Basic Information | |
---|---|
Family ID | F072441 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 121 |
Average Sequence Length | 41 residues |
Representative Sequence | MFNNDKINKNKEAAIIEGPDAVLNSNEENNPKITDNK |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.65 % |
% of genes near scaffold ends (potentially truncated) | 78.51 % |
% of genes from short scaffolds (< 2000 bps) | 96.69 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.347 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (28.926 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.116 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 7.69% β-sheet: 0.00% Coil/Unstructured: 92.31% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF01475 | FUR | 75.21 |
PF02615 | Ldh_2 | 6.61 |
PF01451 | LMWPc | 2.48 |
PF00486 | Trans_reg_C | 1.65 |
PF00950 | ABC-3 | 1.65 |
PF01895 | PhoU | 0.83 |
PF01061 | ABC2_membrane | 0.83 |
PF00230 | MIP | 0.83 |
PF07750 | GcrA | 0.83 |
PF00809 | Pterin_bind | 0.83 |
PF00528 | BPD_transp_1 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 75.21 |
COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 6.61 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 1.65 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 1.65 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 1.65 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.83 |
COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.35 % |
Unclassified | root | N/A | 1.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000117|DelMOWin2010_c10118383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 931 | Open in IMG/M |
3300000973|BBAY93_10039107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1248 | Open in IMG/M |
3300001353|JGI20159J14440_10032736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2197 | Open in IMG/M |
3300001354|JGI20155J14468_10167351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 686 | Open in IMG/M |
3300001951|GOS2249_1006171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1490 | Open in IMG/M |
3300001960|GOS2230_1051633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1650 | Open in IMG/M |
3300001969|GOS2233_1072735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 872 | Open in IMG/M |
3300001972|GOS2216_10027017 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
3300001974|GOS2246_10061461 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300002040|GOScombined01_102388544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1854 | Open in IMG/M |
3300002040|GOScombined01_105270108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1514 | Open in IMG/M |
3300002176|JGI24820J26691_1084730 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 619 | Open in IMG/M |
3300002176|JGI24820J26691_1099792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
3300003474|NAP4_1148541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300005432|Ga0066845_10084624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1193 | Open in IMG/M |
3300005608|Ga0066840_10084955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
3300005960|Ga0066364_10160411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 773 | Open in IMG/M |
3300006305|Ga0068468_1003218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 9066 | Open in IMG/M |
3300006315|Ga0068487_1308334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
3300006329|Ga0068486_1026486 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
3300006332|Ga0068500_1377777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1340 | Open in IMG/M |
3300006334|Ga0099675_1517296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
3300006334|Ga0099675_1602767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300006411|Ga0099956_1014308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1358 | Open in IMG/M |
3300006412|Ga0099955_1202644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1808 | Open in IMG/M |
3300007113|Ga0101666_1042474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 832 | Open in IMG/M |
3300007114|Ga0101668_1034772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1017 | Open in IMG/M |
3300007133|Ga0101671_1058186 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300007283|Ga0066366_10521242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
3300007954|Ga0105739_1063559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 815 | Open in IMG/M |
3300008097|Ga0111541_10213823 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
3300008253|Ga0105349_10255547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 729 | Open in IMG/M |
3300009071|Ga0115566_10839404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300009126|Ga0118723_1361984 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300009193|Ga0115551_1267362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 753 | Open in IMG/M |
3300009339|Ga0117928_1170144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
3300009505|Ga0115564_10547086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
3300009703|Ga0114933_10730230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300009703|Ga0114933_10882446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
3300009703|Ga0114933_11038385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300010936|Ga0137784_1050394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 844 | Open in IMG/M |
3300011013|Ga0114934_10103304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1384 | Open in IMG/M |
3300012919|Ga0160422_10998478 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300012928|Ga0163110_11337262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
3300012954|Ga0163111_11799082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 613 | Open in IMG/M |
3300012954|Ga0163111_12201784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
3300012954|Ga0163111_12750276 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
3300013116|Ga0171646_1172523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 723 | Open in IMG/M |
3300013188|Ga0116834_1035791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 894 | Open in IMG/M |
3300017717|Ga0181404_1167037 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300017743|Ga0181402_1118395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 679 | Open in IMG/M |
3300017745|Ga0181427_1146225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300017752|Ga0181400_1096590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
3300017759|Ga0181414_1191028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
3300017767|Ga0181406_1255246 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
3300017782|Ga0181380_1284832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300017956|Ga0181580_10245891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1237 | Open in IMG/M |
3300017986|Ga0181569_10384076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
3300018876|Ga0181564_10119609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1617 | Open in IMG/M |
3300020191|Ga0181604_10375614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
3300020194|Ga0181597_10482736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300020282|Ga0211667_1032534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1340 | Open in IMG/M |
3300020318|Ga0211491_1042608 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
3300020334|Ga0211593_1071661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 723 | Open in IMG/M |
3300020340|Ga0211594_1129721 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
3300020353|Ga0211613_1060917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
3300020353|Ga0211613_1098213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300020359|Ga0211610_1042626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1047 | Open in IMG/M |
3300020360|Ga0211712_10108387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 684 | Open in IMG/M |
3300020371|Ga0211500_1202880 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 571 | Open in IMG/M |
3300020374|Ga0211477_10179293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 746 | Open in IMG/M |
3300020387|Ga0211590_10014596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2367 | Open in IMG/M |
3300020396|Ga0211687_10177430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 870 | Open in IMG/M |
3300020396|Ga0211687_10298825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 635 | Open in IMG/M |
3300020396|Ga0211687_10423495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300020403|Ga0211532_10179814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 853 | Open in IMG/M |
3300020405|Ga0211496_10193491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 754 | Open in IMG/M |
3300020416|Ga0211644_10341712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300020429|Ga0211581_10100157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1169 | Open in IMG/M |
3300020433|Ga0211565_10419932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300020448|Ga0211638_10482399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300020449|Ga0211642_10483171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
3300020450|Ga0211641_10485470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
3300020451|Ga0211473_10604605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
3300020451|Ga0211473_10630801 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300020456|Ga0211551_10109063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1301 | Open in IMG/M |
3300020459|Ga0211514_10020887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3523 | Open in IMG/M |
3300020459|Ga0211514_10480947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
3300020460|Ga0211486_10310768 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 679 | Open in IMG/M |
3300020461|Ga0211535_10436366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
3300020463|Ga0211676_10214667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1153 | Open in IMG/M |
3300020463|Ga0211676_10566998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300020477|Ga0211585_10483272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 702 | Open in IMG/M |
3300020477|Ga0211585_10749948 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
3300020477|Ga0211585_10764521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
3300021365|Ga0206123_10067840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1781 | Open in IMG/M |
3300022914|Ga0255767_1088889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1493 | Open in IMG/M |
3300023087|Ga0255774_10098979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1673 | Open in IMG/M |
3300023087|Ga0255774_10403370 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300023105|Ga0255782_10225910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 913 | Open in IMG/M |
3300024230|Ga0228638_1145465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
3300024231|Ga0233399_1138833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
3300024237|Ga0228653_1015128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1847 | Open in IMG/M |
(restricted) 3300024261|Ga0233439_10434785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300025685|Ga0209095_1177981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
3300025830|Ga0209832_1218334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300025881|Ga0209309_10291247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 740 | Open in IMG/M |
3300025886|Ga0209632_10432879 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300026076|Ga0208261_1111946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
3300026085|Ga0208880_1074116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 736 | Open in IMG/M |
3300026203|Ga0207985_1043184 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300026517|Ga0228607_1132971 | Not Available | 609 | Open in IMG/M |
3300027774|Ga0209433_10219159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
3300028194|Ga0257106_1274777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 558 | Open in IMG/M |
3300028273|Ga0228640_1086856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
3300028290|Ga0247572_1042688 | Not Available | 1066 | Open in IMG/M |
3300031775|Ga0315326_10696262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 640 | Open in IMG/M |
3300031851|Ga0315320_10983541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
3300032006|Ga0310344_10669706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 885 | Open in IMG/M |
3300032047|Ga0315330_10175866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1393 | Open in IMG/M |
3300032820|Ga0310342_100947569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1006 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 28.93% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.74% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.44% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.79% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 4.96% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.96% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.96% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.13% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.31% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.31% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.48% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.48% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.48% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.65% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.65% |
Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 1.65% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.83% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.83% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.83% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.83% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.83% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.83% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.83% |
Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 0.83% |
Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 0.83% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
3300001960 | Marine microbial communities from South of Charleston, South Carolina, USA - GS014 | Environmental | Open in IMG/M |
3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
3300002176 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m | Environmental | Open in IMG/M |
3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
3300006411 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0200m | Environmental | Open in IMG/M |
3300006412 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0125m | Environmental | Open in IMG/M |
3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
3300007133 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-ds | Environmental | Open in IMG/M |
3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
3300009339 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300010936 | Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m | Environmental | Open in IMG/M |
3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300013116 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
3300020318 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX556107-ERR598973) | Environmental | Open in IMG/M |
3300020334 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555938-ERR599091) | Environmental | Open in IMG/M |
3300020340 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX555960-ERR599119) | Environmental | Open in IMG/M |
3300020353 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998) | Environmental | Open in IMG/M |
3300020359 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555921-ERR599117) | Environmental | Open in IMG/M |
3300020360 | Marine microbial communities from Tara Oceans - TARA_B100000459 (ERX555918-ERR599165) | Environmental | Open in IMG/M |
3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
3300020387 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX556119-ERR599023) | Environmental | Open in IMG/M |
3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300022914 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG | Environmental | Open in IMG/M |
3300023087 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG | Environmental | Open in IMG/M |
3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
3300024230 | Seawater microbial communities from Monterey Bay, California, United States - 48D | Environmental | Open in IMG/M |
3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
3300025830 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes) | Environmental | Open in IMG/M |
3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026203 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes) | Environmental | Open in IMG/M |
3300026517 | Seawater microbial communities from Monterey Bay, California, United States - 8D | Environmental | Open in IMG/M |
3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300028273 | Seawater microbial communities from Monterey Bay, California, United States - 51D | Environmental | Open in IMG/M |
3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOWin2010_101183833 | 3300000117 | Marine | MFNKDNINKIKAATIIEGPEEVLNSNEENNPNITENNPPITE* |
BBAY93_100391074 | 3300000973 | Macroalgal Surface | MDCFILSNERMNKNKEAAIIEGPEAVLNSKDVNNPIITDNKPP |
JGI20159J14440_100327363 | 3300001353 | Pelagic Marine | MFNKDNINKIKAATIIEGPEEVLNSNEENNPNITE* |
JGI20155J14468_101673513 | 3300001354 | Pelagic Marine | MFNKDKINNIKAATIIEGPDEVLNSNEENNPNITDNKP |
GOS2249_10061713 | 3300001951 | Marine | MLSKDNINKIKEAIIIEGPDDVLNSKDENSPNNTD |
GOS2230_10516331 | 3300001960 | Marine | MNKNKEAAMIDGPEDVLNCNEVNKPKITDNKPPSTE* |
GOS2233_10727351 | 3300001969 | Marine | MDCFILSNERMNKNKEAAIIEGPEAVLNSKDVNNPIITDNKPPITEKRIICCGL |
GOS2216_100270174 | 3300001972 | Marine | MDCFIFNNESTNKIKDAVIIEGPDAVLNSSEENNPIITDSKPPNY* |
GOS2246_100614611 | 3300001974 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPIITDNKPPI |
GOScombined01_1023885443 | 3300002040 | Marine | NLIDCLMLSKDNINNTKAAMIIEGPDDVLNSNEENKPNKTDKRPPNY* |
GOScombined01_1052701081 | 3300002040 | Marine | LIDCFILSRESINRNKEAAIIEGPEAVLNSKDVNSPIITDNKPPITEKRII |
JGI24820J26691_10847302 | 3300002176 | Marine | MFSSDKINRNKEAAIIEGPEAVLNSSEENNPKITDNKPPIIEYITIFWGLEE |
JGI24820J26691_10997922 | 3300002176 | Marine | MFSSDKINRNKEAAIIEGPEAVLNSSEENNPKITDNKQIGR |
NAP4_11485412 | 3300003474 | Estuarine | MDCFIFNKDKINKNKDAAIIEGPDAVLNSSDENKPIITDNR |
Ga0066845_100846241 | 3300005432 | Marine | MDCFIFNNESINRNKDAVIIEGPEAVLNSSEENSPITTDNKPP |
Ga0066840_100849552 | 3300005608 | Marine | MFNNDKINKNKEAAIIDGPEAVLNSNEENNPKITDN |
Ga0066364_101604111 | 3300005960 | Marine | LILNNESINNKKAAVIIEGPDEVLNSSEENNPKITDNKPPIIE* |
Ga0068468_100321811 | 3300006305 | Marine | MDCFILSNERMNKNKEAAIIDGPEAVLNSKDVNNPI |
Ga0068487_13083341 | 3300006315 | Marine | MDCFIFNNESINKIKDAVIIEGPDAVLNSSEENNPIITDSKPPIIA |
Ga0068486_10264861 | 3300006329 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPII |
Ga0068500_13777775 | 3300006332 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSNEEKAAL |
Ga0099675_15172962 | 3300006334 | Marine | LIFSNESINKNKEAAIIDGPEEVLNSSEVNKPKTTDS |
Ga0099675_16027672 | 3300006334 | Marine | MFNNDKINNNKDAAIIEGPDAVLNSSEENNPKITDNNP |
Ga0099956_10143081 | 3300006411 | Marine | MDCFIFNNERINKTNDAVIIEGPDAVLNSSEENSPIITDNK |
Ga0099955_12026444 | 3300006412 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPITTDNKPPIIE |
Ga0101666_10424741 | 3300007113 | Volcanic Co2 Seep Seawater | MDCFIFNKDKINKNKDAAIIEGPDAVLNSSDENKPIITD |
Ga0101668_10347721 | 3300007114 | Volcanic Co2 Seep Seawater | MDCFILNKDKINKNKEAAIIDGPDAVLNSSEENKPIITDNK |
Ga0101671_10581861 | 3300007133 | Volcanic Co2 Seeps | MFNNDKINKNKEAAIIDGPEAVLNSNEENNPKITD |
Ga0066366_105212422 | 3300007283 | Marine | MDCFIFNNESINKTNDAVIIEGPDGVLNSSDENNPII |
Ga0105739_10635593 | 3300007954 | Estuary Water | MFNKDNINKTSAATIIEGPDDVLNSKEQNNPNITDNNPP |
Ga0111541_102138232 | 3300008097 | Marine | MDCFIFNNESINRTKAAVIIEGPDAVLNSSEENSPIITDNKP |
Ga0105349_102555471 | 3300008253 | Methane Seep Mesocosm | MFNKDKINKAKDATIIEGPEEVLNSNEVNNPNITDNKPPIIEKRTIFCGLS |
Ga0115566_108394042 | 3300009071 | Pelagic Marine | MNRNKAAAIIEGPEDVLNSKEENNPNITDSNPPMIE* |
Ga0118723_13619841 | 3300009126 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPI |
Ga0115551_12673623 | 3300009193 | Pelagic Marine | MNKNKAAAMIDGPEDVLNSKEENNPNITDNKPPMIE* |
Ga0117928_11701441 | 3300009339 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPIITD |
Ga0115564_105470862 | 3300009505 | Pelagic Marine | MNKNKAAAIIEGPEDVLNSKEENNPNITDSNPPMIE* |
Ga0114933_107302302 | 3300009703 | Deep Subsurface | MDCLIFNNERINKTNDAVIIEGPDAVLNSSEENKPIITDSKPPITENNTIFCG |
Ga0114933_108824462 | 3300009703 | Deep Subsurface | MDCFIFNNESINKTNDAVIIEGPDAVLNSSEENKPIITDSKPPITENNTIFCG |
Ga0114933_110383851 | 3300009703 | Deep Subsurface | MDCFIFNNESINKTNDAVIIEGPDAVLNSSEENKPIITDSKPPITENNTIFCGLS |
Ga0137784_10503941 | 3300010936 | Marine | MFNNDKINSNKDAAIIEGPDAVLNSSEENNPKITDNKPPIIEYITIF* |
Ga0114934_101033041 | 3300011013 | Deep Subsurface | MDCFIFNNESINKTKDAVIIEGPDAVLNSSEENKPIITDSKPPITENNTIFCGL |
Ga0160422_109984781 | 3300012919 | Seawater | MFSNDKINKNKEAVIIEGPDAVLNSSEENNPKITDNKPPIIEYITIF |
Ga0163110_113372622 | 3300012928 | Surface Seawater | MNNNKAAVIIDGPDAVLNSSEENNPKITDNKPPIIE* |
Ga0163111_117990821 | 3300012954 | Surface Seawater | MNNTKAAMIIEGPDDVLNSNEENSPNKTDKRPPITENKTIF* |
Ga0163111_122017841 | 3300012954 | Surface Seawater | MNKNKAAAIIEGPEAVLNSKEVNKPKITDNKPPITEII |
Ga0163111_127502762 | 3300012954 | Surface Seawater | LIDCFIFSSESINKNKEAAIIDGPEAVLNSKDVNSPIITDN |
Ga0171646_11725233 | 3300013116 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPIITDNKPPIIE |
Ga0116834_10357913 | 3300013188 | Marine | MDCFILNKDKMNKNNDAAIIDGPEAVLNSSEENSPSITDN |
Ga0181404_11670371 | 3300017717 | Seawater | MFNKDNINKISAATIIEGPDDVLNSKEVNNPNTNDKKHPMIE |
Ga0181402_11183951 | 3300017743 | Seawater | LILSKDNINKTKAAIIIEGPDAVLNSNEENKPNITDKRPPITENKTIF |
Ga0181427_11462252 | 3300017745 | Seawater | LNNERINKNKEAAIIEGPDDVLNSSEENSPETTDNKPP |
Ga0181400_10965901 | 3300017752 | Seawater | MNKNKAAAIIEGPEDVLNSKEENNPNITDNTPPIIE |
Ga0181414_11910282 | 3300017759 | Seawater | MFNKESMNRNKAAAIIEGPDDVLNSKEENNPNITDNKPPMIE |
Ga0181406_12552462 | 3300017767 | Seawater | MNKNKAAAMIEGPEDVLNSKEENNPNVTDNKPPIIE |
Ga0181380_12848321 | 3300017782 | Seawater | MNKNKEAAMIDGPEDVLNCNEVNKPKITDNKPPSTE |
Ga0181580_102458911 | 3300017956 | Salt Marsh | MNKNNEAAIIEGPEAVLNSSEENNPSITDNKPPIIEKNIIFXGLSE |
Ga0181569_103840763 | 3300017986 | Salt Marsh | MFNNDKINSNKDAAIIEGPDAVLNSSEENNPKITDNKPPIIEYI |
Ga0181564_101196091 | 3300018876 | Salt Marsh | MDCFILNKDKMNKNNEAAIIEGPEAVLNSSEENNPSI |
Ga0181604_103756142 | 3300020191 | Salt Marsh | MNKNNEAAIIEGPEAVLNSSEENNPSITDNKPPIIEKNIIFXGL |
Ga0181597_104827361 | 3300020194 | Salt Marsh | MDCFIFNKDKINKNKDAAIIEGPDAVLNSSDENKPIITDNRPPITEKNKIFR |
Ga0211667_10325341 | 3300020282 | Marine | MFNNDKINKNKEAAIIEGPDAVLNSNEENNPKITDNK |
Ga0211491_10426082 | 3300020318 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPIITDN |
Ga0211593_10716611 | 3300020334 | Marine | MLSKDSINNTKAAMIIEGPDDVLNSNEENSPNKTDKRPPITEN |
Ga0211594_11297211 | 3300020340 | Marine | MFSSDKINRNKEAAIIDGPEAVLNSNEENNPKITDNN |
Ga0211613_10609173 | 3300020353 | Marine | MDCFIFNNESINKIKDALIIEGPDAVLNSSEANKPKITDSKPPIIENN |
Ga0211613_10982133 | 3300020353 | Marine | MDCFIFNNESINKIKDAVIIEGPDAVLNSSEENSPIITD |
Ga0211610_10426263 | 3300020359 | Marine | MDCFIFNNESINKIKDAVIIEGPDAVLNSSEENNPIITDSKPPIIANSTIF |
Ga0211712_101083871 | 3300020360 | Marine | MFNNDKINSNKDAAIIEGPDAVLNSSEENNPKITDNNPP |
Ga0211500_12028801 | 3300020371 | Marine | MFNNDKINSNKDAAIIEGPDAVLNSSEENNPKITD |
Ga0211477_101792931 | 3300020374 | Marine | MNNNKAAVIIEGPDEVLNSSEENNPKITDNKPPIIE |
Ga0211590_100145961 | 3300020387 | Marine | MNKNKAAAIIEGPEAVLNSKEVNKPKITDNKPPITE |
Ga0211687_101774303 | 3300020396 | Marine | MFNKDNINNVNAATIIEGPEEVLNSNEENNPKITDSNP |
Ga0211687_102988253 | 3300020396 | Marine | MFNKDNINKIKAATIIEGPEEVLNSNEENNPNITDN |
Ga0211687_104234951 | 3300020396 | Marine | MFNKDNINNISAATIIEGPEEVLNSNEENNPNITDNKPPITE |
Ga0211532_101798143 | 3300020403 | Marine | LIFSNESINKNKEAAIIDGPEEVLNSSEVNKPKTTDSKPPRIEKI |
Ga0211496_101934911 | 3300020405 | Marine | MLSKDNINKIKEAIIIEGPDDVLNSRDENSPNNTDNN |
Ga0211644_103417122 | 3300020416 | Marine | MNNNKAAVIIDGPDAVLNSSEENNPKITDNKPPII |
Ga0211581_101001574 | 3300020429 | Marine | MFNNDKINSNKDAAIIEGPEAVLNSSEENNPNITDNKPPMIEYIT |
Ga0211565_104199322 | 3300020433 | Marine | MFNNDKINKNKDAAIIEGPDAVLNSSEENNPKITDNN |
Ga0211638_104823991 | 3300020448 | Marine | MNKNKEAAMIDGPEDVLNCNEVNKPKITDNKPPSIE |
Ga0211642_104831712 | 3300020449 | Marine | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPIITDNKPPIIEK |
Ga0211641_104854702 | 3300020450 | Marine | MFNSDKINRNKDAVIIEGPDAVLNSSEENNPKITDNKPPKIEYITIFXGLEEIF |
Ga0211473_106046052 | 3300020451 | Marine | MDCFIFNNERINKTNDAVIIEGPDAVLNSSEENSPIITDN |
Ga0211473_106308012 | 3300020451 | Marine | MFSKDRINNSNAAAIIDGPDEVLNSNEVNNPIITDN |
Ga0211551_101090631 | 3300020456 | Marine | MDCFIFNNESINKIKDAVIIEGPDAVLNSNDENKPIITD |
Ga0211514_100208876 | 3300020459 | Marine | MNKNKEAAMIDGPEDVLNSKEVNKPKITDSKPPSTE |
Ga0211514_104809471 | 3300020459 | Marine | MFNNDKINKNKEAAIIDGPEAVLNSNEENNPKITDNK |
Ga0211486_103107682 | 3300020460 | Marine | MDCFIFNNESINKTKDAVIIEGPDAVLNSNDENNPIITD |
Ga0211535_104363661 | 3300020461 | Marine | LIDCFILSRESINRNKEAAIIDGPEAVLNSKDVNSPII |
Ga0211676_102146673 | 3300020463 | Marine | MNKNKEAAMIDGPEDVLNCNEVNKPKITDNKPPITE |
Ga0211676_105669982 | 3300020463 | Marine | MFSSDKINRNKEAAIIEGPDAVLNSSEENNPKITDNKP |
Ga0211585_104832723 | 3300020477 | Marine | MLSKDNINNTKAAMIIEGPDDVLNSNEENKPNKTDKRPP |
Ga0211585_107499482 | 3300020477 | Marine | MFNNESINKNKEAAIIDGPDDVLNSKEENNPIITDNK |
Ga0211585_107645211 | 3300020477 | Marine | MDCFIFNNESINKTNDAVIIEGPDAVLNSSEENKPIITDSKPPITE |
Ga0206123_100678401 | 3300021365 | Seawater | MFNKDNINKISAATIIEGPDDVLNSKEQNNPNITDNNPPITE |
Ga0255767_10888894 | 3300022914 | Salt Marsh | MDCFIFNKDKINKNKDAAIIEGPDAVLNSSDENKPIITDNRPPITEKNTIFRGL |
Ga0255774_100989794 | 3300023087 | Salt Marsh | MDCFIFNKDKINKNKDAAIIEGPDAVLNSSDENKPIITDNRPPITEKNT |
Ga0255774_104033701 | 3300023087 | Salt Marsh | MDCFILNKDKMNKNNEAAIIEGPEAVLNSSEENSPSITDNKPPII |
Ga0255782_102259101 | 3300023105 | Salt Marsh | MDCFILNKDKMNKNNEAAIIEGPEAVLNSSEENNPRITDNKPPIIE |
Ga0228638_11454651 | 3300024230 | Seawater | MNKNKAAAIIEGPDDVLNSKEENNPNITDNTPPIIEYTTIFC |
Ga0233399_11388332 | 3300024231 | Seawater | MFNKDNMNNIKAATIIDGPDDVLNSNDENNPNITD |
Ga0228653_10151281 | 3300024237 | Seawater | MNKNKAAAMIEGPEDVLNSKEENNPNITDNKPPMIE |
(restricted) Ga0233439_104347851 | 3300024261 | Seawater | MFNKDNINNINAATIIEGPEEVLNSNEENNPKITDNKPPITE |
Ga0209095_11779811 | 3300025685 | Pelagic Marine | MFNKERMNRNKAAAIIEGPDDVLNSSEENSPKTTDNKPPMIE |
Ga0209832_12183341 | 3300025830 | Pelagic Marine | MFNKDKINNIKAATIIEGPDEVLNSNEENNPNITDNKPPITE |
Ga0209309_102912471 | 3300025881 | Pelagic Marine | MNKNKAAAIIEGPEDVLNSKEENNPNITDSNPPMIE |
Ga0209632_104328791 | 3300025886 | Pelagic Marine | LNNERINKNKEAAIIEGPDDVLNSSEENSPKTTDSKP |
Ga0208261_11119463 | 3300026076 | Marine | MFNNDKINKNKEAAIIEGPDAVLNSNEENNPNITDNKPPTIE |
Ga0208880_10741163 | 3300026085 | Marine | MDCFIFNKDKINKNKDAAIIEGPDAVLNSSDENKPIITDNRPP |
Ga0207985_10431844 | 3300026203 | Marine | MFNNDKINNNKDAAIIEGPDAVLNSSEENNPKITDN |
Ga0228607_11329712 | 3300026517 | Seawater | MNKNKAAAMIEGPEDVLNYKEENNPNITDNKPPMIE |
Ga0209433_102191591 | 3300027774 | Marine | MFSSDKINRNKEAAIIEGPEAVLNSSEENNPKITDNKP |
Ga0257106_12747771 | 3300028194 | Marine | MFDKDNINKIKAATIMEGPDDVLNSKEQNNPNITDNN |
Ga0228640_10868562 | 3300028273 | Seawater | MFNKDNMNNIKAATIIDGPDDVLNSNDENNPNITDNKPP |
Ga0247572_10426882 | 3300028290 | Seawater | MFNKDNINNIRAATIIEGPDDVLNSKEENNPKITDNKPPITE |
Ga0315326_106962622 | 3300031775 | Seawater | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSPINTD |
Ga0315320_109835412 | 3300031851 | Seawater | MFNKDNINKISAATIIEGPDDVLNSKEQNNPNITDNNP |
Ga0310344_106697063 | 3300032006 | Seawater | MDCFIFNKESINKTKEADIIEGPDAVLNSSDENKPIITDNKPP |
Ga0315330_101758661 | 3300032047 | Seawater | MNNINAAAIIEGPEDVLNSNEEYSPKITDNKPPIIE |
Ga0310342_1009475691 | 3300032820 | Seawater | MDCFIFNNESINRTKDAVIIEGPDAVLNSSEENSP |
⦗Top⦘ |