Metagenome Family F072229

Overview

Basic Information

• Family ID: F072229
• Family Type: Metagenome
• Number of Sequences: 121
• Average Sequence Length: 44 residues
• Representative Sequence: MSRRTLTILITILFVLLAWAFFSSERGVAGTLEWIGGWISKLFD
• Number of Associated Samples: 94
• Number of Associated Scaffolds: 121

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 78.51 %
• % of genes near scaffold ends (potentially truncated): 21.49 %
• % of genes from short scaffolds (< 2000 bps): 80.17 %
• Associated GOLD sequencing projects: 81
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (100.000 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (7.438 % of family members)
• Environment Ontology (ENVO): Unclassified (50.413 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (71.074 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 56.94%
  β-sheet: 0.00%
  Coil/Unstructured: 43.06%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 121 Family Scaffolds
PF09594	GT87	1.65
PF00005	ABC_tran	1.65
PF01757	Acyl_transf_3	0.83
PF05299	Peptidase_M61	0.83
PF04188	Mannosyl_trans2	0.83
PF01590	GAF	0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 121 Family Scaffolds
COG0308	Aminopeptidase N, contains DUF3458 domain	Amino acid transport and metabolism [E]	0.83
COG3975	Predicted metalloprotease, contains C-terminal PDZ domain	General function prediction only [R]	0.83
COG5542	Mannosyltransferase related to Gpi18	Carbohydrate transport and metabolism [G]	0.83

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	100.00 %
Unclassified	root	N/A	0.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	100.00 %
Unclassified	root	N/A	0.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	100.00 %
Unclassified	root	N/A	0.00 %

Level 4

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	85.12 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.83 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.83 %
Unclassified	root	N/A	0.00 %

Level 5

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	85.12 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.83 %
Unclassified	root	N/A	0.00 %

Level 6

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	85.12 %
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.83 %
Unclassified	root	N/A	0.00 %

Level 7

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	85.12 %
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.83 %
Unclassified	root	N/A	0.00 %

Level 8

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	85.12 %
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.83 %
Unclassified	root	N/A	0.00 %

Level 9

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	85.12 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.83 %
Unclassified	root	N/A	0.00 %

Level 10

Name	Rank	Taxonomy	Distribution
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	85.12 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.83 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.83 %
Unclassified	root	N/A	0.00 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000033|ICChiseqgaiiDRAFT_c2388555	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2005
3300001464|JGI12363J15224_100047	All Organisms → cellular organisms → Bacteria	27615
3300002568|C688J35102_120551418	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1171
3300002899|JGIcombinedJ43975_10097222	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	536
3300003203|JGI25406J46586_10015486	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3214
3300003324|soilH2_10032523	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	4079
3300004156|Ga0062589_100549091	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	988
3300004479|Ga0062595_101432670	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	632
3300005289|Ga0065704_10062240	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	648
3300005290|Ga0065712_10072281	All Organisms → cellular organisms → Bacteria	4779
3300005290|Ga0065712_10390496	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	742
3300005293|Ga0065715_10102838	All Organisms → cellular organisms → Bacteria	3081
3300005293|Ga0065715_10135150	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1942
3300005293|Ga0065715_10236408	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1215
3300005331|Ga0070670_100000114	All Organisms → cellular organisms → Bacteria	75910
3300005331|Ga0070670_100889772	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	807
3300005331|Ga0070670_101296545	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	667
3300005334|Ga0068869_100332502	All Organisms → cellular organisms → Bacteria	1235
3300005334|Ga0068869_100712581	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	857
3300005334|Ga0068869_101697323	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	564
3300005343|Ga0070687_100101279	All Organisms → cellular organisms → Bacteria	1613
3300005344|Ga0070661_101647916	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	543
3300005345|Ga0070692_10506115	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	784
3300005355|Ga0070671_100905374	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	771
3300005438|Ga0070701_10474741	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	807
3300005444|Ga0070694_101516275	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	567
3300005466|Ga0070685_11588500	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	506
3300005468|Ga0070707_100224362	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1830
3300005530|Ga0070679_100367519	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1386
3300005539|Ga0068853_102146832	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	542
3300005545|Ga0070695_100182826	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1487
3300005546|Ga0070696_100670022	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	843
3300005547|Ga0070693_100153693	All Organisms → cellular organisms → Bacteria	1459
3300005549|Ga0070704_100421768	All Organisms → cellular organisms → Bacteria	1143
3300005564|Ga0070664_100515113	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1104
3300005564|Ga0070664_101795450	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	582
3300005577|Ga0068857_100139402	All Organisms → cellular organisms → Bacteria	2192
3300005577|Ga0068857_102420124	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	516
3300005578|Ga0068854_100682919	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	885
3300005615|Ga0070702_100918214	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	687
3300005617|Ga0068859_100216800	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2001
3300005618|Ga0068864_101940213	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	595
3300005841|Ga0068863_101352511	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	719
3300005875|Ga0075293_1006444	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1241
3300005875|Ga0075293_1031832	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	710
3300005878|Ga0075297_1016259	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	766
3300006755|Ga0079222_10097418	All Organisms → cellular organisms → Bacteria	1535
3300006755|Ga0079222_10414972	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	944
3300006804|Ga0079221_10807553	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	673
3300006852|Ga0075433_10862578	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	790
3300006904|Ga0075424_102303172	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	566
3300006954|Ga0079219_10019159	All Organisms → cellular organisms → Bacteria	2496
3300007076|Ga0075435_101007704	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	727
3300009093|Ga0105240_11965269	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	608
3300009098|Ga0105245_10499221	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1233
3300009098|Ga0105245_11263346	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	787
3300009176|Ga0105242_10030629	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4296
3300009177|Ga0105248_12307750	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	613
3300009545|Ga0105237_10211027	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1942
3300010037|Ga0126304_10059528	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2339
3300010038|Ga0126315_10086915	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1771
3300010038|Ga0126315_11162725	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	523
3300010040|Ga0126308_10201363	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1279
3300010041|Ga0126312_11457733	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	507
3300010042|Ga0126314_10046635	All Organisms → cellular organisms → Bacteria	2796
3300010044|Ga0126310_10018817	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	3415
3300010044|Ga0126310_10778973	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	733
3300010044|Ga0126310_10795930	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	726
3300010047|Ga0126382_12256005	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	525
3300010396|Ga0134126_10731815	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1122
3300010399|Ga0134127_10970273	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	909
3300010399|Ga0134127_12161782	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	635
3300010400|Ga0134122_12625927	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	555
3300012212|Ga0150985_110831059	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1101
3300013100|Ga0157373_10018380	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	5090
3300013297|Ga0157378_12692214	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	550
3300013306|Ga0163162_11014244	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	939
3300013306|Ga0163162_11629799	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	736
3300014325|Ga0163163_11745380	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	683
3300015374|Ga0132255_105588889	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	532
3300018476|Ga0190274_10380207	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1359
3300025900|Ga0207710_10001283	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	12696
3300025900|Ga0207710_10701127	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	531
3300025903|Ga0207680_11282072	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	521
3300025911|Ga0207654_10037570	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2712
3300025911|Ga0207654_10068232	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2103
3300025911|Ga0207654_10442587	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	910
3300025913|Ga0207695_10911195	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	759
3300025918|Ga0207662_10195070	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1308
3300025918|Ga0207662_10773209	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	676
3300025919|Ga0207657_10732026	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	767
3300025920|Ga0207649_11397599	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	554
3300025923|Ga0207681_10039783	All Organisms → cellular organisms → Bacteria	3124
3300025925|Ga0207650_10000022	All Organisms → cellular organisms → Bacteria	318878
3300025925|Ga0207650_10524699	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	991
3300025927|Ga0207687_11374305	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	607
3300025930|Ga0207701_10244236	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1568
3300025933|Ga0207706_10404461	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1183
3300025935|Ga0207709_10068050	All Organisms → cellular organisms → Bacteria	2249
3300025935|Ga0207709_10523996	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	928
3300025938|Ga0207704_10914688	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	738
3300025941|Ga0207711_10560603	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1066
3300025941|Ga0207711_10639715	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	992
3300025941|Ga0207711_12047084	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	515
3300025961|Ga0207712_10785191	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	836
3300025981|Ga0207640_10685445	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	877
3300025981|Ga0207640_11639601	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	580
3300026005|Ga0208285_1000587	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	1661
3300026035|Ga0207703_11487288	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	652
3300026041|Ga0207639_10692746	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	945
3300026095|Ga0207676_10963261	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	839
3300026116|Ga0207674_10045025	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4541
3300026116|Ga0207674_10141524	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	2365
3300027514|Ga0208338_1000012	All Organisms → cellular organisms → Bacteria	99281
3300027718|Ga0209795_10138643	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	688
3300027775|Ga0209177_10063871	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1081
3300028380|Ga0268265_11852334	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	610
3300028381|Ga0268264_11504449	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	684
3300030511|Ga0268241_10084148	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	721
3300031548|Ga0307408_101485339	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	640
3300033412|Ga0310810_11407286	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	532

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	59.50%
Environmental	Environmental	40.50%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	59.50%
Terrestrial	Environmental → Terrestrial	40.50%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	40.50%
Rhizosphere	Host-Associated → Plants → Rhizosphere	32.23%
Rhizoplane	Host-Associated → Plants → Rhizoplane	25.62%
Roots	Host-Associated → Plants → Roots	0.83%
Phylloplane	Host-Associated → Plants → Phylloplane	0.83%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	23.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	20.66%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	19.01%
Loam	Environmental → Terrestrial → Soil → Loam	14.05%
Soil	Host-Associated → Plants → Rhizosphere → Soil	11.57%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.61%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.31%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.83%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	20.66%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	19.01%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	14.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	11.57%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	11.57%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.31%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.65%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.83%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.83%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.83%

Habitat

Habitat	Taxonomy	Distribution
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	7.44%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.44%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	7.44%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	5.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	4.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	4.13%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	4.13%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.31%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	3.31%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.31%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.31%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.65%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.65%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.83%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.83%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.83%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.83%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.83%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.83%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.83%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300001464	Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91	Environmental
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300002899	Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607)	Environmental
3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental
3300005878	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_104	Environmental
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental
3300010038	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106	Environmental
3300010040	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55	Environmental
3300010041	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A	Environmental
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300026005	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)	Environmental
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated
3300027514	Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN91 (SPAdes)	Environmental
3300027718	Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)	Host-Associated
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300030511	Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)	Environmental
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_23885552	3300000033	Soil	MSRRTLTILITIXFILLAWAFFSSEGGVAGVLEKIGGWISKLWS*
JGI12363J15224_1000474	3300001464	Soil	MSRRTLTILIVVLFILLALAFLSSEGGVAGALEWIGGWISKLFD*
C688J35102_1205514181	3300002568	Soil	MSRRTLTILITLLFVLLALAVFSSERGVAGVLEQIGAVISKFFD*
JGIcombinedJ43975_100972222	3300002899	Soil	MSRRTLTILITILFVLLAWAFFASDRGVAGTLEQIGGWISKLWS*
JGI25406J46586_100154863	3300003203	Tabebuia Heterophylla Rhizosphere	MSRRTLTILITVLFVVLAWAFFTSERGVAGVLESIGATISKLFD*
soilH2_100325233	3300003324	Sugarcane Root And Bulk Soil	MSRKTLTVLITILFVLLALTFFSSERGVAGVLEQIGAAISKLFD*
Ga0062589_1005490912	3300004156	Soil	MSRKALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA*
Ga0062595_1014326702	3300004479	Soil	VSRRTLTVIITILFILLAWTFFASDRGVLDVLERMGAAISKLFD*
Ga0065704_100622402	3300005289	Switchgrass Rhizosphere	MSRRTLTVLITLLFVLLAWAFFTSERGVAGVLESIGGTLSKLFD*
Ga0065712_100722812	3300005290	Miscanthus Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFD*
Ga0065712_103904961	3300005290	Miscanthus Rhizosphere	MSRRTLTILITLLFILLAWAFFTSERGVAGVLESIGATISKLFD*
Ga0065715_101028383	3300005293	Miscanthus Rhizosphere	MSRKTLTVLITLLFVILALAVFSSERGVAGVLETIGGAISKLFD*
Ga0065715_101351502	3300005293	Miscanthus Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFA*
Ga0065715_102364082	3300005293	Miscanthus Rhizosphere	VSRRTLTILITILFILLAWTFFASDRGLVDVLERIGAAISKLFD*
Ga0070670_10000011439	3300005331	Switchgrass Rhizosphere	MSRRTLTILITILFILLAWAFFSSERGVAGTLEEIGGWISKLWS*
Ga0070670_1008897721	3300005331	Switchgrass Rhizosphere	MSRRTLTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA*
Ga0070670_1012965452	3300005331	Switchgrass Rhizosphere	MSRRTLTILITILFVVLVWTFFASERGVAGVLESIGAAISKLFA*
Ga0068869_1003325022	3300005334	Miscanthus Rhizosphere	MSRRTLTILITILLILLAWAFFSPERGVAGALEQIGGWISKLFS*
Ga0068869_1007125812	3300005334	Miscanthus Rhizosphere	MSRRTLTILITILFVLLVWAFFSSERGVAGTLEQVGGWISKLFS*
Ga0068869_1016973232	3300005334	Miscanthus Rhizosphere	VSRRTLTILITLLFILLAWTFFSSDRGLIGVLEWLGAAISKLFD*
Ga0070687_1001012792	3300005343	Switchgrass Rhizosphere	MSRRTLTILIVILFVLLAWAFFTSERGVAGALEQIGAVISRLFD*
Ga0070661_1016479162	3300005344	Corn Rhizosphere	MSRKTLTILITILFLLLVWVFFASERGIAGTLELIGSWISKLFA*
Ga0070692_105061151	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	TLTILITILFILLAWTFFASDRGLVDVLERIGAAISKLFD*
Ga0070671_1009053742	3300005355	Switchgrass Rhizosphere	MSRRTLTILIVVLFILLAFTFFSSEGGVAGTLERIGGWISKLFD*
Ga0070701_104747411	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MSRRTLTILITVLFVVLAWAFFTSERGVAGVLESIGATISKLFA*
Ga0070694_1015162752	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	MSRRTLTILITLLFVLLAFAVFTSERGVAGVLEQIGAVISKFFD*
Ga0070685_115885001	3300005466	Switchgrass Rhizosphere	TLTILITILFVLLAWAFFSSERGVAGTLEKIGGWISKLFD*
Ga0070707_1002243622	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MSRKSLTVLIALLFVVLAFAVFSSERGVAGVLETIGGAISKLFE*
Ga0070679_1003675191	3300005530	Corn Rhizosphere	RCEESLELMSRKSLTVLIALLFVVLAFAVFSSERGVAGVLETIGGAISKLFE*
Ga0068853_1021468321	3300005539	Corn Rhizosphere	EALMSRRTLTILITILFILLAWALFVSERGLAGVLEQIGGWISKLFD*
Ga0070695_1001828262	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MSRKALTVLICLLFAVLAFAVFSSERGVAGVLEKIGGAISRLLGN*
Ga0070696_1006700222	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MSRKTLTILITILFGLLVWTFLASERGVAGTLEWIGAAISKLFA*
Ga0070693_1001536932	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	MSRRTLTILMVLLFALLVWVLFVSERGLIGVLEEIGALIAKLFN*
Ga0070704_1004217682	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MSRRTLTILITILLIMLAWAFFASERGVAGTLERIGGWISKLFT*
Ga0070664_1005151132	3300005564	Corn Rhizosphere	MSRKTLTILITILFVLLVWTFFASERGVAGTLEWIGGAISKLFA*
Ga0070664_1017954502	3300005564	Corn Rhizosphere	MSRRTLTILITILFVLLVWTFFASERGVAGVLESIGAAISKLFA*
Ga0068857_1001394022	3300005577	Corn Rhizosphere	MSRRTLTILITVLFVLLAWAFFTSERGVAGVLESIGATISKLFA*
Ga0068857_1024201241	3300005577	Corn Rhizosphere	RRTLTVLITLLFVLLALAVFSSERGVAGVLQSIGAMLSKLFD*
Ga0068854_1006829191	3300005578	Corn Rhizosphere	MSRRTLTILITILFILLAWAFFSPERGVAGALEQIGGWISKLFS*
Ga0070702_1009182142	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	TLTILIVVLFILLAFTFFSSERGVAGTLEWIGGWISKLFD*
Ga0068859_1002168003	3300005617	Switchgrass Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLWS*
Ga0068864_1019402131	3300005618	Switchgrass Rhizosphere	WEALMSRRTLTILITILFILLAWAFFSSEGGVAGVLEKIGGWISKLFSYI*
Ga0068863_1013525111	3300005841	Switchgrass Rhizosphere	MSRRTLTILITILFILLAWAFFSSERGVAGTLEWIGGWISKLFD*
Ga0075293_10064442	3300005875	Rice Paddy Soil	MSRRTLTILITILFVLLAWALFTSERGVAGVLEQIGSVLSKLFV*
Ga0075293_10318321	3300005875	Rice Paddy Soil	MRFMSRRTLTILITLLFVLLALAVYSSERGVAGVLEQIGAVISKFFD*
Ga0075297_10162591	3300005878	Rice Paddy Soil	MSRRTLTILITILFVLLAWALFTSERGVAGVLEQIGSVLS
Ga0079222_100974182	3300006755	Agricultural Soil	MSRRTLTVLIVILFALLVWMLFVSERGLTGVLEQIGALISKLFN*
Ga0079222_104149721	3300006755	Agricultural Soil	MSRKTLTILITILFILLAWVFFASERGIAGTLEQIGSWISKLFS*
Ga0079221_108075531	3300006804	Agricultural Soil	RTLTILITLLFVLLALAFFSSERGVAGVLEQIGAVISKLFD*
Ga0075433_108625782	3300006852	Populus Rhizosphere	MMSRKTLTVLIALLFAVLAFAVFSSERGVAGVLEKMGGAISK
Ga0075424_1023031721	3300006904	Populus Rhizosphere	KTLTVLITLLLIVLAFAVFSSERGVTGVLEKIGAAISKLLGN*
Ga0079219_100191592	3300006954	Agricultural Soil	MSRRTLTVLIMILFALLVWVLFVSERGLTGVLEQIGALISKLFN*
Ga0075435_1010077042	3300007076	Populus Rhizosphere	LTVLITLLLIVLAFAVFSSERGVTGVLEKIGAAISKLLGN*
Ga0105240_119652692	3300009093	Corn Rhizosphere	MSRKALTILITILFVLLAWAFFTSERGVAGVLELIGATISKLFA*
Ga0105245_104992211	3300009098	Miscanthus Rhizosphere	KALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA*
Ga0105245_112633461	3300009098	Miscanthus Rhizosphere	RTLTILITILLILLAWAFFSPERGVAGALEQIGGWISKLFS*
Ga0105242_100306293	3300009176	Miscanthus Rhizosphere	MSRRTLTILITILLVLLAWAFFSSERGVAGALEQIGGWISKLFS*
Ga0105248_123077501	3300009177	Switchgrass Rhizosphere	MSRRTLTILITLLFVLLAFAVFTSERGVAGVLEQI
Ga0105237_102110272	3300009545	Corn Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLELIGSWISKLFA*
Ga0126304_100595283	3300010037	Serpentine Soil	MSRRTLTILIAVLIILLALALFTSERDVAGVLEQIGSLLSKLFD*
Ga0126315_100869152	3300010038	Serpentine Soil	MSRRTLTVLITILFVLLGLAVLSSERGVAGVLESIGRTISKLFD*
Ga0126315_111627252	3300010038	Serpentine Soil	MSRRTLTILILVLFILLALTFLSSEGGVAGALEKIGGWISKLFD*
Ga0126308_102013631	3300010040	Serpentine Soil	MSRRTLTILIAVLFILLALALFTSERDVAGVLEQIGSVLSKLFD*
Ga0126312_114577332	3300010041	Serpentine Soil	MSRKTLTILITLLFVLLALAFFSDERGVAGVLEKIGGTISKLFD*
Ga0126314_100466353	3300010042	Serpentine Soil	MSRRTLTILIVVLFILLALTFLSSEGGVAGALEKIGGWISKLFD*
Ga0126310_100188173	3300010044	Serpentine Soil	MSRRTLTILIAVLFILLALALFTSERDVAGVLEYIGSVLSRLFN*
Ga0126310_107789732	3300010044	Serpentine Soil	MSRRTLTILIALLFIALAFAVFASERGVSGVLEKIGTYISRLVD*
Ga0126310_107959302	3300010044	Serpentine Soil	MSRRTLTILITILFGLLALALFSSERGVAGVLETIGKTISKLFDYL*
Ga0126382_122560051	3300010047	Tropical Forest Soil	MSRKGLTVLITLLFVVLAFAVFSSERGVAGVLEKIGGAISKLLGN*
Ga0134126_107318152	3300010396	Terrestrial Soil	MSRRTLTILIVVLFALLVWVLFVSERGLIGVLEEIGALIAKLFN*
Ga0134127_109702732	3300010399	Terrestrial Soil	MLSINAMSRKTLTVAIILLFVILAFAVFSSERGVAGVLEKIGGAISKLFD*
Ga0134127_121617821	3300010399	Terrestrial Soil	MSRRTLTILIVILFALLAWAFFSSERGVAGVLEQIGAVISKLFD*
Ga0134122_126259272	3300010400	Terrestrial Soil	SRRTLTILITVLFVLLAWAFFTSERGVAGVLESIGATISKLFA*
Ga0150985_1108310592	3300012212	Avena Fatua Rhizosphere	MSRKTLTIIITILFILLVWVFFASERGIAGTLELIGSWISKLFA*
Ga0157373_100183802	3300013100	Corn Rhizosphere	MSRRTLTILIVVLFALLVWVLFVSERGLIGVLEQIGALIAKLFD*
Ga0157378_126922141	3300013297	Miscanthus Rhizosphere	MSRRTLTNLIVILFVLLAWAFFTSERGVAGALEQIGAVISRLFD*
Ga0163162_110142442	3300013306	Switchgrass Rhizosphere	MSRRTLTILITLLFVLLALAFFSSERGVAGVLEQI
Ga0163162_116297991	3300013306	Switchgrass Rhizosphere	VSRRTLTILITILFILLAWTFFSSDRGLIGVLEWLGAAISKLFD*
Ga0163163_117453802	3300014325	Switchgrass Rhizosphere	MSRRTLTILIAILFILLAWAFFSSEGGVAGALEWIGGWISKLFD*
Ga0132255_1055888891	3300015374	Arabidopsis Rhizosphere	MSRKALTVLITLLFLVLAFAVFSSERGVAGVLEKIGGAISKLLGN*
Ga0190274_103802073	3300018476	Soil	MSRRTLTILIALLFALLALAVFSSERGVAGVLEQIGGALSKFFDKYGTRG
Ga0207710_100012838	3300025900	Switchgrass Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFA
Ga0207710_107011272	3300025900	Switchgrass Rhizosphere	SRRTLTILITLLFVLLALAVFSSERGVAGVLEQIGAVISKFFD
Ga0207680_112820722	3300025903	Switchgrass Rhizosphere	MSRRTLTILITILFVLLAWAFFASDRGVAGTLEQIGGWISKLFD
Ga0207654_100375703	3300025911	Corn Rhizosphere	MSRRTLTILITILLVLLAWAFFSSERGVAGALEQIGGWISKLFS
Ga0207654_100682322	3300025911	Corn Rhizosphere	MSRKSLTVLIALLFVVLAFAVFSSERGVAGVLETIGGAISKLFE
Ga0207654_104425871	3300025911	Corn Rhizosphere	MSRRTLTILITVLFVLLAWAFFTSERGVAGVLESIGATISKLF
Ga0207695_109111952	3300025913	Corn Rhizosphere	MSRKTLTILITILFGLLVWTFLASERGVAGTLEWIGAAISKLFA
Ga0207662_101950702	3300025918	Switchgrass Rhizosphere	MSRRTLTILIVILFVLLAWAFFTSERGVAGALEQIGAVISRLFD
Ga0207662_107732092	3300025918	Switchgrass Rhizosphere	MSRRTLTILITVLFVVLAWAFFTSERGVAGVLESIGATISKLFD
Ga0207657_107320263	3300025919	Corn Rhizosphere	MSRRTLTILITLLFVLLALAVFSSERGVAGVLEQIGAVISKFFD
Ga0207649_113975992	3300025920	Corn Rhizosphere	MSRKTLTILITILFLLLVWVFFASERGIAGTLELIGSWISKLFA
Ga0207681_100397833	3300025923	Switchgrass Rhizosphere	MSRRTLTILITILFILLAWAFFSPERGVAGALEQIGGWISKLFS
Ga0207650_10000022174	3300025925	Switchgrass Rhizosphere	MSRRTLTILITILFILLAWAFFSSERGVAGTLEEIGGWISKLWS
Ga0207650_105246992	3300025925	Switchgrass Rhizosphere	MSRRTLTVLITLLFVLLALAVFSSERGVAGVLQSIGAMLSKLFD
Ga0207687_113743052	3300025927	Miscanthus Rhizosphere	MSRRTLTILITILLVLLAWAFFSSERGVAGVLEQIGGWISKLFT
Ga0207701_102442363	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MSRRTLTILITILFVLLAWAFFSSERGVAGTLEWIGGWISKLFD
Ga0207706_104044612	3300025933	Corn Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLELIGSWISKLFA
Ga0207709_100680502	3300025935	Miscanthus Rhizosphere	MSRKALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFA
Ga0207709_105239961	3300025935	Miscanthus Rhizosphere	MSRKALTVLICLLFAVLAFAVFSSERGVAGVLEKIGGAISRLL
Ga0207704_109146882	3300025938	Miscanthus Rhizosphere	MSRRTLTILITILFVLLAWAFFSSERGVAGTLEKI
Ga0207711_105606032	3300025941	Switchgrass Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLEQIGGWISKLFD
Ga0207711_106397152	3300025941	Switchgrass Rhizosphere	MSRRTLTILITILFILLAWAFFSSERGVAGTLEWIGGWISKLFD
Ga0207711_120470842	3300025941	Switchgrass Rhizosphere	MSRRTLTILITLFFILLALTFFSSERGVAGVLEQIGA
Ga0207712_107851912	3300025961	Switchgrass Rhizosphere	MSRRTLTILITLLFVLLAWAFFTSERGVAGVLESIGATISKLFD
Ga0207640_106854452	3300025981	Corn Rhizosphere	MSRRTLTILMVLLFALLVWVLFVSERGLIGVLEEIGALIAKLFN
Ga0207640_116396012	3300025981	Corn Rhizosphere	MSRKTLTILITILFLLLVWVFFASERGIAGTLELIGGWISKLFA
Ga0208285_10005873	3300026005	Rice Paddy Soil	MSRRTLTILITILFVLLAWALFTSERGVAGVLEQIG
Ga0207703_114872882	3300026035	Switchgrass Rhizosphere	MSRKALTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFD
Ga0207639_106927462	3300026041	Corn Rhizosphere	MSRKTLTILITILFILLVWVFFASERGIAGTLELIGS
Ga0207676_109632612	3300026095	Switchgrass Rhizosphere	MSRRTLTILITILFILLAWAFFSSEGGVAGVLEKIGGWISKLFSYI
Ga0207674_100450252	3300026116	Corn Rhizosphere	MSRRTLTILITLLFILLAWAFFTSERGVAGVLESIGATISKLFD
Ga0207674_101415243	3300026116	Corn Rhizosphere	MSRKTLTILITILFVLLVWTFFASERGVAGTLEWIGGAISKLFA
Ga0208338_100001232	3300027514	Soil	MSRRTLTILIVVLFILLALAFLSSEGGVAGALEWIGGWISKLFD
Ga0209795_101386432	3300027718	Agave	ITLLFVLLALAIFSSERGVQGVLEKIGDVISKLFV
Ga0209177_100638712	3300027775	Agricultural Soil	MSRRTLTVLIMILFALLVWVLFVSERGLTGVLEQIGALISKLFN
Ga0268265_118523342	3300028380	Switchgrass Rhizosphere	MSRRTLTILIVVLFILLALAFLSSERGVAGTLEWIGGWI
Ga0268264_115044492	3300028381	Switchgrass Rhizosphere	MSRRTLTILITILFVLLAWAFFTSERGVAGVLESIGATISKLFD
Ga0268241_100841482	3300030511	Soil	MSRRTLTILIVLFFVLLALAIFSSERGIAGVLEQIGALISKLFD
Ga0307408_1014853392	3300031548	Rhizosphere	MSRRTLTVLITLLFILLALAVLSSERGVAGVLEWIGATLSKLFD
Ga0310810_114072862	3300033412	Soil	MSRRTLTILIVVLFILLAFAFFSSEGGVAGTLEWIGGWISKLFD