NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072010

Metagenome / Metatranscriptome Family F072010

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072010
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 42 residues
Representative Sequence SQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL
Number of Associated Samples 94
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.52 %
% of genes from short scaffolds (< 2000 bps) 87.60 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (61.983 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater
(14.876 % of family members)
Environment Ontology (ENVO) Unclassified
(47.107 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(72.727 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF09458H_lectin 11.57
PF03796DnaB_C 2.48
PF09479Flg_new 1.65
PF13662Toprim_4 0.83
PF02811PHP 0.83
PF14579HHH_6 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 2.48
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 2.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.42 %
UnclassifiedrootN/A30.58 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1013835All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2027Open in IMG/M
3300001282|B570J14230_10143144Not Available688Open in IMG/M
3300001844|RCM35_1008245All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes787Open in IMG/M
3300001948|GOS2228_1027668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1534Open in IMG/M
3300002195|metazooDRAFT_1224584All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes737Open in IMG/M
3300002408|B570J29032_109393767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes733Open in IMG/M
3300002408|B570J29032_109787040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1323Open in IMG/M
3300002408|B570J29032_109898915All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2176Open in IMG/M
3300002471|metazooDRAFT_1415764Not Available520Open in IMG/M
3300004240|Ga0007787_10679942All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes515Open in IMG/M
3300005528|Ga0068872_10124596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1519Open in IMG/M
3300005528|Ga0068872_10609085Not Available578Open in IMG/M
3300005582|Ga0049080_10021210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2265Open in IMG/M
3300005584|Ga0049082_10161694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes774Open in IMG/M
3300005662|Ga0078894_10994306All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes722Open in IMG/M
3300007177|Ga0102978_1076593All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1540Open in IMG/M
3300007541|Ga0099848_1020380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2833Open in IMG/M
3300007555|Ga0102817_1159213Not Available506Open in IMG/M
3300008107|Ga0114340_1082923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1320Open in IMG/M
3300008107|Ga0114340_1138734All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli914Open in IMG/M
3300008107|Ga0114340_1228074Not Available591Open in IMG/M
3300008108|Ga0114341_10375853All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes701Open in IMG/M
3300008110|Ga0114343_1094224All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1049Open in IMG/M
3300008110|Ga0114343_1234396Not Available503Open in IMG/M
3300008113|Ga0114346_1004451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes9714Open in IMG/M
3300008116|Ga0114350_1044626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1651Open in IMG/M
3300008116|Ga0114350_1192537All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes511Open in IMG/M
3300008120|Ga0114355_1193286Not Available666Open in IMG/M
3300008261|Ga0114336_1018307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6586Open in IMG/M
3300008264|Ga0114353_1126557All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1323Open in IMG/M
3300008266|Ga0114363_1002527Not Available10209Open in IMG/M
3300008450|Ga0114880_1125122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage960Open in IMG/M
3300008996|Ga0102831_1115945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes891Open in IMG/M
3300009159|Ga0114978_10038917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3349Open in IMG/M
3300009160|Ga0114981_10300477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes871Open in IMG/M
3300010354|Ga0129333_10131255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2304Open in IMG/M
3300010354|Ga0129333_10447342All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1138Open in IMG/M
3300010370|Ga0129336_10284670All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli922Open in IMG/M
3300011011|Ga0139556_1046451Not Available642Open in IMG/M
3300011268|Ga0151620_1039556All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1581Open in IMG/M
3300012665|Ga0157210_1023596All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli983Open in IMG/M
3300012666|Ga0157498_1053984Not Available616Open in IMG/M
3300012968|Ga0129337_1067128All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1183Open in IMG/M
3300013087|Ga0163212_1135623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes781Open in IMG/M
(restricted) 3300013126|Ga0172367_10203073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1246Open in IMG/M
(restricted) 3300013126|Ga0172367_10231907All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1135Open in IMG/M
(restricted) 3300013126|Ga0172367_10250813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1075Open in IMG/M
(restricted) 3300013126|Ga0172367_10541556Not Available633Open in IMG/M
(restricted) 3300013132|Ga0172372_10600837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes710Open in IMG/M
(restricted) 3300013132|Ga0172372_10618014Not Available697Open in IMG/M
3300013372|Ga0177922_10614245Not Available668Open in IMG/M
3300013372|Ga0177922_10968772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2402Open in IMG/M
(restricted) 3300014720|Ga0172376_10023594All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes5525Open in IMG/M
3300017761|Ga0181356_1243937All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes514Open in IMG/M
3300017788|Ga0169931_10370638All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1076Open in IMG/M
3300020048|Ga0207193_1639923Not Available706Open in IMG/M
3300020084|Ga0194110_10660772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes653Open in IMG/M
3300020109|Ga0194112_10485791All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes869Open in IMG/M
3300020159|Ga0211734_10685416All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1043Open in IMG/M
3300020160|Ga0211733_11074797Not Available655Open in IMG/M
3300020162|Ga0211735_10544914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1337Open in IMG/M
3300020179|Ga0194134_10281443Not Available665Open in IMG/M
3300020183|Ga0194115_10411182All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes578Open in IMG/M
3300020190|Ga0194118_10031581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3744Open in IMG/M
3300020193|Ga0194131_10342171Not Available674Open in IMG/M
3300020220|Ga0194119_10529658Not Available737Open in IMG/M
3300020220|Ga0194119_10573898Not Available698Open in IMG/M
3300020578|Ga0194129_10256847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1013Open in IMG/M
3300021376|Ga0194130_10187619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1234Open in IMG/M
3300021424|Ga0194117_10442223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes589Open in IMG/M
3300021963|Ga0222712_10284650All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1043Open in IMG/M
3300023184|Ga0214919_10023505All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes6742Open in IMG/M
3300024298|Ga0255178_1035683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes995Open in IMG/M
3300024346|Ga0244775_10175790All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1802Open in IMG/M
3300024495|Ga0255164_1045608All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes704Open in IMG/M
3300024500|Ga0255143_1060799Not Available612Open in IMG/M
3300024559|Ga0255284_1134668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes515Open in IMG/M
3300024857|Ga0256339_1047535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes913Open in IMG/M
3300024864|Ga0255271_1084034Not Available697Open in IMG/M
3300024864|Ga0255271_1111421Not Available598Open in IMG/M
3300025732|Ga0208784_1040150All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1462Open in IMG/M
3300026459|Ga0255170_1085267Not Available525Open in IMG/M
3300026571|Ga0255289_1066622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes815Open in IMG/M
3300026572|Ga0255270_1044727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1129Open in IMG/M
3300027138|Ga0255064_1068123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes553Open in IMG/M
3300027141|Ga0255076_1074199Not Available562Open in IMG/M
3300027541|Ga0255158_1047606All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli971Open in IMG/M
3300027541|Ga0255158_1061073All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes842Open in IMG/M
3300027601|Ga0255079_1003877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3887Open in IMG/M
3300027644|Ga0209356_1093662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes882Open in IMG/M
3300027697|Ga0209033_1165521Not Available679Open in IMG/M
3300027697|Ga0209033_1169386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes669Open in IMG/M
3300027720|Ga0209617_10170268All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes850Open in IMG/M
3300027744|Ga0209355_1253551Not Available689Open in IMG/M
3300027797|Ga0209107_10396554Not Available630Open in IMG/M
3300027797|Ga0209107_10403992Not Available622Open in IMG/M
3300027816|Ga0209990_10442921Not Available558Open in IMG/M
3300027892|Ga0209550_10243070All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1194Open in IMG/M
3300027969|Ga0209191_1340977Not Available543Open in IMG/M
3300028103|Ga0255172_1011705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1722Open in IMG/M
3300028286|Ga0256331_1024842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1334Open in IMG/M
3300028286|Ga0256331_1137671Not Available552Open in IMG/M
3300031758|Ga0315907_10433925All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1052Open in IMG/M
3300031758|Ga0315907_10879380Not Available660Open in IMG/M
3300031784|Ga0315899_10772577All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli883Open in IMG/M
3300031786|Ga0315908_11367234All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes556Open in IMG/M
3300031951|Ga0315904_10231811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1783Open in IMG/M
3300031951|Ga0315904_10311573All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1469Open in IMG/M
3300031951|Ga0315904_11012545All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes657Open in IMG/M
3300032050|Ga0315906_11262767Not Available530Open in IMG/M
3300032093|Ga0315902_10508081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1046Open in IMG/M
3300032093|Ga0315902_10616643All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli907Open in IMG/M
3300032093|Ga0315902_10867341Not Available700Open in IMG/M
3300033995|Ga0335003_0170772All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1065Open in IMG/M
3300034095|Ga0335022_0139214All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1512Open in IMG/M
3300034095|Ga0335022_0593570Not Available561Open in IMG/M
3300034117|Ga0335033_0381016Not Available700Open in IMG/M
3300034117|Ga0335033_0397536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes680Open in IMG/M
3300034272|Ga0335049_0000668All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes23977Open in IMG/M
3300034272|Ga0335049_0251750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1216Open in IMG/M
3300034356|Ga0335048_0364361Not Available727Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater14.88%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater14.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton10.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater9.09%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.48%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.48%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.48%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.65%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake1.65%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic1.65%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment1.65%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.83%
Freshwater, Surface IceEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice0.83%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment0.83%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.83%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.83%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.83%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300001282Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnionEnvironmentalOpen in IMG/M
3300001844Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3aEnvironmentalOpen in IMG/M
3300001948Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012EnvironmentalOpen in IMG/M
3300002195Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002471Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005528Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaGEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300008996Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747EnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009160Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012665Freshwater microbial communities from Talbot River, Ontario, Canada - S11EnvironmentalOpen in IMG/M
3300012666Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300020048Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020109Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300023184Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503EnvironmentalOpen in IMG/M
3300024298Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8dEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024495Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8dEnvironmentalOpen in IMG/M
3300024500Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024559Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024857Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024864Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026459Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8dEnvironmentalOpen in IMG/M
3300026571Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027541Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8hEnvironmentalOpen in IMG/M
3300027601Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8hEnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027697Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028286Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034095Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034356Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_101383543300000736Freshwater And SedimentMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEILAHDLGENL*
B570J14230_1014314423300001282FreshwaterKMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI*
RCM35_100824513300001844Marine PlanktonIVDPDVFNKYGLDRSIIMEVSESETKAHELGENL*
GOS2228_102766843300001948MarineGKIYLISQNKRRHIVSPDSFITYGLDRSKVIEVSEAETNMHEIGDNL*
metazooDRAFT_122458433300002195LakeYLISQNKKRHIVSPDVFTKYGLDRSRLIEVSESEAAIHDLGENL*
B570J29032_10939376733300002408FreshwaterIVNPDSFSKYGLNRSNIVEVSESEINSHELGENL*
B570J29032_10978704013300002408FreshwaterKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI*
B570J29032_10989891563300002408FreshwaterQNKRRHIVTPDSFTKYGLNRSSIVEVSESETNMHDLGENL*
metazooDRAFT_141576413300002471LakeNKRRHITSPDVFERYGLDRSAIIEVSEAEINMHEQGEDLWQI*
Ga0007787_1067994223300004240Freshwater LakeVSQNKLRHIIDPDVFNRYGLDRSKVVEVSEKEILAHDLGENIQ*
Ga0068872_1012459613300005528Freshwater LakeRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENI*
Ga0068872_1060908513300005528Freshwater LakeRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL*
Ga0049080_1002121013300005582Freshwater LenticLRHIVDPDSFSRYGLDRSKMIEVSEKEISVHDLGEII*
Ga0049082_1016169433300005584Freshwater LenticLIKNLADGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEISAHDLGENL*
Ga0078894_1099430633300005662Freshwater LakeSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL*
Ga0102978_107659333300007177Freshwater LakeKMYLVSQNKLRHIVDPDIFDRYGLDRSNLIEVSDTEIKAHDIGEAL*
Ga0099848_102038013300007541AqueousNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHTTGDNL*
Ga0102817_115921313300007555EstuarineADGRMYLVSQNKLRHIVDPDSFNRYGLDRSKVVEVSDKEISAHDLGENL*
Ga0114340_108292313300008107Freshwater, PlanktonGKIYLISQNKRRQIVDPDTFDRYGLDRSMTIEVSEAETNMHDLGENL*
Ga0114340_113873413300008107Freshwater, PlanktonPDVFERYGLDRSMIIEVSEAEINMHEQGEDLWQI*
Ga0114340_122807413300008107Freshwater, PlanktonIKNIADGKIYLLSQNKLRHIIDPDSFTKYGLDRSWIIEVSDNEINAHELGENL*
Ga0114341_1037585323300008108Freshwater, PlanktonLVSQNKLRHIIDPDVFNRYGLDRSKVVEVSEKEILAHDLGENIQ*
Ga0114343_109422413300008110Freshwater, PlanktonIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL*
Ga0114343_123439613300008110Freshwater, PlanktonKMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL*
Ga0114346_1004451133300008113Freshwater, PlanktonIADGKIYLISQNKRRHVVDPDTFDRYGLDRSKTIEVSEVETNMHDLGENL*
Ga0114350_104462643300008116Freshwater, PlanktonIKNIADGRIYLVSQNKLRHIVDPDSFTRYGLDRSNVIEVSETEVSAHDLGEKL*
Ga0114350_119253723300008116Freshwater, PlanktonYLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL*
Ga0114355_119328613300008120Freshwater, PlanktonQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL*
Ga0114336_101830723300008261Freshwater, PlanktonMYLVSQNKLRHIIDPDSFTRYGLDRSKMIEVSEKEISAHDLGEKL*
Ga0114353_112655713300008264Freshwater, PlanktonDGKMYLVSQNKLRHIVDPDIFNKYGLDRTNLIEVSESEVKAHEIGDYL*
Ga0114363_1002527133300008266Freshwater, PlanktonIADGKMYLVSQNKLRHIVDPDIFNKYGLDRTNLIEVSESEVKAHEIGDYL*
Ga0114880_112512223300008450Freshwater LakeMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL*
Ga0102831_111594513300008996EstuarineISQNKRRHIVDPDTFSKYGLNRSNIIEVSESEANMHELGENL*
Ga0114978_1003891773300009159Freshwater LakeHVVSPDIFIQYGLDRSSVLEVSDLEVNMHDLGENL*
Ga0114981_1030047713300009160Freshwater LakeDGKMYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEILAHDLGENL*
Ga0129333_1013125513300010354Freshwater To Marine Saline GradientKRHIVDPDSFDKFGLDRKAIIEVSEAEANMHDIGENL*
Ga0129333_1044734213300010354Freshwater To Marine Saline GradientIADGKMYLVSQNKLRHIVDPDIFTKYGLDRSKLIEVSEAEVKAHDIGESL*
Ga0129336_1028467033300010370Freshwater To Marine Saline GradientDGKIYLVSQNKLRHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGESI*
Ga0139556_104645113300011011FreshwaterYLVSENKLRHIVDPDSFNQYGLDRSKVIEVSDKEISAHDLGENL*
Ga0151620_103955663300011268FreshwaterHIVDPDSFLKYGLDRSKVVEVSESEVNMHDLGDNL*
Ga0157210_102359613300012665FreshwaterGRMYLVSQNKKRHITSPDIFDKFGLDRNTMIEVSAVEVAAHELGEDL*
Ga0157498_105398423300012666Freshwater, Surface IceVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI*
Ga0129337_106712833300012968AqueousNKLRHIVDPDIFDRYGLDRSNLIEVSEAEIKAHDIGETL*
Ga0163212_113562313300013087FreshwaterVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI*
(restricted) Ga0172367_1020307313300013126FreshwaterKLRHIVDPDIFDRYGLDRSNLIEVSEAEINAHDIGETL*
(restricted) Ga0172367_1023190733300013126FreshwaterADGKMYLVSQNKLRHIIDPDIFNKYGLNRSKVVEVSEAEIKAHELGDVL*
(restricted) Ga0172367_1025081333300013126FreshwaterISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDNL*
(restricted) Ga0172367_1054155613300013126FreshwaterRHIVDPDIFDRYGLDRSNLIEVSEAEINAHDIGEEL*
(restricted) Ga0172372_1060083713300013132FreshwaterNKRRHIVDPDSFNKYGLNRSDIIEVSETEAGMHDLGENL*
(restricted) Ga0172372_1061801423300013132FreshwaterVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGEII*
Ga0177922_1061424513300013372FreshwaterLRHIVDPDLFNRYGLDRSKMIEVSEKEISAHDLGESI*
Ga0177922_1096877253300013372FreshwaterISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDSL*
(restricted) Ga0172376_1002359413300014720FreshwaterISQNKKRHIVDPDSFDRYGLDRRLVIEVSEVEANMHTTGDNL*
Ga0181356_124393713300017761Freshwater LakeDGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEISAHDLGENL
Ga0169931_1037063833300017788FreshwaterISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDNL
Ga0207193_163992313300020048Freshwater Lake SedimentKMYLVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEVSAHDLGENL
Ga0194110_1066077213300020084Freshwater LakeKMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI
Ga0194112_1048579113300020109Freshwater LakeKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI
Ga0211734_1068541633300020159FreshwaterMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEISAHDLGENL
Ga0211733_1107479713300020160FreshwaterHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGESI
Ga0211735_1054491413300020162FreshwaterISQNKKRHIVDPDSFTKYGLDRSKTIEVSEAESNAHDLGDNL
Ga0194134_1028144313300020179Freshwater LakeVSQNKLRHIVDPDSFDRYGLDRSRVVEVSEKEISAHELGDNI
Ga0194115_1041118223300020183Freshwater LakeDGKMYLVSQNKLRHIVDPDSFDRYGLDRSRVVEVSEKEILAHDLGENL
Ga0194118_1003158183300020190Freshwater LakeHIVNPDSFNRYGLDRLKVVEVSEKEILAHDLGEKL
Ga0194131_1034217123300020193Freshwater LakeQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKI
Ga0194119_1052965813300020220Freshwater LakeTLIKNISDGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGENL
Ga0194119_1057389813300020220Freshwater LakeVSQNKLRHIVDPDSFDRYGLDRSRVVEVSEKEILAHDLGENL
Ga0194129_1025684733300020578Freshwater LakeADGKMYLISQNKKRHIVDPDSFDRYGLNRKSVIEVSEAEANMHELGDNL
Ga0194130_1018761913300021376Freshwater LakeVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKL
Ga0194117_1044222323300021424Freshwater LakeGKMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSEKEILAHDLGEKL
Ga0222712_1028465033300021963Estuarine WaterMYLLSQNKLRQIKDPDVFDLYGLDRSLLIEVAEYEVKAHELGEDL
Ga0214919_10023505133300023184FreshwaterLLSQNKLRHIVDPDSFDKYGLDRSKVIEVSEAEKQAHDLGEQL
Ga0255178_103568313300024298FreshwaterKKRHIIDPDSFNKYGLDRKSVLEVSQSEADMHQIGEDL
Ga0244775_1017579013300024346EstuarineVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEISAHDLGENL
Ga0255164_104560833300024495FreshwaterLRHIVDPDIFNRYGLDRSNLIEVSEAEIKAHDIGEAL
Ga0255143_106079923300024500FreshwaterVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL
Ga0255284_113466813300024559FreshwaterLISQNKKRHIVDPDAFDRYGLDRKSVIEVSDSEANMHELGDNL
Ga0256339_104753533300024857FreshwaterRHIVDPDAFDRYGLDRKSVIEVSEAEANMHELGDNL
Ga0255271_108403423300024864FreshwaterQNKKRHIIDPDSFNKYGLDRKSVLEVSQAEADMHQIGEDL
Ga0255271_111142113300024864FreshwaterKRHIVDPDAFDRYGLDRKSVIEVSDSEANMHELGDNL
Ga0208784_104015013300025732AqueousHIVDPDSFTKYGLDRSKVIEVSETEISAHDLGEKL
Ga0255170_108526723300026459FreshwaterHIVDPDSFDKYGLDRKSVLEVSESEANMHDIGENL
Ga0255289_106662213300026571FreshwaterDGKMYLVSQNKLRHIVDPDIFNRYGLDRSNLIEVSEAEIKAHDIGEAL
Ga0255270_104472713300026572FreshwaterKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL
Ga0255064_106812323300027138FreshwaterIADGKIYLVSQNKLRHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGENI
Ga0255076_107419913300027141FreshwaterHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGENI
Ga0255158_104760633300027541FreshwaterKRHIIDPDSFNKYGLDRKSVLEVSQSEADMHQIGEDL
Ga0255158_106107333300027541FreshwaterSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL
Ga0255079_100387773300027601FreshwaterIYLVSQNKLRHIVDPDSFTKYGLDRSKVIEVSEAEISAHDLGEKI
Ga0209356_109366233300027644Freshwater LakeYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEISAHDLGENL
Ga0209033_116552123300027697Freshwater LakeGKIYLVSQNKLRHIVDPDSFTKYGLDRSKIIEVSEAEVSAHDLGENI
Ga0209033_116938623300027697Freshwater LakeMYLVSQNKLRHIVDPDSFDRYGLDRSKMIEVSQKEISAHDLGENI
Ga0209617_1017026813300027720Freshwater And SedimentGRMYLVSQNKLRHIVDPDSFDRYGLDRSKVVEVSDKEILAHDLGENL
Ga0209355_125355133300027744Freshwater LakeSQNKLRHIVDPDSFNRYGLDRSKVVEVSDKEILAHDLGENL
Ga0209107_1039655413300027797Freshwater And SedimentQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEASMHELGEDL
Ga0209107_1040399213300027797Freshwater And SedimentKKRHIVDPDTFDKYGLDRASVIEVSAFEVSMHESGEDL
Ga0209990_1044292113300027816Freshwater LakeVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENI
Ga0209550_1024307013300027892Freshwater LakeKMYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEISAHDLGENL
Ga0209191_134097713300027969Freshwater LakeKMYLVSQNKLRHIVDPDSFNRYGLDRSKVIEVSDKEILAHDLGENL
Ga0255172_101170543300028103FreshwaterDGKMYLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL
Ga0256331_102484213300028286FreshwaterKMYLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL
Ga0256331_113767123300028286FreshwaterQNKLRHIVDPDIFIKYGLDRSNLIEVSETEVKAHDIGEIL
Ga0315907_1043392513300031758FreshwaterRHIVDPDSFNRYGLDRSKIIEVSQKEISAHDLGENI
Ga0315907_1087938023300031758FreshwaterSHNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDIGEIL
Ga0315899_1077257733300031784FreshwaterVSQNKLRHIVDPDSFNRYGLDRSKMIEVSEKEISAHDLGENL
Ga0315908_1136723423300031786FreshwaterADGKMYLVSQNKLRHIVDPDIFNRYGLDRSNLIEVSEAEVKAHDIGESL
Ga0315904_1023181113300031951FreshwaterHIVSPDVFDKYGLDKYSVVEVSEAETNMHNLGEQLA
Ga0315904_1031157313300031951FreshwaterNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDLGEIL
Ga0315904_1101254513300031951FreshwaterYLVSQNKLRHIVDPDIFIKYGLDRSNLIEVSEAEVKAHDIGEIL
Ga0315906_1126276713300032050FreshwaterLRHIVDPDIFIKYGLDRSNLVEVSEAEIKAHDIGDIL
Ga0315902_1050808133300032093FreshwaterLRHIVDPDIFNRYGLDRSNLIEVSEAEVKAHDIGESL
Ga0315902_1061664333300032093FreshwaterSQNKRRHIVNPDSFDKYGLDRSNIVEVSDSETNMHDLGENL
Ga0315902_1086734113300032093FreshwaterQNKLRHIVDPDSFNRYGLNRSKMIEVSEKEILAHDLGENI
Ga0335003_0170772_935_10633300033995FreshwaterISQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEASMHELGEDL
Ga0335022_0139214_3_1133300034095FreshwaterRHIVDPDTFDKYGLDRSQVIEVSAFETSMHELGEEL
Ga0335022_0593570_3_1403300034095FreshwaterIYLISQNKRRHVVSPDIFIQYGLDRSIILEVSDLEVNMHDLGENL
Ga0335033_0381016_2_1153300034117FreshwaterKRHIVDPDTFNKYGLDRSQVVEVSAFEVSMHELGEDL
Ga0335033_0397536_3_1553300034117FreshwaterIADGKLYLISQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEASMHELGEDL
Ga0335049_0000668_5158_52953300034272FreshwaterMYLVSQNKLRHIIDPDSFTRYGLDRSKMIEVSEKEISAHDLGEKL
Ga0335049_0251750_3_1223300034272FreshwaterNKRRHIVTPDSFTKYGLNRSSIVEVSESETNMHDLGENL
Ga0335048_0364361_586_7263300034356FreshwaterKLYLISQNKKRHIVDPDTFNKYGLDRSQVVEVSAFEVSMHELGEDL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.