Basic Information | |
---|---|
Family ID | F072120 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 121 |
Average Sequence Length | 40 residues |
Representative Sequence | LTLSAGHAVTYFTSPTTIVYELILDDLVYGTLDAENVLG |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 13.22 % |
% of genes from short scaffolds (< 2000 bps) | 12.40 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (86.777 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.314 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.934 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (43.802 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.99% Coil/Unstructured: 97.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF01464 | SLT | 2.48 |
PF16778 | Phage_tail_APC | 1.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 86.78 % |
All Organisms | root | All Organisms | 13.22 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004126|Ga0066179_10011744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
3300005805|Ga0079957_1203037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
3300006802|Ga0070749_10085634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1878 | Open in IMG/M |
3300007214|Ga0103959_1140502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1592 | Open in IMG/M |
3300009149|Ga0114918_10181805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300009149|Ga0114918_10202331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
3300009161|Ga0114966_10127691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1678 | Open in IMG/M |
3300021376|Ga0194130_10245393 | All Organisms → Viruses → Predicted Viral | 1027 | Open in IMG/M |
3300024262|Ga0210003_1102912 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
3300024262|Ga0210003_1148756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1006 | Open in IMG/M |
3300031566|Ga0307378_10235656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1772 | Open in IMG/M |
3300032116|Ga0315903_11189909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300034072|Ga0310127_143654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 953 | Open in IMG/M |
3300034095|Ga0335022_0029352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3640 | Open in IMG/M |
3300034102|Ga0335029_0163543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1512 | Open in IMG/M |
3300034166|Ga0335016_0162893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1502 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.31% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.57% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.09% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 8.26% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 6.61% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 6.61% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.79% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.13% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.48% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.65% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.65% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.83% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.83% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.83% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.83% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.83% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.83% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.83% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2022920000 | Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007214 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007722 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly) | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009470 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013133 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2 | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017991 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaG | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020566 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027491 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
QL_na_8126390 | 2022920000 | Saline Water | GSGHRVTFFTAPTTIVSLLVLDDVVFGVLNADNVFRGKVGL |
B570J40625_1007185693 | 3300002835 | Freshwater | EHRLDFSTGHSVLYSTAPTTIVFELILNDALYGTIDTTNVLG* |
Ga0066179_100117445 | 3300004126 | Freshwater Lake | LTIEGLEHRLTLSAGHAVTYFTSPTTIVYELILNDLVYGTLDAENVLG* |
Ga0079957_12030371 | 3300005805 | Lake | VIDFNRGHTVTFYTSPTTIVYELILDDAVYGIMDSTNVLG* |
Ga0070749_100856341 | 3300006802 | Aqueous | NGHSIMYFTAQTTIVYELILGDAIYGIIDADNVLG* |
Ga0070749_105242901 | 3300006802 | Aqueous | ISLDGGHTITFYTADTTVVYYLVLDDLVYGVLDSTNVLG* |
Ga0070749_106175442 | 3300006802 | Aqueous | LDGGHTITFYTADTTVVYYLVLDDLVYGVLDSTNVLG* |
Ga0075467_106881462 | 3300006803 | Aqueous | EHYLDFSTGHRVLYSTAPTTIVYELILDDAVYGTIDTTNVLG* |
Ga0075464_102849642 | 3300006805 | Aqueous | TIEGLEHRLTLSAGHAVTYYTSPTTIVYELILDDITYGTLNAENVLG* |
Ga0075476_100815841 | 3300006867 | Aqueous | HELAVRAGHLMTFYTSPTTIVFELLLDDPTYGTLDGSNVLG* |
Ga0075477_101677744 | 3300006869 | Aqueous | IDVNRGHSVTYFTSPTIAVYELILDDLSFGIIDADNVLG* |
Ga0103959_11405026 | 3300007214 | Freshwater Lake | SGHRVTYYTSPTTIVYELILNDPIYGQLDSTNVLG* |
Ga0105050_104943643 | 3300007516 | Freshwater | SGGHTVTFYTSQQLILFNLILNDAVYGEMDSTNVLGA* |
Ga0105050_105699132 | 3300007516 | Freshwater | GHSVTFYTSQQLILFNLILNDAVYGEMDSTNVLGA* |
Ga0105052_105004163 | 3300007523 | Freshwater | GGHTVTFYTSQQLILFNLILNDAVYGEMDSTNVLGA* |
Ga0099851_13657222 | 3300007538 | Aqueous | SLDGGHTITFYTADTTVVYYLVLDDLVYGVLDSTNVLG* |
Ga0099848_11830982 | 3300007541 | Aqueous | SVEVITGDISLDGGHTLTFYTADTTVVYLLVLDDPVYGVLDSTNVLG* |
Ga0105051_105446962 | 3300007722 | Freshwater | ANGHTVSYYTSPTTIQYYLILDDPVYGVLDSNNVLG* |
Ga0105091_106437192 | 3300009146 | Freshwater Sediment | GHRITLFTSPTTLVFELILDDAVYGTLDAENVLG* |
Ga0114918_101818051 | 3300009149 | Deep Subsurface | ITVSGGHSLMFFTSPTVIVYELILDDLTFGILDAENVLG* |
Ga0114918_102023311 | 3300009149 | Deep Subsurface | EHRLTLSAGHAVTYFTSPTTIVYELILDDIVYGTLDEENVLG* |
Ga0114918_102316191 | 3300009149 | Deep Subsurface | LDFSTGHRVLYSTAPTTIVYELILDDAVYGTIDSTNVLG* |
Ga0114918_107256542 | 3300009149 | Deep Subsurface | EHAIDFANGHRVTFFTAPTVVVFELVLDDATFGTLDAENVLG* |
Ga0114966_101276915 | 3300009161 | Freshwater Lake | QFAQNLTIEGLEHRLTLSAGHAVTYYTAPTTIVYELILDDLVYGTLDAENVLG* |
Ga0114979_104991442 | 3300009180 | Freshwater Lake | HRLTLSAGHAVTYFTAPTTIVYELILDDLVYGTLDAENVLG* |
Ga0114979_106776292 | 3300009180 | Freshwater Lake | SAGHAVTYFTAQTTIVYELILDDLVYGTLDAENVLG* |
Ga0114969_103670781 | 3300009181 | Freshwater Lake | TLSAGHAVTYYTAPTTIVYELILDDLVYGTLDAENVLG* |
Ga0126447_10502633 | 3300009470 | Meromictic Pond | FSTGHRVLYSTAPTTIVYELILDDALYGTLDAENVLG* |
Ga0129336_104084881 | 3300010370 | Freshwater To Marine Saline Gradient | FDRGHTLRLSTSPTTIVYALILDDPVYGLLDTNALN* |
Ga0153799_10124104 | 3300012012 | Freshwater | HTITVSGGHSVMYFTSPTTIVYELILDDVVFGIIDADNVLG* |
Ga0153799_10246501 | 3300012012 | Freshwater | DLSTGHRITLFTSPTTLVYELILDDLIYGTIDTENVLG* |
Ga0153801_10394241 | 3300012017 | Freshwater | HEIDLSTGHRMTLFTSPTTLVFELILDDAVYGTIDTENVLG* |
Ga0157595_11165161 | 3300012708 | Freshwater | HRLDFSTGHSVLYSTAPTTIVYELILDDALYGTIDTTNALG* |
Ga0164293_105567641 | 3300013004 | Freshwater | HYLDFSTGHRVLYSTAPTTIVFELILDDAVYGTLDAENVLG* |
Ga0164292_104981643 | 3300013005 | Freshwater | LTLSAGHAVTYFTAPTTIVYELILDDAVYGTLDEDNVLG* |
Ga0129327_109217692 | 3300013010 | Freshwater To Marine Saline Gradient | ITGDISLDGGHTITFYTADTTVVYYLVLGDPTYGVMDSTNVLG* |
(restricted) Ga0172374_12661871 | 3300013122 | Freshwater | GIIDINAGHTLTFYTTDTTVLYLLILDDPVFGLLDSTNALG* |
(restricted) Ga0172367_103078001 | 3300013126 | Freshwater | NRGHTVTFYTSPTTIVYELILDDAIYGVIDSNNVLG* |
(restricted) Ga0172373_103566821 | 3300013131 | Freshwater | IDGVIDLNAGHTLTFYTSNTTVVYLLILDDPVLGVLDSTNVLG* |
(restricted) Ga0172362_104356191 | 3300013133 | Sediment | QAVIDFIRGHTVTFYTSPTTIVYELILDDAVYGVIDSDNVLG* |
(restricted) Ga0172375_103786432 | 3300013137 | Freshwater | GHAITLFTAPTIVVYELILDDLTFGIIDADNVLGT* |
Ga0177922_101325272 | 3300013372 | Freshwater | EHRLTLSAGHAVTYFTSPTTVVYELILNDIVYGTLDAENVLG* |
Ga0181350_11173611 | 3300017716 | Freshwater Lake | LTLSAGHAVTYFTSPTTIVYELILDYIVYGTLDEDNVLG |
Ga0181362_10410272 | 3300017723 | Freshwater Lake | EELTVEGINGEIQLDGGHTLTFYTADTTVVTVLILDDVTFGVLDSTNVLG |
Ga0181362_11139102 | 3300017723 | Freshwater Lake | EGVEHAIDFGSGHRVTFFTAPTTIVYELILDDVTYGIIDAENVLG |
Ga0181344_10331014 | 3300017754 | Freshwater Lake | GIEHRLDFSTGHSVLYSTAPTTIVYELILNDAVYGTIDTTNVLG |
Ga0181344_10452074 | 3300017754 | Freshwater Lake | LDFSTGHRVLYSTAPTTIVYELILDDAVYGTLDAENVLG |
Ga0181358_11218171 | 3300017774 | Freshwater Lake | GVEHAIDFSSGHRVTFFTAPTTIVYLLILDDITFGTLDAENVLG |
Ga0181349_10653881 | 3300017778 | Freshwater Lake | LSVEGVEHAIDFGSGHRVTFFTAPTTIIYELILNDSTFGTLDAENVLG |
Ga0181349_11422762 | 3300017778 | Freshwater Lake | EHRLTLSAGHAVTYFTSPTTIVYELILDDLVYGTLDEENVLG |
Ga0181349_11819102 | 3300017778 | Freshwater Lake | GSGHRVTFFTAPTTIVYELILNDSVFGTIDTENVLG |
Ga0181346_12872791 | 3300017780 | Freshwater Lake | RLTLSAGHAVTYFTSPTTIVFELILDDLVYGTLDEDNVLG |
Ga0180434_103862471 | 3300017991 | Hypersaline Lake Sediment | IEHYIDTTAGHVVRFYTSAVTIVYELILDDSVYGVLDSTNVLG |
Ga0211735_102069062 | 3300020162 | Freshwater | LTLSAGHAVTYFTSPTTIVYELILDDLVYGTLDAENVLG |
Ga0194118_105594962 | 3300020190 | Freshwater Lake | GETVTFFTAPTSIVFELLLDDATKGKMDSTNVLGA |
Ga0194131_104200131 | 3300020193 | Freshwater Lake | INAGHTLTFYTSDTTVLYLLILDDPVYGLLDSTNVLG |
Ga0194128_103139462 | 3300020197 | Freshwater Lake | DFNRGHTVTFYTAPTTVVYDLILDDPVYGVIDSTNVLG |
Ga0194121_101627142 | 3300020200 | Freshwater Lake | RGHTVTFYTAPTTIIYDLILDDPVYGVMDADNVLG |
Ga0208360_10072895 | 3300020551 | Freshwater | FSTGHKVLYSTAPTTIVFELILDDAVYGTLDAENVLG |
Ga0208222_10518402 | 3300020566 | Freshwater | TGHRVTFFTSPTVVVFELILDDAIYGILDADNVLG |
Ga0214163_10471503 | 3300021141 | Freshwater | GIEHRLDFSTGHSVLYSTAPTTIVFELILDDAVYGTLDAENVLG |
Ga0194130_102453933 | 3300021376 | Freshwater Lake | EGITGNIDLNAGHTLTFYTSDTTVLYLLILDDPVYGVLDSTNALG |
Ga0194117_100326288 | 3300021424 | Freshwater Lake | EFNRGHTVTFYTAPTTIIYDLILDDPVYGVMDADNVLG |
Ga0222712_101679914 | 3300021963 | Estuarine Water | AIDFANGHRVTFYTAPTTIVYELILDDLTYGILDAENVLG |
Ga0196905_11856032 | 3300022198 | Aqueous | DISLDGGHTLTFYTADTTVVYLFILDDPLYGVLSTTNALG |
Ga0196901_11217482 | 3300022200 | Aqueous | EGISGDISLDGGHTITFYTADTTVVYYLVLDDLVYGVLDSTNVLG |
Ga0196901_11717622 | 3300022200 | Aqueous | ELSIEGIEHYLDFSTGHRVLYSTAPTTIVYELILDDAVYGTLDADNVLG |
Ga0214917_102070971 | 3300022752 | Freshwater | ITVNNGHSVMYFTAPTTIVYELILDDLTYGIIDSTNVLG |
Ga0210003_11029125 | 3300024262 | Deep Subsurface | GVEHAIDFANGHRVTFFTAPTTVVYLLTLDDATFGVLDSSNVLG |
Ga0210003_11468794 | 3300024262 | Deep Subsurface | SAGHAVTYFTSPTTIVYELILDDLTYGTLDEENVLG |
Ga0210003_11487561 | 3300024262 | Deep Subsurface | LTLSAGHAVTYFTSPTTIVYELILDDLTYGTLDEENVLG |
Ga0210003_12804212 | 3300024262 | Deep Subsurface | SGGHSLMFFTSPTVIVYELILDDLTFGILDAENVLG |
Ga0208019_10930621 | 3300025687 | Aqueous | IEHYLDFSTGHRVLYSTAPTTIVFELILDDALYGTLSTTNALG |
Ga0255097_10680021 | 3300027491 | Freshwater | SIEGVEHAIDFASGHRVTFFTAPTTIVYELILDDVTYGIIDADNVLG |
Ga0208974_11228932 | 3300027608 | Freshwater Lentic | EIDLSTGHRITLFTSPTTLVFELILDDSVYGRIDEENVLG |
Ga0209086_103149632 | 3300027770 | Freshwater Lake | IEGLEHRLTLSAGHAVTYYTAPTTIVYELILDDLVYGTLDAENVLG |
(restricted) Ga0247837_12962932 | 3300027970 | Freshwater | AIDFDSGHRVTLFTAPTTIVYELVLNDAVFGTIDAENVLG |
Ga0209079_102467582 | 3300027972 | Freshwater Sediment | EIDLFTGHRITLFTSPTTLVFELILDDLVYGTLDAENVLG |
Ga0209702_102943091 | 3300027976 | Freshwater | GHSVTFYTSQQLILFNLILNDAVYGEMDSTNVLGA |
Ga0307379_103141586 | 3300031565 | Soil | GIEHYLDFSTGHRVLYSTAPTTIVYELILDDAVYGTLDEENVLG |
Ga0307378_102356561 | 3300031566 | Soil | SSGHSLMFFTSPTVIVYELILDDAVFGILDAENVLG |
Ga0307378_102984871 | 3300031566 | Soil | VGGGHRVEYFTSPTVLVFELILDDAIYGIIDSTNVLG |
Ga0307378_106944011 | 3300031566 | Soil | LSVEGVEHAIDFANGHRVTFFTAPTTVVFELVLDDATFGTIDTTNVLG |
Ga0307378_108893351 | 3300031566 | Soil | LSTGHRITLFTSPTTLVFELILDDLVYGTLDEENVLG |
Ga0307378_110399081 | 3300031566 | Soil | EGIEHYLDFSTGHRVLYSTAPTTIVFELILDDAVYGILDAENVLG |
Ga0307378_114180161 | 3300031566 | Soil | EHYLDFSTGHRVLYSTAPTTIVYELILDDAQYGTIDTTNVLG |
Ga0307376_104565551 | 3300031578 | Soil | DFANGHRVTFFTAPTTVVFELVLDDATFGTLDAENVLG |
Ga0307376_105387651 | 3300031578 | Soil | SGGHSLMFFTSPTVIVYELILDDAVFGILDAENVLG |
Ga0307376_108291651 | 3300031578 | Soil | ITVSGGHSLMFFTSPTVIVYELILDDLTFGILDAENVLG |
Ga0315288_107084063 | 3300031772 | Sediment | TLDGHRVALFTSPTTIVYELILDNATYGTIDTTNVLG |
Ga0315909_104030111 | 3300031857 | Freshwater | EGIEHYLDFSTGHRVLYSTAPTTIVYELILNDAVYGTIDTTNVLG |
Ga0315285_109263971 | 3300031885 | Sediment | NLTVEGLEHRLTLSAGHAVTYFTAPTTIVYELILDDAVYGTLDEDNVLG |
Ga0315294_109851672 | 3300031952 | Sediment | LSAGHAVTYFTAPTTIVYELILDDAVYGTLDEDNVLG |
Ga0315289_104320952 | 3300032046 | Sediment | IQHEIDLSTGHRITLFTSPTTLVFELILDDLVYGTIDTENVLG |
Ga0315289_106460341 | 3300032046 | Sediment | SDGHRITLFTSPTTLVYELILDDLIYGTIDTENVLG |
Ga0315906_100418831 | 3300032050 | Freshwater | GIEHYLDFSTGHRVLYSTAPTVIVYELILDDAVYGTLDAENVLG |
Ga0315903_111899092 | 3300032116 | Freshwater | HIITVGAGHSILLSTAPTTIVFELILDNALYGTIDTENVLG |
Ga0335396_102764763 | 3300032462 | Freshwater | RINVANGHTVSYYTSPTTIQYYLILDDPVYGVLDSNNVLG |
Ga0335396_105311163 | 3300032462 | Freshwater | INVANGHTVSYYTSPTTIQYYLILDDPVYGVLDSNNVLG |
Ga0335396_106652881 | 3300032462 | Freshwater | ANGHTVSYYTSPTTIQYYLILDDPVYGVLDSNNVLG |
Ga0334978_0121489_1192_1314 | 3300033979 | Freshwater | YLDFATGHRVLYSTAPTTIVYELILDNAVYGTLDAENVLG |
Ga0334994_0263674_3_119 | 3300033993 | Freshwater | TLSAGHAVTYFTSPTTIVYELILDDLVYGTLDEENVLG |
Ga0335005_0767968_342_500 | 3300034022 | Freshwater | FAEILTVEGLEHRLTLSAGHAVTYFTAPTTIVYELILNDAVYGTLDEDNVLG |
Ga0334987_0750270_3_116 | 3300034061 | Freshwater | LSDGHRITLFTSPTTLVFELVLDDLIYGITDADNVLG |
Ga0334995_0028128_4751_4882 | 3300034062 | Freshwater | LEHRLTLSAGHAVTYFTAPTTIVYELILNDPVYGTLNEENVLG |
Ga0334995_0567628_3_128 | 3300034062 | Freshwater | HAIDFGSGHRVTFFTAPTTIVYELILDDLTYGIIDAENVLG |
Ga0335000_0091656_3_140 | 3300034063 | Freshwater | EGIEAVIDFAAGHTVRFYTNDVTIVYELILDDVTYGIIDAENVLG |
Ga0310127_143654_841_951 | 3300034072 | Fracking Water | SGGHQITFFTSPTVIVYELILDDSVYGVLDDSNVLG |
Ga0310127_218830_1_123 | 3300034072 | Fracking Water | VIDVNRGHTVTFYTSPTIIVFELILDDAVYGLLDSTNVLG |
Ga0335022_0029352_2_130 | 3300034095 | Freshwater | EHRLTLSAGHAVTYFTSPTTIVYELILNDAVYGTLDEDNVLG |
Ga0335029_0163543_3_122 | 3300034102 | Freshwater | LDFSTGHSVLYSTAPTTIVYELILDDAVYGTLDAENVLG |
Ga0335029_0240553_1063_1176 | 3300034102 | Freshwater | VNNGHSVMYFTAPTTIVYELILDDLTYGIIDSTNVLG |
Ga0335030_0890644_403_513 | 3300034103 | Freshwater | STGHRITLFTSPTTLVFELILDDLVYGTIDTENVLG |
Ga0335036_0270674_1018_1140 | 3300034106 | Freshwater | YLDFATGHRVLYSTSPTVIVYELILDNLTYGTLDQFNVLG |
Ga0335063_0072846_1_129 | 3300034111 | Freshwater | TGVINFSRGHTITYYTSPTTIVYELILDDAIYGVIDAQNVLG |
Ga0335054_0221937_1009_1131 | 3300034119 | Freshwater | RLDFSTGHSVLYSTAPTTIVYELILDDAVYGTLDAENVLG |
Ga0335056_0344167_2_145 | 3300034120 | Freshwater | SIEGIEHRLDFSTGHSVLYSTAPTTIVYELILDDAVYGTLDAENVLG |
Ga0335060_0607736_428_547 | 3300034122 | Freshwater | LTLSAGHAVTYFTAPTTIVYELILDDIVYGTLDQENVLG |
Ga0335016_0162893_1374_1502 | 3300034166 | Freshwater | EHYLDFSTGHRVLYSTASTTIVFELILDDAVYGTIDEENVLG |
Ga0335049_0883942_353_511 | 3300034272 | Freshwater | LAQELSIEGIEHRLDFSTGHSVLYSTAPTTIVYELILDDAVYGTLDAENVLG |
Ga0348335_041271_1745_1885 | 3300034374 | Aqueous | VEGITGDISLDGGHTITFYTADTTVVYYLVLDDLVYGVMDSTNVLG |
⦗Top⦘ |