NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072412

Metagenome Family F072412

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072412
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 48 residues
Representative Sequence VKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Number of Associated Samples 112
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 90.08 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.521 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(12.397 % of family members)
Environment Ontology (ENVO) Unclassified
(35.537 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.669 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.89%    β-sheet: 19.44%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF02224Cytidylate_kin 81.82
PF13207AAA_17 1.65
PF01641SelR 1.65
PF01042Ribonuc_L-PSP 0.83
PF02661Fic 0.83
PF13415Kelch_3 0.83
PF00351Biopterin_H 0.83
PF10136SpecificRecomb 0.83
PF02954HTH_8 0.83
PF02567PhzC-PhzF 0.83
PF00483NTP_transferase 0.83
PF00005ABC_tran 0.83
PF13620CarboxypepD_reg 0.83
PF11950DUF3467 0.83
PF00152tRNA-synt_2 0.83
PF00756Esterase 0.83
PF01336tRNA_anti-codon 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0283Cytidylate kinaseNucleotide transport and metabolism [F] 81.82
COG0229Peptide methionine sulfoxide reductase MsrBPosttranslational modification, protein turnover, chaperones [O] 1.65
COG0017Aspartyl/asparaginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.83
COG0173Aspartyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.83
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.83
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.83
COG1190Lysyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.83
COG2269Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway)Translation, ribosomal structure and biogenesis [J] 0.83
COG3186Phenylalanine-4-hydroxylaseAmino acid transport and metabolism [E] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.52 %
UnclassifiedrootN/A2.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002074|JGI24748J21848_1018997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis825Open in IMG/M
3300004082|Ga0062384_100962009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter608Open in IMG/M
3300004091|Ga0062387_100158344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1314Open in IMG/M
3300004092|Ga0062389_104738745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter512Open in IMG/M
3300005174|Ga0066680_10765895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter585Open in IMG/M
3300005455|Ga0070663_100001295All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter13713Open in IMG/M
3300005938|Ga0066795_10026716All Organisms → cellular organisms → Bacteria1668Open in IMG/M
3300005950|Ga0066787_10137274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter546Open in IMG/M
3300005995|Ga0066790_10016076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3293Open in IMG/M
3300006086|Ga0075019_11113662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7513Open in IMG/M
3300006162|Ga0075030_100158402All Organisms → cellular organisms → Bacteria1830Open in IMG/M
3300006162|Ga0075030_100926436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae687Open in IMG/M
3300006354|Ga0075021_10940434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7562Open in IMG/M
3300006893|Ga0073928_10710774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7700Open in IMG/M
3300009623|Ga0116133_1113819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7694Open in IMG/M
3300009630|Ga0116114_1088468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7833Open in IMG/M
3300009632|Ga0116102_1054096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71251Open in IMG/M
3300009698|Ga0116216_10162156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71374Open in IMG/M
3300009762|Ga0116130_1096845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7926Open in IMG/M
3300009839|Ga0116223_10025257All Organisms → cellular organisms → Bacteria4108Open in IMG/M
3300009839|Ga0116223_10576483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7651Open in IMG/M
3300010341|Ga0074045_10535670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7750Open in IMG/M
3300010343|Ga0074044_10296415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71064Open in IMG/M
3300010343|Ga0074044_11060499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7531Open in IMG/M
3300010364|Ga0134066_10310300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7570Open in IMG/M
3300012205|Ga0137362_10721460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis856Open in IMG/M
3300012362|Ga0137361_11504236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7595Open in IMG/M
3300012683|Ga0137398_10520177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis819Open in IMG/M
3300012923|Ga0137359_10763693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7839Open in IMG/M
3300014159|Ga0181530_10214981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71049Open in IMG/M
3300014200|Ga0181526_10828772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7582Open in IMG/M
3300014491|Ga0182014_10163601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71240Open in IMG/M
3300014492|Ga0182013_10687518All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300014498|Ga0182019_10642153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis748Open in IMG/M
3300014499|Ga0182012_10788074All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis603Open in IMG/M
3300014638|Ga0181536_10207504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7970Open in IMG/M
3300015264|Ga0137403_10689929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae882Open in IMG/M
3300017822|Ga0187802_10166998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7842Open in IMG/M
3300017929|Ga0187849_1309622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7589Open in IMG/M
3300017933|Ga0187801_10340327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7616Open in IMG/M
3300017934|Ga0187803_10006085All Organisms → cellular organisms → Bacteria4782Open in IMG/M
3300017934|Ga0187803_10298821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7642Open in IMG/M
3300017935|Ga0187848_10114269All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71217Open in IMG/M
3300017935|Ga0187848_10284665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7692Open in IMG/M
3300017943|Ga0187819_10614081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7616Open in IMG/M
3300018002|Ga0187868_1035622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2234Open in IMG/M
3300018006|Ga0187804_10292353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis709Open in IMG/M
3300018009|Ga0187884_10218110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7783Open in IMG/M
3300018016|Ga0187880_1403719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis572Open in IMG/M
3300018017|Ga0187872_10127745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71240Open in IMG/M
3300018020|Ga0187861_10284439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7712Open in IMG/M
3300018024|Ga0187881_10478348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis507Open in IMG/M
3300018025|Ga0187885_10181310All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7983Open in IMG/M
3300018026|Ga0187857_10407582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis613Open in IMG/M
3300018035|Ga0187875_10360851All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis780Open in IMG/M
3300018038|Ga0187855_10472779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7730Open in IMG/M
3300018040|Ga0187862_10605972Not Available648Open in IMG/M
3300018047|Ga0187859_10717864All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis569Open in IMG/M
3300018086|Ga0187769_10937601All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis655Open in IMG/M
3300018468|Ga0066662_10350634All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1269Open in IMG/M
3300020199|Ga0179592_10179286All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis964Open in IMG/M
3300020199|Ga0179592_10519501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7508Open in IMG/M
3300020580|Ga0210403_10064253All Organisms → cellular organisms → Bacteria → Acidobacteria2944Open in IMG/M
3300020581|Ga0210399_10626367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7888Open in IMG/M
3300021088|Ga0210404_10145441All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1238Open in IMG/M
3300021420|Ga0210394_11690146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7530Open in IMG/M
3300021433|Ga0210391_10365420All Organisms → cellular organisms → Bacteria → Acidobacteria1132Open in IMG/M
3300021477|Ga0210398_11368288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7554Open in IMG/M
3300021478|Ga0210402_10927593All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium797Open in IMG/M
3300022557|Ga0212123_10948802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7502Open in IMG/M
3300023250|Ga0224544_1028193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7787Open in IMG/M
3300025453|Ga0208455_1045985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7944Open in IMG/M
3300025474|Ga0208479_1049176All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300025505|Ga0207929_1070571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7660Open in IMG/M
3300025579|Ga0207927_1105411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7634Open in IMG/M
3300025612|Ga0208691_1149321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7526Open in IMG/M
3300025922|Ga0207646_11212653Not Available661Open in IMG/M
3300025934|Ga0207686_10298154All Organisms → cellular organisms → Bacteria1196Open in IMG/M
3300026320|Ga0209131_1157986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71134Open in IMG/M
3300026557|Ga0179587_11114097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7519Open in IMG/M
3300027591|Ga0209733_1035682All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1333Open in IMG/M
3300027591|Ga0209733_1086939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7798Open in IMG/M
3300027674|Ga0209118_1026502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71804Open in IMG/M
3300027676|Ga0209333_1131927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis674Open in IMG/M
3300027692|Ga0209530_1014333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2432Open in IMG/M
3300027729|Ga0209248_10110079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7829Open in IMG/M
3300027737|Ga0209038_10189450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7622Open in IMG/M
3300027768|Ga0209772_10297135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7512Open in IMG/M
3300027846|Ga0209180_10375524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7808Open in IMG/M
3300027854|Ga0209517_10222575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71148Open in IMG/M
3300027854|Ga0209517_10592219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7589Open in IMG/M
3300027894|Ga0209068_10725752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7583Open in IMG/M
3300027905|Ga0209415_11007132Not Available553Open in IMG/M
3300027910|Ga0209583_10091377All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300027911|Ga0209698_10638645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis815Open in IMG/M
3300028747|Ga0302219_10133476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7947Open in IMG/M
3300028792|Ga0307504_10057603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71130Open in IMG/M
3300029945|Ga0311330_10531865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7939Open in IMG/M
3300030020|Ga0311344_10091980All Organisms → cellular organisms → Bacteria3488Open in IMG/M
3300030041|Ga0302274_10216883All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis933Open in IMG/M
3300030042|Ga0302300_1147299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7680Open in IMG/M
3300030049|Ga0302191_10242152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7670Open in IMG/M
3300030051|Ga0302195_10029681All Organisms → cellular organisms → Bacteria → Acidobacteria3345Open in IMG/M
3300030520|Ga0311372_11718180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis755Open in IMG/M
3300030520|Ga0311372_12585773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7567Open in IMG/M
3300031231|Ga0170824_116176676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7654Open in IMG/M
3300031236|Ga0302324_100096868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5017Open in IMG/M
3300031247|Ga0265340_10535885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7515Open in IMG/M
3300031250|Ga0265331_10265677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7769Open in IMG/M
3300031708|Ga0310686_104832292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7614Open in IMG/M
3300031720|Ga0307469_11286655All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis694Open in IMG/M
3300031823|Ga0307478_11187610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis636Open in IMG/M
3300032160|Ga0311301_10102959All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5562Open in IMG/M
3300032205|Ga0307472_102611845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7515Open in IMG/M
3300032828|Ga0335080_12387422All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis504Open in IMG/M
3300033402|Ga0326728_10423283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1123Open in IMG/M
3300033755|Ga0371489_0047404All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2908Open in IMG/M
3300033982|Ga0371487_0159969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71113Open in IMG/M
3300033983|Ga0371488_0142288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_71267Open in IMG/M
3300034090|Ga0326723_0216495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7850Open in IMG/M
3300034124|Ga0370483_0209800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_2_59_7663Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland12.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds5.79%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.79%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil4.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.13%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.13%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog4.13%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.13%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.48%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.48%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.48%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog2.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil2.48%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.65%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.83%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002074Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1Host-AssociatedOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005938Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191EnvironmentalOpen in IMG/M
3300005950Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023250Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025505Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030049Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034090Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00NEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24748J21848_101899713300002074Corn, Switchgrass And Miscanthus RhizosphereALLAARELSFLRAGSHSMLQVTPPKAVYVPQPRPERVG*
Ga0062384_10096200913300004082Bog Forest SoilVKEAVHALLAARELSFVHVGSKSLLQVTPPKVAYVPKSRAERMRERSST*
Ga0062387_10015834413300004091Bog Forest SoilLECVIAVDEGDVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKVVYVPKNRRPERVS*
Ga0062389_10473874513300004092Bog Forest SoilKEAIHALLAARELSFVHVGSKSLLQVTPPKQVYVPKPRPQRVS*
Ga0066680_1076589513300005174SoilIHALLAARELSFVHVGSKSLLQVTPPKQAYVPKPRAERLRERSST*
Ga0070663_10000129513300005455Corn RhizosphereKEAVNALLAARELSFLRAGSHSMLQVTPPKAVYVPQPRPERVG*
Ga0066795_1002671643300005938SoilLLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVV*
Ga0066787_1013727413300005950SoilCVIAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLVQVTPPKQVYIPKNRRPERVS*
Ga0066790_1001607613300005995SoilNFVPRTRVKEAIHALLSARELSFVHAGSKSLLQVTPPKQAYVPKPRPLRVS*
Ga0075019_1111366223300006086WatershedsAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS*
Ga0075030_10015840213300006162WatershedsVAVDESEVEKFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYMPKNRRPERVG*
Ga0075030_10092643623300006162WatershedsDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKRRSERVS*
Ga0075021_1094043413300006354WatershedsNFLANFVPRTRVKEAIHALLSAREVSFVHVGSKSMVQVTPPKQVFAPKNRRPERVS*
Ga0073928_1071077413300006893Iron-Sulfur Acid SpringTRVKEAIHALLSARELSFVHVGSKSLMQLTPPKQVYVPKPRPERVS*
Ga0116133_111381923300009623PeatlandEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS*
Ga0116114_108846813300009630PeatlandNFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS*
Ga0116102_105409633300009632PeatlandALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS*
Ga0116216_1016215633300009698Peatlands SoilLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS*
Ga0116130_109684513300009762PeatlandEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS*
Ga0116223_1002525743300009839Peatlands SoilANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVG*
Ga0116223_1057648323300009839Peatlands SoilANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKRRSERVS*
Ga0074045_1053567023300010341Bog Forest SoilLLSARELSFVHVGSKSLIQVTPPKQVYVPKPRPERVG*
Ga0074044_1029641513300010343Bog Forest SoilKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS*
Ga0074044_1106049923300010343Bog Forest SoilLLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVG*
Ga0134066_1031030023300010364Grasslands SoilEVETFFSNFVPRSRVKDAINALLSARELSFVHVGKHSLLQVTPPKPAFVPRIRPQQVGS*
Ga0137362_1072146023300012205Vadose Zone SoilFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVT*
Ga0137361_1150423613300012362Vadose Zone SoilHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS*
Ga0137398_1052017723300012683Vadose Zone SoilDCVVAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS*
Ga0137359_1076369313300012923Vadose Zone SoilRELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS*
Ga0181530_1021498113300014159BogAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVG*
Ga0181526_1082877213300014200BogTRVKEAIHALLAARELSFVHVGTKSLLQVTPPKQVYIPKNRRPERVS*
Ga0182014_1016360133300014491BogTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVLKRRPERVS*
Ga0182013_1068751823300014492BogARELSFVHVGSKSLLHVTPPKQAYVPKPRPERVS*
Ga0182019_1064215323300014498FenVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPERVG*
Ga0182012_1078807423300014499BogTRVKEAIHALLAARELSFVHVGGKTLLQVTPPKQVYIPKNRRPERVS*
Ga0181536_1020750413300014638BogHALLSARELSFVHIGSKSLLQITPPRQAYVPKPRPERVT*
Ga0137403_1068992913300015264Vadose Zone SoilDQVEVEAFFSNFVPRSRVKDAINALLSARELSFVHVGKRSLLQVTPPKQAFVPRSRPQHVS*
Ga0187802_1016699823300017822Freshwater SedimentARELSFAHIGSKSLLQVTPPKQAYVPKPRPERVSG
Ga0187849_130962223300017929PeatlandLLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS
Ga0187801_1034032723300017933Freshwater SedimentIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Ga0187803_1000608563300017934Freshwater SedimentDEGEVENFLANFVPRTRVKEAIHALLSARELCFVHVGSKSLLQVTPPKQAYVPKPRPERV
Ga0187803_1029882123300017934Freshwater SedimentHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Ga0187848_1011426933300017935PeatlandVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Ga0187848_1028466513300017935PeatlandIKALLAARELSFVRMGSKSLLQVAPVREAFVLRPRGERVR
Ga0187819_1061408123300017943Freshwater SedimentFVPRSRVKESINALLSAREVSFVRVGSKSLLQVTPPKQAYVPRPRPERVGS
Ga0187868_103562213300018002PeatlandKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS
Ga0187804_1029235313300018006Freshwater SedimentENFLANFVPRTRVKEAIHALLSARELSFAHIGSKSLLQVTPPKQAYVPKPRPERVSG
Ga0187884_1021811013300018009PeatlandEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPQRVS
Ga0187880_140371913300018016PeatlandPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Ga0187872_1012774513300018017PeatlandELSFVHIGSKSLLQVTPPKLPYVHKPRAERMKKIVSE
Ga0187861_1028443923300018020PeatlandSFVPRTRVKEAVHALLSARELSFVHVGSKSLLQVTPPKQAYVLKRRPERVS
Ga0187881_1047834813300018024PeatlandVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Ga0187885_1018131023300018025PeatlandSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS
Ga0187857_1040758213300018026PeatlandNFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS
Ga0187875_1036085123300018035PeatlandEVENFLANFVPRTRVKEAIHALLSARELSFVHIGSKSLLQVTPPKQAYVPKPRPERVS
Ga0187855_1047277913300018038PeatlandAIHALLAARELSFVHVGSKSLLQVTPPKQVYIPKNRRPERVS
Ga0187862_1060597223300018040PeatlandRMKEAIHALLSARELSFVHIGSKSLLQVTPPKLPYVHKPRAERMKKIVSE
Ga0187859_1071786423300018047PeatlandCVVAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKRRSAPVS
Ga0187769_1093760123300018086Tropical PeatlandSNFVPRTRVKEAFHALLAARELSFLHVGGKSLLQVTPPRRAYIPKIVAQSG
Ga0066662_1035063433300018468Grasslands SoilDCVIAVDEGEVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPRQVYVPKNRRPERVS
Ga0179592_1017928623300020199Vadose Zone SoilVDEGEVENFLANFVPRTRVKEAIHALLSAREVSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0179592_1051950113300020199Vadose Zone SoilEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0210403_1006425313300020580SoilTRVKEAIHALLAARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0210399_1062636713300020581SoilRVKEAIHALLAARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0210404_1014544123300021088SoilNFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPRQAYVPKNRRPERVS
Ga0210394_1169014623300021420SoilLLAARELSFVHVGSKSLLQVTPPKVAYVPKNRRPERVS
Ga0210391_1036542013300021433SoilAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPVRVS
Ga0210398_1136828813300021477SoilEAIHALLSARELSFVHVGSKSLLQVTPPKVVYVPKNRRPERVS
Ga0210402_1092759323300021478SoilVDFFANFVPRTRVRESINALLSARELTFVHVGKRSLLQVTPAKQPYVPRVRPQQVGG
Ga0212123_1094880223300022557Iron-Sulfur Acid SpringVKEAIHALLSARELSFVHVGSKSLMQLTPPKQVYVPKPRPERVS
Ga0224544_102819323300023250SoilAENFLANFVPRTRVKEAIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS
Ga0208455_104598513300025453PeatlandKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVS
Ga0208479_104917613300025474Arctic Peat SoilCVVAVDEADVENFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPVRVS
Ga0207929_107057123300025505Arctic Peat SoilIHALLSARELSFVHVGSKSLVQVTPPKQVYVPKPRPERVS
Ga0207927_110541113300025579Arctic Peat SoilKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPERVS
Ga0208691_114932123300025612PeatlandTRVKEAIHALLAARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS
Ga0207646_1121265313300025922Corn, Switchgrass And Miscanthus RhizosphereEAVHALLSARELSFVHIGSKSLLQVTPPKQVYVPKNRRPERAS
Ga0207686_1029815433300025934Miscanthus RhizosphereRVKEAVNALLAARELSFLRAGSHSMLQVTPPKAVYVPQPRPERVG
Ga0209131_115798623300026320Grasslands SoilIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS
Ga0179587_1111409723300026557Vadose Zone SoilRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0209733_103568213300027591Forest SoilSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0209733_108693923300027591Forest SoilLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0209118_102650233300027674Forest SoilLLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVS
Ga0209333_113192723300027676Forest SoilNFLVNFVPRTRVKEAVHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS
Ga0209530_101433333300027692Forest SoilLTNFVPRTRVKEAIHALLSARELSFVHVGGKSLLQVTPPKQAYVPKPRPQRVS
Ga0209248_1011007913300027729Bog Forest SoilIHALLSARELSFVHVGSKSLLQVTPPKQPYVPKPRPNRVTTSS
Ga0209038_1018945013300027737Bog Forest SoilVKEAVHALLAARELSFVHVGSKSLLQVTPPKVAYVPKSRAERMRERSST
Ga0209772_1029713513300027768Bog Forest SoilTRVKESIHALLAARELSFVHVGSKSLLQVTPPKQVYMPKNRRPERVS
Ga0209180_1037552423300027846Vadose Zone SoilKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKPRAERLRERSST
Ga0209517_1022257513300027854Peatlands SoilLLSARELSFVHVGSKSLLQVTPPKQAYVPKPRPERVG
Ga0209517_1059221913300027854Peatlands SoilRVKEAIHALLSARELSFVHIGSKSLLQVTPPKQAYVPKPRPQRVS
Ga0209068_1072575223300027894WatershedsHALLSAREVSFVHVGSKSMVQVTPPKQVFAPKNRRPERVS
Ga0209415_1100713213300027905Peatlands SoilRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYLPKPRPERVG
Ga0209583_1009137713300027910WatershedsKEAIHALLSARELSFVHVGSKSLLQVTPPKEAYVPKPRPERVSRG
Ga0209698_1063864523300027911WatershedsVEKFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYMPKNRRPERVG
Ga0302219_1013347623300028747PalsaKEAIHALLSARELSFLYVGSKSLLQVTPPKQAYVPKPRPQRVM
Ga0307504_1005760313300028792SoilVKDAINALLSARELSFVHVGKRSLLQVTPPKQAFVPRTRPQQVGS
Ga0311330_1053186513300029945BogSARELSFVHVGSKSLLQVTPPKQVYIPKNRRPERVS
Ga0311344_1009198013300030020BogARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS
Ga0302274_1021688313300030041BogVDEGEVEKFLANFVPRTRVKEAIHALLSARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS
Ga0302300_114729923300030042PalsaGEVENFLANFVPRTRVKEAIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS
Ga0302191_1024215213300030049BogEAIHALLAARELSFVHVGGKTLLQVTPPKQVYIPKNRRPERVS
Ga0302195_1002968113300030051BogALLAARELSFVHVGGKTLLQVTPPKQVYIPKNRRPERVS
Ga0311372_1171818013300030520PalsaSNFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPVRVS
Ga0311372_1258577313300030520PalsaIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS
Ga0170824_11617667623300031231Forest SoilARELSFVHVGSKSLLQVTPPKVAYVPKSRAERMRERSSTS
Ga0302324_10009686843300031236PalsaFLANFVPRTRVKEAIHALLSAREVSFVLVGSKSLLQVTPPKQVYVPKPRPERVS
Ga0265340_1053588513300031247RhizosphereTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKPRPERVS
Ga0265331_1026567723300031250RhizosphereVKEAIHALLSARELSFVHVGSKSLVQVTPPKQVFIPKNRRPERVS
Ga0310686_10483229223300031708SoilLAARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVS
Ga0307469_1128665523300031720Hardwood Forest SoilETFFSNFVPRSRVKDAINGLLSARELSFVHVGKHSLLQVTPPKQAFVPRSRPQHVG
Ga0307478_1118761013300031823Hardwood Forest SoilDQQEIEVFFGNFVPRSRVKESINALLSARELSFVHVGNRSLIQITPEKEPPAPFVSRHPERAKR
Ga0311301_1010295953300032160Peatlands SoilLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQAYVPKNRRPERVG
Ga0307472_10261184513300032205Hardwood Forest SoilRVKEAINALLSARELSFVHVGKRSLLQVTPPKQAFVPRTRPQHVS
Ga0335080_1238742223300032828SoilANFVPRTKVKEAIHALLSAREFSFVHVGGKSLLQATPPKQVYVAKPRPQRVS
Ga0326728_1042328313300033402Peat SoilCVVAVEEDEVEKLLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT
Ga0371489_0047404_2746_29073300033755Peat SoilANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT
Ga0371487_0159969_2_1783300033982Peat SoilVEKLLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT
Ga0371488_0142288_2_1843300033983Peat SoilDEVEKLLANFVPRTRVKEAIHALLSARELSFVHVGSKSLLQVTPPKQVYVPKNRRPERVT
Ga0326723_0216495_708_8453300034090Peat SoilVKEAINALLSARELSFVHVTNRSLLQVTPPKEAFVPRQHRPERVS
Ga0370483_0209800_6_1493300034124Untreated Peat SoilVKEAIHALLAARELSFVHVGSKSLIQVTPPKQVYIPKNRRPERVSRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.