga0114998_1032977913300009422MarineMDEFMGFSILVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0114997_1006365243300009425MarineMAWIWRKLKDIESHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0114997_1010626633300009425MarineMNEFLGFYIVITIVVCMAWIWRKLKDIETHLKERDLVQEKHNKNIAAYLSSISQEAINQEWERKFKAEQELKKEHKE*
Ga0114997_1024478723300009425MarineMDEFMGFSIVVVIIACMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKDKKL*
Ga0114997_1024989023300009425MarineMNELLGFWIIIIIATCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINKEWERNNKE*
Ga0114997_1026518033300009425MarineMNEFLGFYIVITIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQ
Ga0114997_1058753413300009425MarineMNEFLGFYIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD*
Ga0115008_1026139323300009436MarineMDEFMGFSMLVVIMACMAWIWRKLKDIETQLNERDLVQQKHNKDIESYLSSLSQEAVNRDWERKNKD*
Ga0115557_123810523300009443Pelagic MarineMDEFLGFYIVITIAVCMAWIWRKLKDIETHLKDRDLVQQKHNQDIAAYLSSISQEAINQEWEK
Ga0115557_125132323300009443Pelagic MarineMDEFMGFSIMVVIIACMAWIWRKLKDIETQLKERDLVQQKHNKDVESYLSLLSQEAVNQDWERKNKD*
Ga0115553_111087113300009445Pelagic MarineMDEFTGFWFVVVIIVCMAWIWRKLKDIETHLKERDLVQQKHNKDVKSYLSSLSQEAVNQD
Ga0115554_114631313300009472Pelagic MarineNPIRAIFILMNEFLGFYIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD*
Ga0115555_104103833300009476Pelagic MarineMDEFMGFSMLVVIMACMAWIWRKLKDIETQLNERDLVQQKHNKDIESYLSSLSQEAVNREWERKNKD*
Ga0115569_1052122113300009497Pelagic MarineAWIWRKLKDIEAHLKERDLVQQKHNKDVESYLSSLSQEAVNQDWERKNKD*
Ga0115568_1032505723300009498Pelagic MarineMNEFTGFWFVVVVVVCMAWIWRKLKDIETHLKERDLVQQKHNKDVKSYLSSLSQEAVNQDWERKNKD*
Ga0115003_1017489723300009512MarineMNEFLGFYIVITIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKSKAEQELKKEHKE*
Ga0115004_1013539233300009526MarineMNEFLGFYIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWKRKNKD*
Ga0115004_1015215233300009526MarineWIWRKLKDIETSLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKSKAEQELKKEHKE*
Ga0115004_1030413813300009526MarineMDEFMGFSILIVIIACMAWIWRKLKDIETHLKEKELVQQKHNKDVESYLSSLSQEAVNQDWERKNKD*
Ga0115004_1091628423300009526MarineMAWIWRKLKDIETHLKEQDLVQKKHNKDVESYLSSLSQEAVNRDWERKNKD*
Ga0115000_1067177423300009705MarineMNEFLGFWVVIIIVVCMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD*
Ga0115000_1068670223300009705MarineMDEFTGFWFVVVIIACMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKDKKL*
Ga0115001_1008533833300009785MarineMNEFLGFWIVIIIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKFKAEQELKKEHKE*
Ga0133547_1101015333300010883MarineMNEFLGFWIVIIIVVCMAWIWRKLKDIETHLKERDVVQEKHNKDIAAYLSSISQEAINQEWERKNKD*
Ga0133547_1150874733300010883MarineMAWVWRKLKDLETLIENKDSIQQKHNKDIASSLSVITQEAINQEWERKFKAEKESESP*
Ga0133547_1152143913300010883MarineMINEFLGFYIVITIVVCMAWIWRKLKDIETSLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKFKA
Ga0133547_1188922443300010883MarineMNEFLGFWIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINKEWERNNKE*
Ga0133547_1189048533300010883MarineMSEFLGFWIVIIIATCMAWIWRKLKDIETHLKERDLVQQKHNKDVESYLSSLSQEAVN
Ga0133547_1193488443300010883MarineMNEFLGFWVVIIIVVCMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAINKEWERNNKD*
Ga0163111_1135519833300012954Surface SeawaterMNEFIGFWFVVVIVVCMAWIWRKLKDIETHLKERDLEQDKHNKTVESYLAGISQRAVNEEWERKFKAEQEEKD*
Ga0211683_1012060413300020372MarineMDEFTGFWFVVVIIVCMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0211512_1045563213300020419MarineMNEFIGFWFVVVIVVCMAWIWRKLTDIETHLKERDLEQDKHNKTVESYLAGISQRAVNEEWERKFKAEQEEKD
Ga0211554_1048377123300020431MarineMDEYYGFWFVAVMVACMAWIWRKLKDIETYLKERDLVQQKHNEKIPEYLNGISQEVVNLEWERKFKAEQELKKKQ
Ga0211545_1025776823300020452MarineMNEFIGFWFVVVIVVCMAWIWRKLKDIETHLKERDLDQDKHNKTVESYLAGISTRAVNEEWERKFKAEQEEED
Ga0206683_1046531313300021087SeawaterLKDIETYLKERDLVQQKHNEKIPEYLNGISQEVVNLEWERKFKAEQELKKKQ
(restricted) Ga0233427_1042785713300022933SeawaterVVIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
(restricted) Ga0233432_1042351223300023109SeawaterMDEFMGFSIVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNKDVESYLSLLSQEAVNQEWERKNKD
Ga0209406_119884913300025694Pelagic MarineMDEFMGFSMLVVIMACMAWIWRKLKDIETQLNERDLVQQKHNKDIESYLSSLSQEAVNRDWERKNKD
Ga0209252_115942923300025719MarineMDEFMGFSIVVVIIACMAWIWRKLKDIETHLKERDLVQEKHNKTVESYLSSISQESVNQDWERKFKAEQEFKKEDK
Ga0209660_112848733300025722MarineMNEFLGFWIIIIIATCMAWIWRKLKDIETHLKKRDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0209832_117780313300025830Pelagic MarineMNEFLGFYIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0209632_1021952343300025886Pelagic MarineIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0209632_1034846823300025886Pelagic MarineVSMAWVWRKLKDLETLIENKDSIQQKHNKDIASSLSVITQEAINQEWERKFKAEKESESP
Ga0209425_1036005923300025897Pelagic MarineMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERK
Ga0209384_100481073300027522MarineMGFWFVVVIVVCMAWIWRKLKDIETHLKERDLLQDKHNEHVSSELSAISHDAMNQEWERNNKD
Ga0209384_108214913300027522MarineMDEFTGFWFVVVIIACMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0209482_102298613300027668MarineMDEFMGFWFVVVIVVCMAWIWRKLKDIETHLKERDLLQDKHNEHVSSELSAISHDAMNQEWERNNKD
Ga0209482_109761513300027668MarineLKDIETHLKERDLVQDKHNEHVSSELSAISHDAMNQEWERKFKAEQEINEKDEP
Ga0209482_110752813300027668MarineMNEFLGFWIVIIIATCMAWIWRKLKDIETHLKERDLVQQKHNKDVKSYLSSLSQEAVNQDWERNNKD
Ga0209071_122522313300027686MarineFIGFWFVVVVVVCMAWIWRKLKDIETHLKERDLVQDKHNKHVSSELSAISHDAMNQEWERKFKAEQEINEKDEP
Ga0209710_1003497133300027687MarineMDEFMGFSILVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0209710_1008112103300027687MarineMNEFLGFWVVIIIVVCMAWIWRKLKDIETHIKERDLVQQKHNKDVESYLSSLSQEAVNQDWERKNKD
Ga0209710_113053913300027687MarineMDEFMGFSIVVVIIACMAWIWRKLKDIETQLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKDKKL
Ga0209710_122594913300027687MarineMNEFTGFWFVVVVVVCMAWIWRKLKDIETHLKERDLVQEKHNEHVSSELSGISHDAMN
Ga0209816_105061013300027704MarineMAWIWRKLKDIETHLKERDLVQDKHNEHVSSELSAISHDAMNQEWER
Ga0209815_109372723300027714MarineMAWIWRKLKDIETHLKERDLVQDKHNEHVSSELSAISHDAMNQEWERNNKD
Ga0209815_112025033300027714MarineFQEGSLMDEFMGFWFVVVIVVCMAWIWRKLKDIETHLKERDLLQDKHNEHVSSELSAISHDAMNQEWERNNKD
Ga0209815_120832233300027714MarineWRKLKDIETHLKERDLVQQKHNKDVESYLSSISQEAINQEWERKFKAEQELKKEHKE
Ga0209192_1011377823300027752MarineMNEFLGFWIVIIIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0209192_1012039633300027752MarineMDEFMGFSILIVIIACMAWIWRKLKDIETHLKEKELVQQKHNKDVESYLSSLSQEAVNQDWERKNKD
Ga0209709_1004302553300027779MarineMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0209709_1009430343300027779MarineMGFSIVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0209709_1010416743300027779MarineMNEFLGFWIVIIIVVCMAWIWRKLKDIESHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0209709_1014709033300027779MarineMNELLGFWIIIIIATCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINKEWERNNKE
Ga0209709_1015011933300027779MarineMNEFLGFYIVITIVVCMAWIWRKLKDIETHLKERDLVQEKHNKNIAAYLSSISQEAINQEWERKFKAEQELKKEHKE
Ga0209502_1020595913300027780MarineMNEFLGFWIVIIIVACMAWIWRKLKDIETHLKEQDLVQKKHNKDVESYLSSLSQEAVNRDWERKNKD
Ga0209830_1029760723300027791MarineMNEFLGFWIVIIIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQE
Ga0209035_1025462723300027827MarineMDEFTGFWFVVVIIVCMAWIWRKLKDIETHLKERDLVQQKHNKDVKSYLSSLSQEAVNQDWERNNKD
Ga0257110_103695633300028197MarineMNEFLGFWVVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINKEWERNNKE
Ga0308010_132541423300031510MarineMNEFTGFWFVVVVVVCMAWIWRKLKDIETHLKERDLAQEKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0307488_1047970923300031519Sackhole BrineMNEFLGFWIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0302137_110033323300031588MarineMDEFMGFSIVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0302131_129299813300031594MarineMNEFLGFYIAITIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0302134_1026103513300031596MarineVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0302114_1035347713300031621MarineMDEFIGFSIVVVIMACMAWIWRKLKDIETHLNERDLVQQKHNKNVESYLSSLSQEAVNQEWERKNKD
Ga0302126_1015231813300031622MarineMNEFLGFYIVIIIVVCMAWIWRKLKDIETHLKERDLVQQKHNKDVESYLSSLSQEAVNQEWER
Ga0302138_1014129223300031637MarineMNEFLGFYIVITIVACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKFKAEQELKKEHKE
Ga0302138_1015927313300031637MarineKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKSKAEQEIKKEHKE
Ga0302138_1022325823300031637MarineMNEFLGFWIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKN
Ga0302125_1008635733300031638MarineMVVCMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0308001_1008814613300031644MarineMDEFTGFWFVVVIIVCMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0307986_1027962613300031659MarineVIDLIGFYIVIVIMVCMAWIWRKLKDIETHLKERDLLQDKHNEHVSSELSAISHDAMNQEWGRNNKD
Ga0302122_1008957153300031675MarineKDIETHLKERDLVQQKHNKDVESYLSSLSQEAVNQDWERKNKD
Ga0302136_101085093300031676MarineMNEFLGFYIVIIIVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQE
Ga0302136_112083833300031676MarineEFMGFSILVVIIACMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0307995_103709523300031696MarineMDEFTGFWFVVVIIACMAWIWRKLKDIETHLKERDLVQQKHNKDVKSYLSSLSQEAVNQDWERNNKD
Ga0302130_112830513300031700MarineMNEFLGFWIVIIVVVCMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0308013_1023433713300031721MarineMAWIWRKLKDIETHLKERDLVQEKHNEHVSSELSAISHDAMNQEWERNNKD
Ga0308013_1030506613300031721MarineMDEFMGFWFVVVIVVCMAWIWRKLKDIETHLKERDLVQEKHNEHVSSELSAISHDAMNKE
Ga0315315_1165562923300032073SeawaterKLKDIETHLKERDLEQNKHNKTVESYLAGISQRAVNEEWERKNKD
Ga0302127_1023113633300032151MarineMDEFMGFSMLVVIIACMAWIWRKLKDIETHLKERDLVQEKHNKDIAAYLSSISQEAINQEWERKNKD
Ga0302127_1031182633300032151MarineMNEFLGFWIVIIIATCMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD
Ga0302127_1032338923300032151MarineMAWIWRKLKDIETHLKERDLVQQKHNEHVSSELSAISHDAMNKEWERNNKD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.