Basic Information | |
---|---|
Family ID | F072145 |
Family Type | Metagenome |
Number of Sequences | 121 |
Average Sequence Length | 45 residues |
Representative Sequence | MTDYTKLLLPRFRYGVIHPRAHEDVQRGPCYQLYRLVPKDFME |
Number of Associated Samples | 114 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 4.13 % |
% of genes from short scaffolds (< 2000 bps) | 4.13 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (95.868 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (9.917 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.364 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.86% β-sheet: 14.08% Coil/Unstructured: 76.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF01266 | DAO | 10.74 |
PF13472 | Lipase_GDSL_2 | 5.79 |
PF04909 | Amidohydro_2 | 4.13 |
PF00753 | Lactamase_B | 4.13 |
PF13379 | NMT1_2 | 3.31 |
PF00561 | Abhydrolase_1 | 3.31 |
PF02775 | TPP_enzyme_C | 2.48 |
PF01741 | MscL | 2.48 |
PF04014 | MazE_antitoxin | 2.48 |
PF04366 | Ysc84 | 1.65 |
PF03446 | NAD_binding_2 | 1.65 |
PF02798 | GST_N | 1.65 |
PF00271 | Helicase_C | 1.65 |
PF00117 | GATase | 1.65 |
PF09084 | NMT1 | 1.65 |
PF00355 | Rieske | 1.65 |
PF01844 | HNH | 0.83 |
PF06779 | MFS_4 | 0.83 |
PF12697 | Abhydrolase_6 | 0.83 |
PF13531 | SBP_bac_11 | 0.83 |
PF09594 | GT87 | 0.83 |
PF14686 | fn3_3 | 0.83 |
PF13416 | SBP_bac_8 | 0.83 |
PF02776 | TPP_enzyme_N | 0.83 |
PF03241 | HpaB | 0.83 |
PF13714 | PEP_mutase | 0.83 |
PF03473 | MOSC | 0.83 |
PF00903 | Glyoxalase | 0.83 |
PF01896 | DNA_primase_S | 0.83 |
PF13519 | VWA_2 | 0.83 |
PF04365 | BrnT_toxin | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 2.48 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.65 |
COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 1.65 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.65 |
COG2368 | Aromatic ring hydroxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.83 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 95.87 % |
All Organisms | root | All Organisms | 4.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_104318115 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300004070|Ga0055488_10061028 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300009094|Ga0111539_10462864 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
3300015373|Ga0132257_100096057 | Not Available | 3402 | Open in IMG/M |
3300018056|Ga0184623_10239034 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300033483|Ga0316629_11496137 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.26% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.44% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.13% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.13% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 3.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.48% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.48% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.48% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.65% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.65% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.65% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.65% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.65% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.83% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.83% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.83% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.83% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005185 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPB | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300024058 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024516 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025149 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 (SPAdes) | Environmental | Open in IMG/M |
3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025174 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026063 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_08800021 | 2228664021 | Soil | MTNYVQKLLPRFRYGVIQPRAHEEVQRARSYQLYRLL |
F14TC_1012664062 | 3300000559 | Soil | MADPIEKLLPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVMEIST |
JGI11643J11755_117011121 | 3300000787 | Soil | MTNYVQKLLPRFRYGVIQPRAHEEVQRARSYQLYRLLPLDFM |
JGI1027J12803_1043181153 | 3300000955 | Soil | MTDYVKKFMPRFRYGVIQPRAHEDVQRGRSYQLYRL |
JGI10216J12902_1006151862 | 3300000956 | Soil | MANPIEKILPRFRYGVIHPRANEEFQRGPGYQLYRLVPLDVMEISTGL |
JGIcombinedJ13530_1098272442 | 3300001213 | Wetland | MTDYAKLLLPRFRYGVIHPRAHEDVQRGPCYQLYRLVPNDFMEIS |
C687J26623_101790532 | 3300002122 | Soil | MSDHIKKMLPRFRYGVIHPRAHEALQRGPGYQLYRLVPLDVMELA |
C687J26631_101294371 | 3300002124 | Soil | MSDHIITMLPRFRYGVIHPRAHEALQRGPGYQLYRLVPLDVMELATGLGLENY |
Ga0055435_101502981 | 3300003994 | Natural And Restored Wetlands | MSDHIKKILPRFRYGVIHPRAHEALQRGPGYQLYRLVPLDVMELATGLGLEN |
Ga0055488_100610282 | 3300004070 | Natural And Restored Wetlands | MVDHRDRILPRFRYGVIHPRANEGVQRGPGYQLYRLVPLEIMEISTGLGLENYTSEGVEKAIAN |
Ga0063356_1017717602 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSDHVKSFLPRFRYGMIHPRSHEGRARGAGYQFYRLVPLDVMEFSAVLGISNY |
Ga0062383_103708473 | 3300004778 | Wetland Sediment | MTDHVKKFLPRFRYGMIQPRSHENRQRGSGYQFYRLVPLDVMECSAVLGIGNYTL |
Ga0068993_103179111 | 3300005183 | Natural And Restored Wetlands | MADHVKNFLPRFRYGMIHPRSHEGRNRGAGYQFYRLVPLDIMEVASVLGITNYTLE |
Ga0066811_10304911 | 3300005185 | Soil | MADPTEKLLPRFRYGVIHPRGNEEFQRGPAYQLYRLVPLDVMEISTGL |
Ga0070697_1010321112 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDYVKQIMPRFRYGQIQPRANEAVSRGRSYQLYRLLPLDFM |
Ga0070697_1021320401 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTDYTKRLLPRFRYGVIQPRAHEDVQRARSYQLYRLVPLDFMEIST |
Ga0070696_1009102981 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VNQYATTLIPRFRYGVIHPRSHDSLDRGPGYQFYRLVPLDVME |
Ga0068863_1016421172 | 3300005841 | Switchgrass Rhizosphere | MADPVQSFLPRFRYGMIQPRSHEGRQRGAGYQFYRLVPLDVMEFSSVLGIENYT |
Ga0081538_101794551 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MVDPAQKMLPRFRYGVIHPRANEKVQRGPAYQFYRLVPLYVMEIATGLGLENYTPE |
Ga0075417_106993591 | 3300006049 | Populus Rhizosphere | MADHVKNFLPRFRYGMIHPRSHEDRARGVGYQFYRLVPLDVM |
Ga0066659_100395391 | 3300006797 | Soil | MNDSTNNLLPRFRYGVIHPRGHEGVQRGPGYQFYRLVPLDVMEIS |
Ga0075420_1000510434 | 3300006853 | Populus Rhizosphere | MADPTEKILPRFRYGVIHPRANEEFQRGPAYQLYR |
Ga0075424_1009537491 | 3300006904 | Populus Rhizosphere | MMDDHTKKILPRFRYGVIHPRSHESLERGPGYQFYRLVPTDVMELATS |
Ga0079216_106674711 | 3300006918 | Agricultural Soil | MTDYVKKLLPRFRYGVIQPRAHEEVQRARSYQLYRLLPL |
Ga0075419_104630702 | 3300006969 | Populus Rhizosphere | MTDHVKNFLPRFRYGMIHPRSHEGRNRGAGYQFYRLVPLEVMEFSAVLGI |
Ga0066710_1008229961 | 3300009012 | Grasslands Soil | MADHIKSFLPRFRYGMIHPRSHEDRARGAGYQFYR |
Ga0105095_101424871 | 3300009053 | Freshwater Sediment | MADYISKLLPRFRYGVIQPRANEEVSRARSYQLYKL |
Ga0111539_104628641 | 3300009094 | Populus Rhizosphere | MADPTEKILPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVMEISTGLGLENYTREG |
Ga0066709_1024839981 | 3300009137 | Grasslands Soil | MADPTERILPRFRYGVIHPRANEEFQRGPGYQLYRLVPLDVMEISTGL |
Ga0114129_106940422 | 3300009147 | Populus Rhizosphere | MPDYIKKLLPRFRYGVIQPRAHEDVHRGRTYQLYRLLPLDFME |
Ga0114129_129373952 | 3300009147 | Populus Rhizosphere | MSDYTKKLLPRFRYGVIQPRAHEDVHRGRTYQLYRLLPLDFMEIA |
Ga0075423_101759733 | 3300009162 | Populus Rhizosphere | MADPTEKILPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVMEIS |
Ga0075423_117450611 | 3300009162 | Populus Rhizosphere | MMTDYTKKLLPRFRYGVIQPRANEEVQRARSYQLY |
Ga0105242_133317081 | 3300009176 | Miscanthus Rhizosphere | VNQKGAFPMTDYVKKFMPRFRYGVIQPRAHEDVQRGRSYQLYRLLPLD |
Ga0114945_104867031 | 3300009444 | Thermal Springs | MDEQARKMLPRFRYGVIHPRSTGGLLRGPGYQLYRLVPLDVM |
Ga0105249_130847592 | 3300009553 | Switchgrass Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHADVQRARSYQLYRLVPLDFMEI |
Ga0114944_14933091 | 3300009691 | Thermal Springs | MDEQARKMLPRFRYGVIHPRSTGGLLRGPGYQLYRL |
Ga0126309_108677901 | 3300010039 | Serpentine Soil | MTDHIKNFLPRFRYGMIQPRSHENRQRGSGYQFYRLVPLDVMECSAVLGIENYTLEAVEKAL |
Ga0126382_102671561 | 3300010047 | Tropical Forest Soil | MDNHTKKLVPRFRYGVIHPRSHEDLDRGPGYQFYRLVPLEVMELATSLGLENYT |
Ga0126376_102126731 | 3300010359 | Tropical Forest Soil | MDNHTKKLVPRFRYGVIHPRSHEDLDRGPGYQFYRLVPLEVMELATSLG |
Ga0126377_129897821 | 3300010362 | Tropical Forest Soil | MADPIAKLLPRFRYGVIHPRANEEFQRGPAYQLYRLVPPDVMEIST |
Ga0126379_108712851 | 3300010366 | Tropical Forest Soil | MTDHVKNFLPRFRYGMIQPRSHEDRHRGAGYQFYRLVPLDVMQFSAVLGIENYTLAAVEKAL |
Ga0137323_10239572 | 3300011409 | Soil | MVDHVKNFLPRFRYGMIHPRSHEGRNRGAGYQFYRLVPLDVMEVASVLGITNYTL |
Ga0137323_11127021 | 3300011409 | Soil | LLEKLEEHMTDHVKNFMPRYRYGMIHPRSHEGRNRGAGYQFYRLVPLDVMEVASVLGITNYTL |
Ga0120191_100876502 | 3300012022 | Terrestrial | MADPIEKIMPRFRYGVIHPRANEEFQRGPAYQLYRL |
Ga0137338_11289702 | 3300012174 | Soil | MNDHVQKLLPRFRYGVIQPRAHEEVQRARSYQLYRLLPLDF |
Ga0137334_10389871 | 3300012179 | Soil | MADPVKSFLPRFRYGMIHPRSHENRQRGAGYQFYRLVPLDVMEFSATLGLENYT |
Ga0137382_107900412 | 3300012200 | Vadose Zone Soil | MTNSGNKLLPRFRYGSIRPRGHEDLQRGPGYQFYQMVPL |
Ga0137376_111713711 | 3300012208 | Vadose Zone Soil | MTDSGNKLLPRFRYGSIRPRGHEDLQRGPGYQFYQMVPLDVM |
Ga0137379_108270581 | 3300012209 | Vadose Zone Soil | MADPIERILPRFRYGVIHPRANEEFQRGPGYQLYRLVPLDV |
Ga0137378_104378283 | 3300012210 | Vadose Zone Soil | MADHIKSFLPRFRYGMIHPRSHEDRARGAGYQFYRLVPLDVM |
Ga0137377_113329041 | 3300012211 | Vadose Zone Soil | MADPTERILPRFRYGVIHPRANEEFQRGPGYQLYRLVPLDVMEISTGLGLENY |
Ga0137366_101143281 | 3300012354 | Vadose Zone Soil | MADHIKSFLPRFRYGMIHPRSHEDRARGAGYQFYRLVPLDVMEFSAVL |
Ga0137369_100306323 | 3300012355 | Vadose Zone Soil | MTDYVKNFMPRFRYGVIQPRAHEDVQRGRSYQLYRLLPLDFMEIA |
Ga0157326_10914272 | 3300012513 | Arabidopsis Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEEVQRARSYQLYRLLPLDFM |
Ga0137419_112753461 | 3300012925 | Vadose Zone Soil | MTDYVKKFMPRFRYGVIQPRAHEDIQRGRSYQLYRLLPLD |
Ga0137404_115093431 | 3300012929 | Vadose Zone Soil | MADPTEELLPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVME |
Ga0164303_106461832 | 3300012957 | Soil | MADPTEKLLPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVMEIS |
Ga0126369_126673902 | 3300012971 | Tropical Forest Soil | MDNHTKKFVPRFRYGVIHPRSHEDLDRGPGYQFYRLVPLEVMELATSLGLENYTPEGVEK |
Ga0134075_104101102 | 3300014154 | Grasslands Soil | MNDSTNNLLPRFRYGVIHPRGHEGVQRGPGYQFYRLVPLDVMEISTGLG |
Ga0075309_11516541 | 3300014268 | Natural And Restored Wetlands | MTDYVQKLLPRYRYGVIQPRAHEDVQRARSYQLYRLLPLDFIEIST |
Ga0180078_10136113 | 3300014865 | Soil | MADHVKSFMPRFRYGMIHPRSHEGRQRGAGYQFYRLVPLVVMEFFAVLGIFNYTLDAVEKAL |
Ga0180064_10608981 | 3300014876 | Soil | MADPVESFLPRFRYGMIHPRSHENRQRGAGYQFYRLVPLDVMEFSATLGLENYTPEGVEK |
Ga0180104_10743151 | 3300014884 | Soil | MADHVKSFMPRFRYGMIHPRSHEGRQRGAGYQFYRLVPLDVMEF* |
Ga0137409_106583362 | 3300015245 | Vadose Zone Soil | MADPTEKLLPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVMEISTGLGLENYTPEGVEK |
Ga0132256_1018569512 | 3300015372 | Arabidopsis Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEEVQRARSYQLYRLLPLEF |
Ga0132257_1000960571 | 3300015373 | Arabidopsis Rhizosphere | MTDYIKKFMPRFRYGVIQPRAHEDVQRGRSYQLYRLLPLDFMEISTGL |
Ga0132255_1000416851 | 3300015374 | Arabidopsis Rhizosphere | MTDYIKKFMPRFRYGVIQPRAHEDVQRGRSYQLYRLLPLDFM |
Ga0184634_104050331 | 3300018031 | Groundwater Sediment | MADHVKNFLPRFRYGMIHPRSHEGRNRGAGYQFYRLVPLDVMEFSAV |
Ga0184638_10623542 | 3300018052 | Groundwater Sediment | MADPIERILPRFRYGVIHPRANEEFQRGPGYQLYGLVP |
Ga0184623_102390341 | 3300018056 | Groundwater Sediment | MTDYVKKLMPRFRYGVIQPRAHEDVQRGRSYQLYRLLPLDFMEISTGL |
Ga0184619_103540361 | 3300018061 | Groundwater Sediment | MTDYVKKFMPRFRYGVIQPRAHEDIQRGRSYQLYR |
Ga0184617_10804942 | 3300018066 | Groundwater Sediment | MTDYVKKIMPRFRYGQIQPRANETVSRGRSYQLYRLLPLDF |
Ga0184635_102178452 | 3300018072 | Groundwater Sediment | MTNYIEKLVPRFRYGVIHPRANEPVQRGPTYQLYRLIPLDVMEIATGLGLENYT |
Ga0184640_100381801 | 3300018074 | Groundwater Sediment | MDKYVQKLLPRFRYGVIHPRANEPVQRGPTYQLYRLIPLDVMEIATGLGL |
Ga0184632_101538702 | 3300018075 | Groundwater Sediment | MADPIERILPRFRYGVIHPRANEEFQRGPGYQLYRLVPLDVMEISTGLGLDNYTPEGVEK |
Ga0184612_103262932 | 3300018078 | Groundwater Sediment | MTNYIEKLVPRFRYGVIHPRANEPVQRGPTYQLYRLIPLDVMEIA |
Ga0190265_119142912 | 3300018422 | Soil | MSDHVKSFMPRFRYGVIHPRSHEGRARGAGYQFYRLVPLDVMEFSAVLGITNY |
Ga0190272_127478001 | 3300018429 | Soil | MSDHVKSFLPRFRYGMIHPRSHEGRNRGAGYQFYRLVPLDVMEFSAVL |
Ga0066669_115231262 | 3300018482 | Grasslands Soil | MTDSGNKLLPRFRYGSIRPRGHEDLQRGPGYQFYQMVPLDVMEVS |
Ga0193713_11371601 | 3300019882 | Soil | MTDYVKKLLPRFRYGVIQPRAHEEVQRARSYQLYRLLPLDF |
Ga0210380_104905011 | 3300021082 | Groundwater Sediment | MSDHVKSFLPRFRYGVIHPRSHEGRARGAGYQFYRLVPLDVMEFSAVLGI |
Ga0222623_104192792 | 3300022694 | Groundwater Sediment | MSDHVKSFLPRFRYGMIHPRSHEGRNRGAGYQFYR |
Ga0209997_103642331 | 3300024058 | Deep Subsurface | VDDATKKLLPRFRYGVIHPRSAEGLQRGPGYQLYRLVPVDIME |
Ga0209980_101919432 | 3300024516 | Deep Subsurface | VDDATKKLLPRFRYGVIHPRSAEGLQRGPGYQLYRL |
Ga0209827_103904081 | 3300025149 | Thermal Springs | MADPVKNFLPRFRYGVIHPRSHENRQRGAGYQFYRLV |
Ga0209399_102383993 | 3300025157 | Thermal Springs | MDEQARKMLPRFRYGVIHPRSTGGLLRGPGYQLYRLVPLD |
Ga0209521_101199831 | 3300025164 | Soil | MDDFAKKILPRFRYGVIHPRAHEDLQRGPGYQLYRLVPL |
Ga0209324_102058522 | 3300025174 | Soil | MSDHIITMLPRFRYGVIHPRAHEALQRGPGYQLYRLV |
Ga0209640_109063823 | 3300025324 | Soil | MADHVKNFLPRFRYGMIRPRAQEGGNRGAGYQFYRLVPLDVMEFSAVI |
Ga0207688_109946441 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEEVQRARSYQLY |
Ga0207680_102215501 | 3300025903 | Switchgrass Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEDVQRARSYQLYRLVPLDFMEI |
Ga0207685_106098942 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEEVQRARSYQLYR |
Ga0207684_109170762 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDYVKQIMPRFRYGQIQPRANEAVSRGRSYQLYRLLPLDF |
Ga0207649_113111522 | 3300025920 | Corn Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEDVQRARSYQLYRLLPLD |
Ga0207667_102371321 | 3300025949 | Corn Rhizosphere | MTTDYTKKLLPRFRYGVIQPRAHEDVQRARSYQLYRLVPLDFME |
Ga0207651_120428691 | 3300025960 | Switchgrass Rhizosphere | VNQYATTLIPRFRYGIIHPRSHESLDRGPGYQFYRLVPLDVLEV |
Ga0208656_10111572 | 3300026063 | Natural And Restored Wetlands | MADHRDRILPRFRYGVIHPRANEGVQRGPGYQLYRLVPLEIME |
Ga0207641_113366991 | 3300026088 | Switchgrass Rhizosphere | MADPVQSFLPRFRYGMIQPRSHEGRQRGAGYQFYRLVPLDVMEFSSVLGIENYTLAA |
Ga0209802_12767951 | 3300026328 | Soil | MNDSTNNLLPRFRYGVIHPRGHEGVQRGPGYQFYRLVPLDVMEISTGLGLEN |
Ga0208685_10090214 | 3300027513 | Soil | MADPVESFLPRFRYGMIHPRSHENRQRGAGYQFYRLVP |
Ga0208685_10391171 | 3300027513 | Soil | MTDHVKSFLPRFRYGVIHPRSHEGRARGAGYQFYRLVPLDVMEFSAVLGISNY |
Ga0209819_100276533 | 3300027722 | Freshwater Sediment | MDKYVQKLLPRFRYGVIHPRANEPLQRGPTYQLYRLIPL |
Ga0209683_100647761 | 3300027840 | Wetland Sediment | MTDYAKLLIPRFRYGVIHPRAHEDVQRGPCYQLYRLVP |
Ga0209814_103230962 | 3300027873 | Populus Rhizosphere | MTDHVKSFLPRFRYGMIHPRSHEDRARGAGYQFYRLVPLDVMEFSAVLGITNYTLE |
Ga0209814_104768821 | 3300027873 | Populus Rhizosphere | MTDFTKKLMPRFRYGVIHPRAHEDLQRGPGYQLYRLVPLDIMELATGLG |
Ga0209481_104188152 | 3300027880 | Populus Rhizosphere | MADPTEKILPRFRYGVIHPRANEEFQRGPAYQLYRLVPLDVME |
Ga0209705_105932991 | 3300027979 | Freshwater Sediment | MTDYVKKLLPRFRYGVIQPRAHEVVQRSRSYQLYRLLPLDF |
Ga0299913_102864444 | 3300031229 | Soil | MTDYVQKLLPRFRYGVIQPRSHEDVQRARSYQLYR |
Ga0307473_104501582 | 3300031820 | Hardwood Forest Soil | MENHTNRLLPRFRYGVIHPRSHEELDRGPGYQFYRLVPLEVME |
Ga0307412_118295931 | 3300031911 | Rhizosphere | MTDYTKLLLPRFRYGVIHPRAHEDVQRGPCYQLYRLVPKD |
Ga0310912_104501732 | 3300031941 | Soil | MAKQAHTLLPRFRYGVIHPRAHEDVQRGPGYQFYRLVPLDVMEISTGLGL |
Ga0306926_119276312 | 3300031954 | Soil | MADPLEKIMPRLRYGVIHPRANEEFQRGPGYQLYRLVPLD |
Ga0306924_102520513 | 3300032076 | Soil | MAKQAHTLLPRFRYGVIHPRAHEDVQRGPGYQFYRLVPLDVMEI |
Ga0307415_1014247491 | 3300032126 | Rhizosphere | MTDYTKLLLPRFRYGVIHPRAHEDVQRGPCYQLYRLVPKDFME |
Ga0307470_104519841 | 3300032174 | Hardwood Forest Soil | MTDFTKKFMPRFRYGVIQPRAHEDVQRGRSYQLYRLLPL |
Ga0214471_110031972 | 3300033417 | Soil | MDNYTKTLVPRFRYGVIHPRSGEGLQRGPGYQLYRL |
Ga0214471_113614172 | 3300033417 | Soil | MADHVKSFMPRFRYGTIHPRSHEGRQRGAGYQFYRLVPLDVMEFSAVLGI |
Ga0316629_114961372 | 3300033483 | Soil | MTDYAKLLMPRFRYGVIHPRAHEDLQRGPCYQLYRLVPNDFMEISTGLGL |
Ga0247830_100406931 | 3300033551 | Soil | MTDYVNKLLPRFRYGVIQPRAYEEVQRARSYQLYR |
Ga0364925_0051176_1240_1401 | 3300034147 | Sediment | MADHVKSFIPRFRYGVIHPRSHEGRQRGAGYQFYRLVPLDVMEFSAVLGISNYT |
⦗Top⦘ |