Metagenome Family F071807

Overview

Basic Information

• Family ID: F071807
• Family Type: Metagenome
• Number of Sequences: 121
• Average Sequence Length: 38 residues
• Representative Sequence: VGLAATPSPRALGLAATPDPRALDVGLAARLCHKSVITK
• Number of Associated Samples: 18
• Number of Associated Scaffolds: 119

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.65 %
• % of genes near scaffold ends (potentially truncated): 6.61 %
• % of genes from short scaffolds (< 2000 bps): 42.15 %
• Associated GOLD sequencing projects: 18
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (61.983 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (80.992 % of family members)
• Environment Ontology (ENVO): Unclassified (100.000 % of family members)
• Earth Microbiome Project Ontology (EMPO): Unclassified (72.727 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 34.33%
  β-sheet: 0.00%
  Coil/Unstructured: 65.67%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF00854	PTR2	3.36
PF01852	START	1.68
PF05212	DUF707	1.68
PF00967	Barwin	0.84
PF12776	Myb_DNA-bind_3	0.84
PF14244	Retrotran_gag_3	0.84
PF01459	Porin_3	0.84
PF13963	Transpos_assoc	0.84
PF03936	Terpene_synth_C	0.84
PF13976	gag_pre-integrs	0.84
PF07727	RVT_2	0.84
PF08284	RVP_2	0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG3104	Dipeptide/tripeptide permease	Amino acid transport and metabolism [E]	3.36

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
All Organisms	root	All Organisms	38.02 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
cellular organisms	root	All Organisms → cellular organisms	38.02 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	35.54 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.48 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	33.88 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.65 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	33.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.83 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	33.88 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.65 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.83 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	33.88 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	1.65 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	22.31 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	1.65 %
Rheinheimera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera	0.83 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	22.31 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	22.31 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	22.31 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	15.70 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	15.70 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	15.70 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	14.88 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	13.22 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	1.65 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300028786|Ga0307517_10008996	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14238
3300028786|Ga0307517_10012118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	11876
3300028786|Ga0307517_10016801	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9590
3300028786|Ga0307517_10028513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	6649
3300028786|Ga0307517_10030551	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	6308
3300028786|Ga0307517_10044403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4701
3300028786|Ga0307517_10052998	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4050
3300028786|Ga0307517_10055130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3910
3300028786|Ga0307517_10055130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3910
3300028786|Ga0307517_10066827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3301
3300028786|Ga0307517_10081653	Not Available	2753
3300028786|Ga0307517_10087595	All Organisms → cellular organisms → Eukaryota	2585
3300028786|Ga0307517_10144324	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1657
3300028786|Ga0307517_10177655	Not Available	1382
3300028786|Ga0307517_10207446	Not Available	1213
3300028786|Ga0307517_10225050	Not Available	1134
3300028794|Ga0307515_10012436	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16011
3300028794|Ga0307515_10014574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14554
3300028794|Ga0307515_10031931	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8747
3300028794|Ga0307515_10035470	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8112
3300028794|Ga0307515_10039836	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7455
3300028794|Ga0307515_10044307	Not Available	6877
3300028794|Ga0307515_10051919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6097
3300028794|Ga0307515_10052747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6021
3300028794|Ga0307515_10063826	Not Available	5162
3300028794|Ga0307515_10082658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4149
3300028794|Ga0307515_10098784	Not Available	3551
3300028794|Ga0307515_10137201	Not Available	2650
3300028794|Ga0307515_10168866	Not Available	2191
3300028794|Ga0307515_10201137	Not Available	1867
3300028794|Ga0307515_10493651	Not Available	835
3300028794|Ga0307515_10591955	Not Available	719
3300028794|Ga0307515_10936920	Not Available	500
3300030521|Ga0307511_10058626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2973
3300030521|Ga0307511_10063554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2786
3300030521|Ga0307511_10092828	Not Available	2032
3300030521|Ga0307511_10380732	Not Available	590
3300030521|Ga0307511_10388204	Not Available	580
3300030521|Ga0307511_10409026	Not Available	554
3300030522|Ga0307512_10135114	Not Available	1531
3300030522|Ga0307512_10230100	Not Available	954
3300030522|Ga0307512_10230881	Not Available	951
3300030522|Ga0307512_10347370	Not Available	656
3300030522|Ga0307512_10367635	Not Available	623
3300030522|Ga0307512_10461015	Not Available	509
3300031456|Ga0307513_10028703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6355
3300031456|Ga0307513_10051192	All Organisms → cellular organisms → Eukaryota	4457
3300031456|Ga0307513_10058469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4097
3300031456|Ga0307513_10060536	Not Available	4014
3300031456|Ga0307513_10066771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3777
3300031456|Ga0307513_10073150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3569
3300031456|Ga0307513_10159983	Not Available	2146
3300031456|Ga0307513_10173150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2033
3300031456|Ga0307513_10203450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1818
3300031456|Ga0307513_10251567	Not Available	1563
3300031456|Ga0307513_10259540	Not Available	1528
3300031507|Ga0307509_10038489	Not Available	5216
3300031507|Ga0307509_10049477	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	4506
3300031507|Ga0307509_10136158	Not Available	2401
3300031507|Ga0307509_10151986	Not Available	2228
3300031507|Ga0307509_10160760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2144
3300031507|Ga0307509_10183715	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1952
3300031507|Ga0307509_10198807	Not Available	1844
3300031507|Ga0307509_10199587	Not Available	1839
3300031507|Ga0307509_10233586	Not Available	1639
3300031507|Ga0307509_10254852	Not Available	1535
3300031507|Ga0307509_10301209	Not Available	1351
3300031507|Ga0307509_10461396	Not Available	962
3300031507|Ga0307509_10588739	Not Available	786
3300031616|Ga0307508_10095539	Not Available	2563
3300031616|Ga0307508_10133742	Not Available	2083
3300031616|Ga0307508_10133742	Not Available	2083
3300031616|Ga0307508_10526907	Not Available	778
3300031616|Ga0307508_10694737	Not Available	626
3300031649|Ga0307514_10004530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12763
3300031649|Ga0307514_10131047	Not Available	1726
3300031649|Ga0307514_10194592	Not Available	1285
3300031649|Ga0307514_10278339	Not Available	960
3300031649|Ga0307514_10326258	Not Available	838
3300031649|Ga0307514_10345209	Not Available	798
3300031649|Ga0307514_10366695	Not Available	757
3300031649|Ga0307514_10554678	Not Available	529
3300031730|Ga0307516_10101602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	2691
3300031730|Ga0307516_10105122	Not Available	2635
3300031730|Ga0307516_10224991	Not Available	1583
3300031730|Ga0307516_10637244	Not Available	720
3300031730|Ga0307516_10742662	Not Available	640
3300031838|Ga0307518_10030713	Not Available	3892
3300032354|Ga0325403_1002833	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	15539
3300032354|Ga0325403_1002974	Not Available	15277
3300032354|Ga0325403_1003860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	13785
3300032354|Ga0325403_1011555	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8368
3300032354|Ga0325403_1023695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5427
3300032354|Ga0325403_1036581	Not Available	3900
3300032354|Ga0325403_1042737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	3407
3300032354|Ga0325403_1049326	Not Available	2970
3300032354|Ga0325403_1050095	Not Available	2922
3300032354|Ga0325403_1079008	Not Available	1694
3300032354|Ga0325403_1086423	Not Available	1488
3300032354|Ga0325403_1087121	Not Available	1469
3300032354|Ga0325403_1121187	Not Available	879
3300032355|Ga0325401_1068687	Not Available	2383
3300032374|Ga0325400_1111366	Not Available	1693
3300032389|Ga0325405_1001363	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24769
3300032389|Ga0325405_1016474	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6749
3300032389|Ga0325405_1040626	Not Available	3175
3300032389|Ga0325405_1052539	Not Available	2379
3300032389|Ga0325405_1071173	Not Available	1537
3300032389|Ga0325405_1114848	Not Available	665
3300032735|Ga0325410_1031930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	4171
3300033160|Ga0325402_1068614	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	2011
3300033179|Ga0307507_10013007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10181
3300033179|Ga0307507_10036444	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5028
3300033179|Ga0307507_10099575	Not Available	2441
3300033179|Ga0307507_10154170	Not Available	1718
3300033179|Ga0307507_10391734	Not Available	794
3300033180|Ga0307510_10041070	Not Available	5065
3300033180|Ga0307510_10059530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3942
3300033180|Ga0307510_10137097	Not Available	2101
3300033180|Ga0307510_10173455	Not Available	1731
3300033180|Ga0307510_10481005	Not Available	683

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	80.99%
Wood	Host-Associated → Plants → Wood	19.01%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	80.99%
Unclassified	Host-Associated → Plants → Wood → Unclassified	19.01%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	80.99%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	19.01%

Habitat

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	80.99%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	19.01%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated
3300033160	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3	Host-Associated
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100089963	3300028786	Ectomycorrhiza	MGLAATSRPRALGLAATPNPRALDVSLVVRPCHESVTTK
Ga0307517_1001211812	3300028786	Ectomycorrhiza	VVLAATLCLRALSLAATPDRRALDLGLAARSCHESLITK
Ga0307517_100168011	3300028786	Ectomycorrhiza	VDIAATRDPRVLGLAATPNPKALDVDLAARWCHESVITK
Ga0307517_100285139	3300028786	Ectomycorrhiza	VGLAATSGSRVLGLAATLDPRALDVGMAAKPCHESMITK
Ga0307517_100305513	3300028786	Ectomycorrhiza	MGLAATSGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307517_100444035	3300028786	Ectomycorrhiza	VNLAATPSLRALGLAAAPDPRALDVGLTARLCHKSVIIK
Ga0307517_100529984	3300028786	Ectomycorrhiza	VDLAATPSPRALGLAATSDPRALNVGFAARSCHESVITK
Ga0307517_100551305	3300028786	Ectomycorrhiza	VGLAATPSLRALGLAATPDPRALDVSLTARLCHESVITK
Ga0307517_100551306	3300028786	Ectomycorrhiza	MGLAATPGSKAFGLAATPDLRALDVGLAAGLCHESVITK
Ga0307517_100668275	3300028786	Ectomycorrhiza	VGLAVTPGSRALSLAATLDPRALKMGLTTRSCHESVITK
Ga0307517_100816533	3300028786	Ectomycorrhiza	VGLVATPGSRALGLAATLDPRALDVSLIVKPCHESVITK
Ga0307517_100875951	3300028786	Ectomycorrhiza	VGLTTTSSPRALSLAATSDPRALDVGLAIRQCHESVITK
Ga0307517_101443242	3300028786	Ectomycorrhiza	VSLTATPGPRALGLAAPPDPRALDVGRAARLCHESVITK
Ga0307517_101776552	3300028786	Ectomycorrhiza	MGLDTTPGPRALSPATTQDPRALDVGLAARSCHESVITK
Ga0307517_102074463	3300028786	Ectomycorrhiza	VGLAATPIPRALGLATTPDPRALDVDLIVKSCHESVITK
Ga0307517_102250502	3300028786	Ectomycorrhiza	VGLTATSDPRALSLAATPDPKALDVDLAVKSCHESMMTK
Ga0307515_1001243610	3300028794	Ectomycorrhiza	MAATRDPRALGLAATPNPKALDVDLAARSCHESVITK
Ga0307515_1001457411	3300028794	Ectomycorrhiza	VVLAATLCLRALSLAATPDRRALDVGLAARSCHESLITK
Ga0307515_100319318	3300028794	Ectomycorrhiza	VGLAATPIPRALGLAATPDPRALGLGLTVRSCHESVITK
Ga0307515_100354704	3300028794	Ectomycorrhiza	VDLAATPSSKVLGLAATLNPRALDVGLTARSCHESVITK
Ga0307515_100398361	3300028794	Ectomycorrhiza	MDLTATSSPRALGLTATPNPRALDLGLAAKLWHESVITK
Ga0307515_100443073	3300028794	Ectomycorrhiza	VDLAATPSTRVLGLTATPDPRAMDIGLTARSCHESVITK
Ga0307515_100519195	3300028794	Ectomycorrhiza	VSLTTTPDPKALSLAATPNPGALDVATRSCHENVITK
Ga0307515_100527475	3300028794	Ectomycorrhiza	VNLAATPSLRAFGLAAAPDPRALDVGLTARLCHKSAIIK
Ga0307515_100638261	3300028794	Ectomycorrhiza	VDLAATPSSRALSLAATLDPRALDVDLTARSSHESVITK
Ga0307515_100826582	3300028794	Ectomycorrhiza	VGLATTPSLRALGLAATPNPRALDVSLTARLCHESVITK
Ga0307515_100987842	3300028794	Ectomycorrhiza	VSLAATPGSVALGLIETLDPRALDVSLTARACHKSVITK
Ga0307515_101372011	3300028794	Ectomycorrhiza	VGLATTPGPRALGLVATPDPRALDVAARPCYESVITK
Ga0307515_101688663	3300028794	Ectomycorrhiza	MDLTATPGPKALGLAATPNPRVLDVGLTARSCHENMITK
Ga0307515_102011372	3300028794	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPGALEVGLATRSYHESVITK
Ga0307515_104936511	3300028794	Ectomycorrhiza	VSLAATPSLRALSLATTLDPRAFDASLIAMPCYESVMTKLKKINIKK
Ga0307515_105919551	3300028794	Ectomycorrhiza	LPATSGPRTLGLVATPDPRALDMGLATRSCHESMITK
Ga0307515_109369201	3300028794	Ectomycorrhiza	VDLAATSSPRALGLAATPDPIALDVGLAARSCHESVITR
Ga0307511_100586263	3300030521	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPRALKIGLATRSCHESVITK
Ga0307511_100635543	3300030521	Ectomycorrhiza	VGLAATPSPRALGLAATPDPRALDVGLAARLYHKSVTTK
Ga0307511_100928281	3300030521	Ectomycorrhiza	MAAKRDPIALGLAATPNPKALDVDLAARSCYESVITK
Ga0307511_103807321	3300030521	Ectomycorrhiza	MGLAVTSRPRALGLAATPNPRALDVSLVVRPCHESMTTK
Ga0307511_103882041	3300030521	Ectomycorrhiza	VGLASTPIPRALGLAATPDPRALGLGLTVRSCHESVITK
Ga0307511_104090261	3300030521	Ectomycorrhiza	DLAATPSSRVLGLAATLDPRTLDVGLTARSCHESVITK
Ga0307512_101351141	3300030522	Ectomycorrhiza	VDLVATLGSKVFGLAATPDLRALDVGLAARSCHESVITK
Ga0307512_102301002	3300030522	Ectomycorrhiza	VGLPATSGPRTLGLVATPDPRALDMGLATRSCHESMITK
Ga0307512_102308812	3300030522	Ectomycorrhiza	MGLAATSRPRALGLAATPNPRALDVSLVVRSCHESVTTK
Ga0307512_103473702	3300030522	Ectomycorrhiza	LVATPGSRALGLAATLDPRALDVSLIVKPCHESVITK
Ga0307512_103676351	3300030522	Ectomycorrhiza	LAATPGPXTFSLAATPDPRALDVDLAARPYHESVITK
Ga0307512_104610151	3300030522	Ectomycorrhiza	VDLAATPSSRALSLAATLDPRALDVDLTARSGHESVITK
Ga0307513_100287037	3300031456	Ectomycorrhiza	VDLIATSNPRALSLATTSDPRALDVGLATRSCHESVITK
Ga0307513_100511922	3300031456	Ectomycorrhiza	LHDSSLSGFAATPGPRASSLAATQDSRALNVGLAARSCHESIITK
Ga0307513_100584692	3300031456	Ectomycorrhiza	MGLTATSRPRALDLAATPNPRALDVSLVVRPCHESVTTK
Ga0307513_100605364	3300031456	Ectomycorrhiza	VGLAATPSPRALGLAATPDPRALDVGLAARLCHKSVITK
Ga0307513_100667713	3300031456	Ectomycorrhiza	MAATRDPIALGLAATPNPKALDVDLAARSCYESVITK
Ga0307513_100731501	3300031456	Ectomycorrhiza	VGLAATLGLRALGLAATPDPKAFDVSLTARLCHKSVITK
Ga0307513_101599833	3300031456	Ectomycorrhiza	VGIAVTLGSRALSLAATLDPRALEVGLATRSCHENVITK
Ga0307513_101731503	3300031456	Ectomycorrhiza	VSLTATPGPRALGLAAPPDPTALDVGRAARLCHESVITK
Ga0307513_102034503	3300031456	Ectomycorrhiza	VDLAATSSPRALGLAATPDPIALDVSLAARSCHESVITR
Ga0307513_102515672	3300031456	Ectomycorrhiza	VGLAATSIPRALGLAATPDPRALGLGLTVRSCHESVITK
Ga0307513_102595402	3300031456	Ectomycorrhiza	VGLATTSGARALSLAATSDPRALDVGLTIRQCHESVITK
Ga0307509_100384891	3300031507	Ectomycorrhiza	VDLAATPSSRALGLAATLDPRTLDVGLTARSCHESVITK
Ga0307509_100494771	3300031507	Ectomycorrhiza	VSLTATPGPRALGLTAPPDPRALDVGRAARLCHESVITK
Ga0307509_101361581	3300031507	Ectomycorrhiza	VGLAVTSGSRALSLAATPDPGALEVGLATRSYHESVITK
Ga0307509_101519862	3300031507	Ectomycorrhiza	VGLTTISGSRALSLAATSDPRALDVGLAIRQCHESVITK
Ga0307509_101607601	3300031507	Ectomycorrhiza	VGLAATRGLRALGLAATPDPKAFDVSLTARLCHKSVITK
Ga0307509_101837153	3300031507	Ectomycorrhiza	VGLAATPSPRALGPDPRALDVGLAARSCHKSVTTK
Ga0307509_101988073	3300031507	Ectomycorrhiza	VSLTTTPDPKALSLAATPNPRALDVATRSCHENVITK
Ga0307509_101995872	3300031507	Ectomycorrhiza	VSLAATPGSVALGLIETLDPRALDVSLTARACHKSMITK
Ga0307509_102335861	3300031507	Ectomycorrhiza	MGLAATPGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307509_102548522	3300031507	Ectomycorrhiza	VGLTVTPGSRALSLAATLDPRALKMGLTTRSCHESVITK
Ga0307509_103012091	3300031507	Ectomycorrhiza	VGLAATPSPRALGLAATPDPRALDVGLAARLCHKSVTTK
Ga0307509_104613961	3300031507	Ectomycorrhiza	VGLAATPCSKAFGLAATPDLRALDVGLAARLCHENVISK
Ga0307509_105887391	3300031507	Ectomycorrhiza	MAAKRDPRALGLAATPNPKALDVDLAARSCHESVITK
Ga0307508_100955391	3300031616	Ectomycorrhiza	VDLAATPSPRVLGLTATPDPRAMDIGLTARSCHESVITK
Ga0307508_101337421	3300031616	Ectomycorrhiza	VDLVATLGSKAFGLATTPDLRALDVGLAARSYHESMITK
Ga0307508_101337422	3300031616	Ectomycorrhiza	VGLAATIGLRALGLAATPDPKAFDVSLTARLCHKSVITK
Ga0307508_105269071	3300031616	Ectomycorrhiza	VGLAATPDSVALGLLETLDPRALDVSLTARPCYKSVITK
Ga0307508_106947371	3300031616	Ectomycorrhiza	AATSGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307514_100045307	3300031649	Ectomycorrhiza	VGLTATPSPRALGLAATPDPRALNVGLAARLCHKSVTTK
Ga0307514_101310474	3300031649	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPRALEIGLATRSCHESVM
Ga0307514_101945921	3300031649	Ectomycorrhiza	VGLPATSGPRTLGLVATPDPRALDVGLATRSCHESMITK
Ga0307514_102783391	3300031649	Ectomycorrhiza	VGLAATPCSKAFGLAATPDLRALDVGLAARLCHENVITK
Ga0307514_103262581	3300031649	Ectomycorrhiza	VDLTATLGLRALGLAATPDPRAFDVSLTARLCHKSVITK
Ga0307514_103452091	3300031649	Ectomycorrhiza	VGLAVTPSSRALSLAATPDPRALEVGLATRSCHESVITK
Ga0307514_103666951	3300031649	Ectomycorrhiza	VDVAATLGPIALGPAVTLDPRVLDVDLTVRSCHESVITK
Ga0307514_105546781	3300031649	Ectomycorrhiza	VSLTATPGPRALGLAAPPDPRALDVGRAAKLCHESVITK
Ga0307516_101016021	3300031730	Ectomycorrhiza	MGLAATPIPRALGLATTPDPRALDVGLTVRLCHESVITK
Ga0307516_101051221	3300031730	Ectomycorrhiza	VDLTATPSPRALGLAATPNPRALDVGLTAESCHESVITK
Ga0307516_102249912	3300031730	Ectomycorrhiza	VGLVATPSSRALGLAATLDPRALDVSLIVKPCHESVITK
Ga0307516_106372441	3300031730	Ectomycorrhiza	VDLAATPSSRALGLAATLDPRTLDVGLTARSCHESVITKYKKN
Ga0307516_107426622	3300031730	Ectomycorrhiza	VGLATTPSLRALGLAATPNPRALDVSLTARLYHESVITK
Ga0307518_100307133	3300031838	Ectomycorrhiza	VDLTTTPSPKALGLVATPDPRALDVGLATRSCHESVITK
Ga0325403_10028331	3300032354	Xylem	VCLAATPGSKAFGLAATPDLRALDVGLAVRLCYESVITK
Ga0325403_10029748	3300032354	Xylem	VDVAAMSGLRALGLAVTLDPRVLDVDLTAKLCHESVITK
Ga0325403_10038606	3300032354	Xylem	VDLTVTLSLRALGLTATPDPRALDVGLAARSYHKSVIAK
Ga0325403_10115558	3300032354	Xylem	VDLAATSGPRALSLAATSDPRALDVGLAVRQCHESVITK
Ga0325403_10236951	3300032354	Xylem	MSLAATPGPKALGLATMPGPRALDLGLTARLCHENVITK
Ga0325403_10365812	3300032354	Xylem	LHDSSLNGFAATPGSRASSLAATQDPGALNVGLVARSCHESVITK
Ga0325403_10427372	3300032354	Xylem	VVLAAILCLRALSLAATPDRRALDVGLAARSCHESLITK
Ga0325403_10493262	3300032354	Xylem	VGLAAIPSPRALGLAATPDPRALDVGLAARLCHKSMTTK
Ga0325403_10500951	3300032354	Xylem	VGLAATPSPRALGLAATPDPRALDVGLAARLYHKSVITK
Ga0325403_10790081	3300032354	Xylem	VGLTATSGPRALGLAATPDPRALDVGLAARSCHESMITK
Ga0325403_10864232	3300032354	Xylem	VSLAATPSSVALGLIETPDPRTLDVSLTARPHHKKVITK
Ga0325403_10871211	3300032354	Xylem	VSLAATPGSVALGLIETPDPKTLDVSLTARPHHKKVITK
Ga0325403_11211871	3300032354	Xylem	VDLAATPCPRAVGLAVTPDPRALDVDLAARSCHENVITK
Ga0325401_10686871	3300032355	Xylem	VSLFAMPGPRALGLTAISDSRALDVSLVARSCHESVITK
Ga0325400_11113663	3300032374	Xylem	VGLTATSGPRALGLAATPDPRALDVGLAARPCHESMITK
Ga0325405_10013633	3300032389	Xylem	VDLAATPCPRAVGLAVTPNPRALDVDLAARSCHENVITK
Ga0325405_10164747	3300032389	Xylem	VNLAATPNPRALGLATTPDPRALDVGLVARSCNENMINK
Ga0325405_10406261	3300032389	Xylem	VNLAVTPCPKAVGLAATLDPRALDVDLATRSCHENMITK
Ga0325405_10525393	3300032389	Xylem	MSLAATSGPKALNLITTPDPRALDVGLTARLCHKNVITK
Ga0325405_10711731	3300032389	Xylem	VGLAATPSLRVLGLASTPDPRALDVSLTVRLCHESVITK
Ga0325405_11148481	3300032389	Xylem	VCLAATSGSKTFGLAATPDLRALDVGLAVKLCYESVITK
Ga0325410_10319301	3300032735	Xylem	MSLAATSGPKALNLVTTPDPRALDVGLTARLCHKNVITK
Ga0325402_10686141	3300033160	Xylem	DLAITSGSRALCLAATPEPRVLNVSLAARSCHESVINK
Ga0307507_100130072	3300033179	Ectomycorrhiza	VDIAATRDPRALGLAATPNPKALDVDLAARWCHESVITK
Ga0307507_100364445	3300033179	Ectomycorrhiza	VGLAATSGSRVLGLAATLDPRALDVGLAAKPCHESMITK
Ga0307507_100995753	3300033179	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPRALEIGLATRSCHESVITK
Ga0307507_101541702	3300033179	Ectomycorrhiza	VGLVTTPSLKASGLATTPNPRALDVSLTARLCHESVITK
Ga0307507_103917341	3300033179	Ectomycorrhiza	GLATTSGSVALGLIETRDQRALDVSLTARPCHKSVITK
Ga0307510_100410701	3300033180	Ectomycorrhiza	VDLAATPSSRVLGLAATLDPRTLDVGLTARSCHESVITK
Ga0307510_100595301	3300033180	Ectomycorrhiza	VDIAATRDPRALGLAATPNPKALDVDLAARWCHESV
Ga0307510_101370972	3300033180	Ectomycorrhiza	MGLAATLGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307510_101734551	3300033180	Ectomycorrhiza	VSLAATSDPRALSLAATPDPKALDVDLAVKSCHESMMTK
Ga0307510_104810052	3300033180	Ectomycorrhiza	VGLTTISGPRALSLAATSDPRALDVGLAIRQCHESVITK