Basic Information | |
---|---|
Family ID | F071686 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 45 residues |
Representative Sequence | ITVDYKDGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.82 % |
% of genes near scaffold ends (potentially truncated) | 99.18 % |
% of genes from short scaffolds (< 2000 bps) | 94.26 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (59.016 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.574 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.049 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.705 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 11.43% Coil/Unstructured: 70.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF02653 | BPD_transp_2 | 57.38 |
PF00005 | ABC_tran | 1.64 |
PF02504 | FA_synthesis | 0.82 |
PF05192 | MutS_III | 0.82 |
PF01425 | Amidase | 0.82 |
PF00732 | GMC_oxred_N | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.82 |
COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.82 |
COG0416 | Acyl-ACP:phosphate acyltransferase (fatty acid/phospholipid biosynthesis) | Lipid transport and metabolism [I] | 0.82 |
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 59.02 % |
All Organisms | root | All Organisms | 40.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459003|FZ032L002J4MZE | Not Available | 521 | Open in IMG/M |
2170459007|GJ61VE201B8QBQ | Not Available | 502 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_101904954 | Not Available | 585 | Open in IMG/M |
3300000559|F14TC_105254874 | Not Available | 562 | Open in IMG/M |
3300000956|JGI10216J12902_104604006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1557 | Open in IMG/M |
3300003993|Ga0055468_10069893 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
3300004081|Ga0063454_102075519 | Not Available | 504 | Open in IMG/M |
3300004156|Ga0062589_100050775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2319 | Open in IMG/M |
3300004463|Ga0063356_101458282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1011 | Open in IMG/M |
3300005169|Ga0066810_10001521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2460 | Open in IMG/M |
3300005187|Ga0066675_10786499 | Not Available | 718 | Open in IMG/M |
3300005338|Ga0068868_101996274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 551 | Open in IMG/M |
3300005436|Ga0070713_101369525 | Not Available | 686 | Open in IMG/M |
3300005438|Ga0070701_10515295 | Not Available | 779 | Open in IMG/M |
3300005440|Ga0070705_100326568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 1110 | Open in IMG/M |
3300005441|Ga0070700_100663981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 825 | Open in IMG/M |
3300005441|Ga0070700_101288621 | Not Available | 614 | Open in IMG/M |
3300005466|Ga0070685_10872442 | Not Available | 668 | Open in IMG/M |
3300005526|Ga0073909_10557997 | Not Available | 561 | Open in IMG/M |
3300005538|Ga0070731_10919489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 580 | Open in IMG/M |
3300005718|Ga0068866_10751127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 674 | Open in IMG/M |
3300005718|Ga0068866_10817745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 649 | Open in IMG/M |
3300005719|Ga0068861_101115991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 759 | Open in IMG/M |
3300005840|Ga0068870_11434784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 506 | Open in IMG/M |
3300005886|Ga0075286_1067683 | Not Available | 520 | Open in IMG/M |
3300006041|Ga0075023_100145797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 867 | Open in IMG/M |
3300006051|Ga0075364_10874063 | Not Available | 612 | Open in IMG/M |
3300006163|Ga0070715_10522331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 683 | Open in IMG/M |
3300006573|Ga0074055_11326774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1268 | Open in IMG/M |
3300006846|Ga0075430_101453324 | Not Available | 563 | Open in IMG/M |
3300006953|Ga0074063_13968640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1173 | Open in IMG/M |
3300007076|Ga0075435_100181527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1779 | Open in IMG/M |
3300009101|Ga0105247_10042205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 2793 | Open in IMG/M |
3300010362|Ga0126377_11875459 | Not Available | 675 | Open in IMG/M |
3300010362|Ga0126377_12615761 | Not Available | 580 | Open in IMG/M |
3300010376|Ga0126381_105136475 | Not Available | 501 | Open in IMG/M |
3300010400|Ga0134122_10195541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1674 | Open in IMG/M |
3300010403|Ga0134123_11189853 | Not Available | 792 | Open in IMG/M |
3300010403|Ga0134123_11358279 | Not Available | 749 | Open in IMG/M |
3300010865|Ga0126346_1342179 | Not Available | 533 | Open in IMG/M |
3300011969|Ga0120166_1013449 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300012212|Ga0150985_111155319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 1248 | Open in IMG/M |
3300012350|Ga0137372_10739896 | Not Available | 709 | Open in IMG/M |
3300012355|Ga0137369_11147995 | Not Available | 504 | Open in IMG/M |
3300012519|Ga0157352_1079081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 547 | Open in IMG/M |
3300012892|Ga0157294_10310407 | Not Available | 508 | Open in IMG/M |
3300012893|Ga0157284_10042189 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300012907|Ga0157283_10115058 | Not Available | 743 | Open in IMG/M |
3300012912|Ga0157306_10157598 | Not Available | 724 | Open in IMG/M |
3300012916|Ga0157310_10004734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 3059 | Open in IMG/M |
3300012951|Ga0164300_11170385 | Not Available | 507 | Open in IMG/M |
3300012957|Ga0164303_11291332 | Not Available | 539 | Open in IMG/M |
3300012964|Ga0153916_10956312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 937 | Open in IMG/M |
3300012985|Ga0164308_10836108 | Not Available | 806 | Open in IMG/M |
3300012986|Ga0164304_11349081 | Not Available | 583 | Open in IMG/M |
3300012987|Ga0164307_10683306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 802 | Open in IMG/M |
3300014326|Ga0157380_10174804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1880 | Open in IMG/M |
3300015373|Ga0132257_100797453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 1179 | Open in IMG/M |
3300015374|Ga0132255_100805240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1401 | Open in IMG/M |
3300015374|Ga0132255_104560093 | Not Available | 587 | Open in IMG/M |
3300017939|Ga0187775_10123409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 895 | Open in IMG/M |
3300018058|Ga0187766_10194778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 1278 | Open in IMG/M |
3300018089|Ga0187774_11281333 | Not Available | 530 | Open in IMG/M |
3300018429|Ga0190272_13244314 | Not Available | 507 | Open in IMG/M |
3300018466|Ga0190268_11064883 | Not Available | 653 | Open in IMG/M |
3300018469|Ga0190270_12126311 | Not Available | 621 | Open in IMG/M |
3300019232|Ga0180114_1371946 | Not Available | 536 | Open in IMG/M |
3300021081|Ga0210379_10295280 | Not Available | 708 | Open in IMG/M |
3300022737|Ga0247747_1032182 | Not Available | 613 | Open in IMG/M |
3300022903|Ga0247774_1039687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 1161 | Open in IMG/M |
3300024055|Ga0247794_10016481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1789 | Open in IMG/M |
3300024232|Ga0247664_1076987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 770 | Open in IMG/M |
3300025464|Ga0208076_1089944 | Not Available | 529 | Open in IMG/M |
3300025619|Ga0207926_1115281 | Not Available | 639 | Open in IMG/M |
3300025891|Ga0209585_10155435 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
3300025903|Ga0207680_10737097 | Not Available | 706 | Open in IMG/M |
3300025915|Ga0207693_10021237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5160 | Open in IMG/M |
3300025918|Ga0207662_11245084 | Not Available | 529 | Open in IMG/M |
3300025935|Ga0207709_10973146 | Not Available | 693 | Open in IMG/M |
3300025961|Ga0207712_10367039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 1201 | Open in IMG/M |
3300025986|Ga0207658_11865180 | Not Available | 548 | Open in IMG/M |
3300026062|Ga0208654_1026515 | Not Available | 729 | Open in IMG/M |
3300026075|Ga0207708_10947615 | Not Available | 746 | Open in IMG/M |
3300026116|Ga0207674_12008340 | Not Available | 543 | Open in IMG/M |
3300026118|Ga0207675_101509270 | Not Available | 693 | Open in IMG/M |
3300026121|Ga0207683_10026877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 4972 | Open in IMG/M |
3300026121|Ga0207683_11709825 | Not Available | 578 | Open in IMG/M |
3300026142|Ga0207698_10265383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1579 | Open in IMG/M |
3300027869|Ga0209579_10416333 | Not Available | 729 | Open in IMG/M |
3300028379|Ga0268266_11070314 | Not Available | 780 | Open in IMG/M |
3300028381|Ga0268264_10871788 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300028577|Ga0265318_10299905 | Not Available | 586 | Open in IMG/M |
3300028715|Ga0307313_10056865 | Not Available | 1153 | Open in IMG/M |
3300028771|Ga0307320_10160543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter medicamentivorans | 872 | Open in IMG/M |
3300028791|Ga0307290_10195571 | Not Available | 741 | Open in IMG/M |
3300030917|Ga0075382_11458079 | Not Available | 515 | Open in IMG/M |
3300031170|Ga0307498_10486635 | Not Available | 502 | Open in IMG/M |
3300031226|Ga0307497_10715907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus | 518 | Open in IMG/M |
3300031231|Ga0170824_112281966 | Not Available | 515 | Open in IMG/M |
3300031231|Ga0170824_128649407 | Not Available | 509 | Open in IMG/M |
3300031474|Ga0170818_109231530 | Not Available | 502 | Open in IMG/M |
3300031521|Ga0311364_11674660 | Not Available | 627 | Open in IMG/M |
3300031680|Ga0318574_10385770 | Not Available | 818 | Open in IMG/M |
3300031716|Ga0310813_10448737 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
3300031854|Ga0310904_10286794 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
3300031860|Ga0318495_10319268 | Not Available | 690 | Open in IMG/M |
3300031894|Ga0318522_10265087 | Not Available | 651 | Open in IMG/M |
3300031902|Ga0302322_100466469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1463 | Open in IMG/M |
3300031912|Ga0306921_11527482 | Not Available | 729 | Open in IMG/M |
3300031996|Ga0308176_12301193 | Not Available | 575 | Open in IMG/M |
3300032010|Ga0318569_10524223 | Not Available | 552 | Open in IMG/M |
3300032013|Ga0310906_11119813 | Not Available | 570 | Open in IMG/M |
3300032055|Ga0318575_10118255 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
3300032075|Ga0310890_10084572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1940 | Open in IMG/M |
3300032089|Ga0318525_10013531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3742 | Open in IMG/M |
3300032122|Ga0310895_10229847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 847 | Open in IMG/M |
3300033513|Ga0316628_103534426 | Not Available | 564 | Open in IMG/M |
3300033551|Ga0247830_11680494 | Not Available | 509 | Open in IMG/M |
3300033760|Ga0314870_017205 | Not Available | 612 | Open in IMG/M |
3300033805|Ga0314864_0155199 | Not Available | 584 | Open in IMG/M |
3300034125|Ga0370484_0074830 | Not Available | 864 | Open in IMG/M |
3300034660|Ga0314781_086468 | Not Available | 613 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.56% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.46% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.46% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.46% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.46% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.46% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.46% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.46% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.46% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.64% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.64% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.64% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.64% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.64% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.64% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.64% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.64% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.82% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.82% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.82% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.82% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.82% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.82% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.82% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.82% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.82% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.82% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.82% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010865 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011969 | Permafrost microbial communities from Nunavut, Canada - A23_80cm_12M | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300022903 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6 | Environmental | Open in IMG/M |
3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300025464 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300033760 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E4A_08198720 | 2170459003 | Grass Soil | TVDYKAGAVVLKEKCFDIAPVDPAIAQTRNWEKKYNLNTGK |
L02_05366670 | 2170459007 | Grass Soil | NTDITVDYKAGAVVLKEKCFDIAPVDPAIAQTRNWEKKYNLNTGK |
INPhiseqgaiiFebDRAFT_1019049541 | 3300000364 | Soil | PNNTDITVDYKDGKVVVKEKCFNIAPVDKELAQTRIWEKKFNLNTK* |
F14TC_1052548742 | 3300000559 | Soil | DITVDYKDGKVVVXXXXXXXXPVDKELAQTRVWEKKYKLNTG* |
JGI10216J12902_1046040063 | 3300000956 | Soil | TVDYKDGKVVLKEKCFAIAAVDDELVKTRAWEKKFKLNTAK* |
Ga0055468_100698932 | 3300003993 | Natural And Restored Wetlands | NWDITVDYKDGKVVLKEKCFAIAAVDKELVQTRVWEKKFKLNTAK* |
Ga0063454_1020755192 | 3300004081 | Soil | WDITVTYKAGKVVQEDKCFGIQAVDKELTQTRAWEKQFKLNTGK* |
Ga0062589_1000507751 | 3300004156 | Soil | VDYKDGKVVLKEKCFDIAPVDKELAQTRVWEKKFNLNTK* |
Ga0063356_1014582822 | 3300004463 | Arabidopsis Thaliana Rhizosphere | WYFGKGLKAHIPNNWDITVSYSGGKVVQVEKCFAIAAVDKDLVATRAAEKKFKLNTAK* |
Ga0066810_100015214 | 3300005169 | Soil | TVTYNNGKIIVKDKCFAIAPVDNSIAQTRKWEKKYNLNTK* |
Ga0066675_107864991 | 3300005187 | Soil | DITVDYKGGQVVVKEKCFDIAAVDKSIAQTRIWEKKFKLNTG* |
Ga0068868_1019962741 | 3300005338 | Miscanthus Rhizosphere | LAYHIPNNWDITVTYKGGQVVQEDKCFAIQAVDKELTQTRAWEKQFKLNTAK* |
Ga0070713_1013695251 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NNTDITVDYKGGNVVVRTGCTAIAAVDKQLTQTRAWEKKYHLNTGK* |
Ga0070701_105152952 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | PNNTDITVTYKAGEVVTEDKCIPIQAVDPELTQTRKWETQFNLNTGK* |
Ga0070705_1003265682 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DITVDYKGGKVVLKEKCFDIAPVDKELAQTRIWEKKFNLNTK* |
Ga0070700_1006639812 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | HIPNNWDITVDYKDGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK* |
Ga0070700_1012886212 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TVDYKDGKVVLKEKCFGIAPVDRELAQTRIWEKKFNLNTK* |
Ga0070685_108724422 | 3300005466 | Switchgrass Rhizosphere | DITVDYKDGKVVKKESCFDIAAVDKELAQTRVWEKKLKLNTG* |
Ga0073909_105579971 | 3300005526 | Surface Soil | PNNTDRTVDYKDKKVVLKEKCFDIAAVDKELAQTRVWEKKFNLNTK* |
Ga0070731_109194891 | 3300005538 | Surface Soil | LPYHIPNNSDITVDYKNGQVVLKKGCTQIAAVDPEITQTRLWEKKYHLQG* |
Ga0068866_107511272 | 3300005718 | Miscanthus Rhizosphere | PYHIPNNWDITVDYKGGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK* |
Ga0068866_108177452 | 3300005718 | Miscanthus Rhizosphere | YHIPNNWDITVTYKGGQVVQEDKCFAIQAVDKELTQTRAWEKQFKLNTAK* |
Ga0068861_1011159912 | 3300005719 | Switchgrass Rhizosphere | HIPNNWDITVDYKKGKVVVKEKCFAIAAVDKSISQTRAWEKKFKLNGG* |
Ga0068870_114347841 | 3300005840 | Miscanthus Rhizosphere | YHIPNNTDITVDYKDGKVVKKESCFDIAAVDKELAQTRVWEKKLKLNTG* |
Ga0075286_10676831 | 3300005886 | Rice Paddy Soil | DGKVVKKESCFDIAAVDKELAQTRVWEKKLKLNTG* |
Ga0075023_1001457971 | 3300006041 | Watersheds | HIPNNTDITVTYKAGAVVTEDKCFAIQAVDPELTQTRAWEKQFNLNTGK* |
Ga0075364_108740631 | 3300006051 | Populus Endosphere | YKDGKVVLKEKCFAIAAVDAELVKTRAWEKKFKLNTAK* |
Ga0070715_105223311 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LPYHIPNNTDITVTYKAGKIVTEDKCFDIAPIDKQLTQTRKWEKQFNLNTGK* |
Ga0074055_113267741 | 3300006573 | Soil | VDYKDGKVVLKEKCFAIAPVDKEMAQTRVWEKKFNLNTGK* |
Ga0075430_1014533241 | 3300006846 | Populus Rhizosphere | IPNNTDITVVYDNGKLKQVDACFPIQAVDPQLKQTRVWEKKYKLNTAK* |
Ga0074063_139686402 | 3300006953 | Soil | YHIPNNWDITVDYKDGKVVLKEKCFAIAPVDKEMAQTRVWEKKFNLNTGK* |
Ga0075435_1001815271 | 3300007076 | Populus Rhizosphere | DITVDYKNGKVVVKEKCFDIAPVDKELAQTRIWEKKFNLNTK* |
Ga0105247_100422051 | 3300009101 | Switchgrass Rhizosphere | NTDITVTYKAGEVVTEDKCIPIQAVDPELTQTRKWETQFNLNTGK* |
Ga0126377_118754591 | 3300010362 | Tropical Forest Soil | NTDITVDYKNGKVVLKEKCFEIAPVDKEVAQTRVWEKKFKLNTAG* |
Ga0126377_126157611 | 3300010362 | Tropical Forest Soil | HIPNNWDITVDYKGGNVVIKEKCFPIAPVDKAITQTRAFEKKFKLN* |
Ga0126381_1051364751 | 3300010376 | Tropical Forest Soil | NALPYHIPNNTDITVDYKAGKVVVRTGCTEIYPVDKQLTQTRQWEKKYHLN* |
Ga0134122_101955411 | 3300010400 | Terrestrial Soil | KKGKVVVKEKCFAIAAVDKSISQTRAWEKKIKLNGG* |
Ga0134123_111898531 | 3300010403 | Terrestrial Soil | VGNNLPYHIPNNWDITVDYKGGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK* |
Ga0134123_113582791 | 3300010403 | Terrestrial Soil | PNNWDITVDYKDGKVVLKEKCFAIAPVDKEMAQTRVWEKKFNLNTGK* |
Ga0126346_13421792 | 3300010865 | Boreal Forest Soil | VGNALPYHIPNNSDITVDYKNGQVVPKTGCTKIAAVDPEITQTRLWEQKYHLQG* |
Ga0120166_10134492 | 3300011969 | Permafrost | PWYVGNLAYHIPSNWDITVDYKAGKVVLKEKCFAIAPVDASVAQTRAWEKKFKLNG* |
Ga0150985_1111553192 | 3300012212 | Avena Fatua Rhizosphere | PLKYHIPNNWDITVTYRNGKVVLADKCFAIAPVDSEIVQTRKWERQFKLNTRK* |
Ga0137372_107398961 | 3300012350 | Vadose Zone Soil | IPNNTDITVSYADGKVVQTEKCFAIQAVDKDLVTTRAAEKKFKLNAG* |
Ga0137369_111479952 | 3300012355 | Vadose Zone Soil | GKVVVKEKCFAIAAVDKSIAQTRIWEKKFKLTSG* |
Ga0157352_10790812 | 3300012519 | Unplanted Soil | DYKDGKVVLKEKCFAIAPVDKEMAQTRVWEKKFNLNTGK* |
Ga0157294_103104071 | 3300012892 | Soil | DVVVKNGCTAIAAVDKSVAQTRIWEKKFNLNTGK* |
Ga0157284_100421892 | 3300012893 | Soil | VGNALPYHIPNNWDITVDYKGGKVVLKEKCFAIAPVDKEVAQTRVWEKKFKLNTGK* |
Ga0157283_101150581 | 3300012907 | Soil | KVGKVVLKEKCFAIAPVDKEVAQTRVWEKKFKLNTGK* |
Ga0157306_101575982 | 3300012912 | Soil | CKPWYVGNALPYHIPSNWDITVDYKDGKVVLKEKCFAIAAVDAELAQTRVWEKKFNLNTGK* |
Ga0157310_100047345 | 3300012916 | Soil | DITVDYKGGKVVLKEKCFAIAPVDKEVAQTRVWEKKFKLNTGK* |
Ga0164300_111703852 | 3300012951 | Soil | GGKVVLKEKCFAIAPVDKEVAQTRVWEKKFNLNTGK* |
Ga0164303_112913321 | 3300012957 | Soil | NNGKVVLKEKCFDIAPVDKELAQTRIWEKKFNLNTK* |
Ga0153916_109563122 | 3300012964 | Freshwater Wetlands | PNNTDITVDYKGGNVVSKEKCFDIAPVDQALTQTRAWEKKFKLNTGK* |
Ga0164308_108361081 | 3300012985 | Soil | IPNNVDITADYKGGKVVVKEPCFAIAPVDKALAQTRVFEKKLKLNTG* |
Ga0164304_113490811 | 3300012986 | Soil | NTDITVDYKDGKVVVKEKCFDIAPVDKELAQTRVWEKKYKLNTG* |
Ga0164307_106833061 | 3300012987 | Soil | KNGKVVLKEKCFEIAPVDKELAQTRAWEKKFNLNTK* |
Ga0157380_101748041 | 3300014326 | Switchgrass Rhizosphere | NNWDITVDYKDGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK* |
Ga0132257_1007974532 | 3300015373 | Arabidopsis Rhizosphere | DYKDGKVVKKESCFDIAAVDKELAQTRVWEKKLKLNTG* |
Ga0132255_1008052403 | 3300015374 | Arabidopsis Rhizosphere | YKDGKVVVKEKCFDIAPVDKEVAQTRVWEKKFKLNTG* |
Ga0132255_1045600931 | 3300015374 | Arabidopsis Rhizosphere | NNADITVDYKDGKVVVKEKCFNIGPVDKEIAQTRVWEKKYKLNTG* |
Ga0187775_101234091 | 3300017939 | Tropical Peatland | YHIPNNTDITVDYKNGAVVVKQPCFEITGATDQPIRQTRVWEKKYHLNG |
Ga0187766_101947781 | 3300018058 | Tropical Peatland | NNTDITVDYKNGAVVVKQPCFEITGATDAPIRQTRVWEKKYHLNG |
Ga0187774_112813332 | 3300018089 | Tropical Peatland | YVGNLAYHIPNNTDITVDYKNGAVVVKQPCFEITGATDAPIRQTRVWEKKYHLNG |
Ga0190272_132443142 | 3300018429 | Soil | TYKGGKVVQEDKCFAIQAVDKELTQTRAWEKQFKLNTAK |
Ga0190268_110648831 | 3300018466 | Soil | VDYKKGNVVVKEKCFAIQAVDKSIAQTRVWEKKFNLNGG |
Ga0190270_121263112 | 3300018469 | Soil | DITVTYRNGKVVEVDKCFDIAPVDKELGQTRKWEKKFKLNTAK |
Ga0180114_13719462 | 3300019232 | Groundwater Sediment | WDITVDYKDGKVVLKEKCFAIAAVDAEMAKTRVWEKKFKLQG |
Ga0210379_102952802 | 3300021081 | Groundwater Sediment | IPNNTDITVDYKNGKVVKKESCFDIAAVDKELAQTRVWEKKLKLNTG |
Ga0247747_10321821 | 3300022737 | Soil | PYHIPNNWDITVDYKGGKVVLKEKCFAIAPVDKEVAQTRVWEKKFKLNTGK |
Ga0247774_10396871 | 3300022903 | Plant Litter | VDYKNKDVVVKNGCTAIAAVDKSVAQTRVWEKKFNLNTGK |
Ga0247794_100164813 | 3300024055 | Soil | TYKNGKVVQSDKCFKVAPVDKEIAQTRVWEKKFKLN |
Ga0247664_10769872 | 3300024232 | Soil | KDGKVVVKEKCFDIAPVDKELAQTRVWEKKYKLNTG |
Ga0208076_10899442 | 3300025464 | Arctic Peat Soil | TVDYKGGQVVQKQGCFAIAAVDPQITQTRIWEKKYHLQG |
Ga0207926_11152812 | 3300025619 | Arctic Peat Soil | WYVGNLAYHIPNNNDITVDYKGGNVVTRTGCVPIAPVDAAVTQTRAWEKKFNLNTGK |
Ga0209585_101554351 | 3300025891 | Arctic Peat Soil | DITVDYKAGKVVPKEKCFAIAPVDASVAQTRVWEKKFKLNG |
Ga0207680_107370972 | 3300025903 | Switchgrass Rhizosphere | LPYHIPNNTDITVTYKAGEVVTEDKCIPIQAVDPELTQTRKWETQFNLNTGK |
Ga0207693_100212371 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NGKVVVADKCFAIAPVDSEIAQTRKWERQFKLNTGK |
Ga0207662_112450841 | 3300025918 | Switchgrass Rhizosphere | NWDITVDYKDGKVVLKEKCFAIAPVDKEMAQTRVWEKKFNLNTGK |
Ga0207709_109731462 | 3300025935 | Miscanthus Rhizosphere | TVDYKDGKVVLKEKCFAIAPVDKELAQTRIWEKKFNLNTK |
Ga0207712_103670392 | 3300025961 | Switchgrass Rhizosphere | VTYKNGKVVQSDKCFKVAPVDKEIAQTRIWEKKYKLN |
Ga0207658_118651802 | 3300025986 | Switchgrass Rhizosphere | KAGEVVTEDKCIPIQAVDPELTQTRKWETQFNLNTGK |
Ga0208654_10265151 | 3300026062 | Natural And Restored Wetlands | IGATYRNGAVVRSDACFNIQAVDREIAQTRVWEKKFKLNTAK |
Ga0207708_109476152 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | GKVVLKEKCFEIAAVDKELAQTRVWEKKFKLNTGG |
Ga0207674_120083401 | 3300026116 | Corn Rhizosphere | ITVDYKDGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK |
Ga0207675_1015092702 | 3300026118 | Switchgrass Rhizosphere | NNWDITVTYKGGKVVQEDKCFAIQAVDPELTQTRAWEKKFNLNTGK |
Ga0207683_100268771 | 3300026121 | Miscanthus Rhizosphere | GGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK |
Ga0207683_117098252 | 3300026121 | Miscanthus Rhizosphere | ITVDYKDGKVVLKEKCFAIAPVDKELAQTRIWEKKFNLNTK |
Ga0207698_102653831 | 3300026142 | Corn Rhizosphere | QGCKVVLKEKCFAIAPVDKEMAQTRVWEKKFNLNTGK |
Ga0209579_104163332 | 3300027869 | Surface Soil | YVGNALPYHIPNNSDITVDYKNGQVVLKKGCTQIAAVDPEITQTRLWEKKYHLQG |
Ga0268266_110703142 | 3300028379 | Switchgrass Rhizosphere | HIPNNTDITVDYKDGKVVKKESCFDIAAVDKELAQTRVWEKKLKLNTG |
Ga0268264_108717882 | 3300028381 | Switchgrass Rhizosphere | KGGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK |
Ga0265318_102999051 | 3300028577 | Rhizosphere | HIPNNVDITVDYKNGQVVPKQGCFQIAAVDPQIAQTRVWEKKYHLQG |
Ga0307313_100568652 | 3300028715 | Soil | AGKVVTEDKCFAIQAVDPQLTQTRAWEKQFKLNTGK |
Ga0307320_101605431 | 3300028771 | Soil | VDYKGGNVVVKEKCFAIAAVDKSIAQTRVWEKKFKLNGG |
Ga0307290_101955712 | 3300028791 | Soil | YHIPSNWDITVTYKAGKVVTEDKCFAIQAVDPQLTQTRAWEKQFKLNSGK |
Ga0075382_114580792 | 3300030917 | Soil | NALPYHIPNNWDITVDYKNGQVVQKENCFAIAPVDPQLAQTRVWEKKYHLQG |
Ga0307498_104866352 | 3300031170 | Soil | DYKDGKVVLKEKCFDIAPVDKELAQTRIWEKKFNLNTK |
Ga0307497_107159072 | 3300031226 | Soil | NTDITVDYKNGKVVLKEKCFDIAAVDPELATTRVWEKKFNLNTK |
Ga0170824_1122819662 | 3300031231 | Forest Soil | GNLAYHIPNNVDITVDYKAGNVVVRTGCTAIAPVDKAITQTRVWEKKYGLNDG |
Ga0170824_1286494071 | 3300031231 | Forest Soil | DITVDYKGGNVVLKEKCFDIAPVDPEVAQTRVWEKKYHLNG |
Ga0170818_1092315302 | 3300031474 | Forest Soil | WDITVDYKNGAVVQKQNCFAIAAVDPQIAQTRLWEKKYHLQG |
Ga0311364_116746602 | 3300031521 | Fen | PNNTDITVTYKGGQVVANEKCFNIAPVDPEIAQTRVWEKKFKLNTGK |
Ga0318574_103857702 | 3300031680 | Soil | HIPNNTDITVDYKAGTVVVKESCFAIAPVDKAIAQTRVWEKKYKLN |
Ga0310813_104487371 | 3300031716 | Soil | DITVDYKDGKVVVKEKCFDIAPVDKEVAQTRVWEKKFKLNTGK |
Ga0310904_102867941 | 3300031854 | Soil | GNALPYHIPNNWDITVDYKGGKVVLKEKCFAIAPVDKEVAQTRVWEKKFNLNTGK |
Ga0318495_103192682 | 3300031860 | Soil | NALPYHIPNNTDITVDYKSGQVVVKQGCFDIAPVDKQLTQTRVWEKKYHLN |
Ga0318522_102650871 | 3300031894 | Soil | TDITVDYKSGQVVVKQGCFDIAPVDKQLTQTRVWEKKYHLN |
Ga0302322_1004664691 | 3300031902 | Fen | NTDITVTYKGGQVVANEKCFNIAPVDPEIAQTRVWEKKFKLNTGK |
Ga0306921_115274822 | 3300031912 | Soil | VDYKNGKVVVKQKCFSIAPVDTELVKTRVFEKKFKLNTG |
Ga0308176_123011931 | 3300031996 | Soil | GNLAYHIPNNWNITVDYKDGNVVVKNKCFAIQAVDKSIAQTRTWEKKFKLQG |
Ga0318569_105242232 | 3300032010 | Soil | PYHIPNNTDITVDYKSGQVVVKQGCFDIAPVDKQLTQTRVWEKKYHLN |
Ga0310906_111198131 | 3300032013 | Soil | KPWYVGNALPYHIPVNTDITVDYKDGKVVLKEKCFDIAAVDKELAQTRVWEKKFKLNTG |
Ga0318575_101182553 | 3300032055 | Soil | YVGNALPYHIPNNTDITVDYKSGQVVVKQGCFDIAPVDKQLTQTRVWEKKYHLN |
Ga0310890_100845723 | 3300032075 | Soil | TYRNGAVVRSDACFNIQAVDSEIAQTRVWEKKFKLNTAK |
Ga0318525_100135311 | 3300032089 | Soil | DYKSGQVVVKQGCFDIAPVDKQLTQTRVWEKKYHLN |
Ga0310895_102298472 | 3300032122 | Soil | KDGKVVLKEKCFAIAAVDAELAQTRVWEKKFNLNTGK |
Ga0316628_1035344261 | 3300033513 | Soil | LPYHIPNNVNIIVDYRKGNVVQKQPCTAIAAVDKAVAQTRVWEKKYHLQG |
Ga0247830_116804941 | 3300033551 | Soil | PYHIPNNWDITVDYKGGKVVLKEKCFAIAPVDKELAQTRVWEKKFNLNTGK |
Ga0314870_017205_491_610 | 3300033760 | Peatland | VTYDKGKVVVKDKCFAIAPVDGSIAQTRKWEKKYHLNTH |
Ga0314864_0155199_473_583 | 3300033805 | Peatland | YKAGQVVVKQGCFDIYPVDKQLTQTRIWEKKYHLNG |
Ga0370484_0074830_2_166 | 3300034125 | Untreated Peat Soil | GNALPYHIPNNTDITVDYKNGQVVQKEPCFDIQAVDPQVAQTRVWEKKYHLNGS |
Ga0314781_086468_434_613 | 3300034660 | Soil | PWYVGNALPYHIPSNWDITVDYKDGKVVLKEKCFAIAAVDAELAQTRVWEKKFNLNTGK |
⦗Top⦘ |