Metagenome / Metatranscriptome Family F071587

Basic Information
Family ID	F071587
Family Type	Metagenome / Metatranscriptome
Number of Sequences	122
Average Sequence Length	36 residues
Representative Sequence	VLDLNAHGIKNTAALLGGWNGWNEAKLPIEATSKK
Number of Associated Samples	102
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	13.93 %
% of genes near scaffold ends (potentially truncated)	5.74 %
% of genes from short scaffolds (< 2000 bps)	80.33 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.27

Most Common Taxonomy
Group	Bacteria (90.164 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.934 % of family members)
Environment Ontology (ENVO)	Unclassified (34.426 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.541 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 11.11% β-sheet: 0.00% Coil/Unstructured: 88.89%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF00581	Rhodanese	53.28
PF03952	Enolase_N	9.84
PF10502	Peptidase_S26	8.20
PF00990	GGDEF	2.46
PF02082	Rrf2	2.46
PF12704	MacB_PCD	1.64
PF01464	SLT	1.64
PF02518	HATPase_c	1.64
PF01175	Urocanase	1.64
PF02223	Thymidylate_kin	1.64
PF00005	ABC_tran	1.64
PF01458	SUFBD	0.82
PF00171	Aldedh	0.82
PF00884	Sulfatase	0.82
PF01266	DAO	0.82
PF07813	LTXXQ	0.82
PF12840	HTH_20	0.82
PF15975	Flot	0.82
PF10387	DUF2442	0.82
PF00154	RecA	0.82
PF01569	PAP2	0.82
PF13474	SnoaL_3	0.82
PF12802	MarR_2	0.82
PF09992	NAGPA	0.82
PF00072	Response_reg	0.82

COG ID	Name	Functional Category	% Frequency in 122 Family Scaffolds
COG0148	Enolase	Carbohydrate transport and metabolism [G]	9.84
COG3678	Periplasmic chaperone Spy, Spy/CpxP family	Posttranslational modification, protein turnover, chaperones [O]	3.28
COG0640	DNA-binding transcriptional regulator, ArsR family	Transcription [K]	2.46
COG2524	Predicted transcriptional regulator, contains C-terminal CBS domains	Transcription [K]	2.46
COG2378	Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains	Transcription [K]	2.46
COG1414	DNA-binding transcriptional regulator, IclR family	Transcription [K]	2.46
COG1725	DNA-binding transcriptional regulator YhcF, GntR family	Transcription [K]	2.46
COG1959	DNA-binding transcriptional regulator, IscR family	Transcription [K]	2.46
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	2.46
COG2188	DNA-binding transcriptional regulator, GntR family	Transcription [K]	2.46
COG0125	Thymidylate kinase	Nucleotide transport and metabolism [F]	1.64
COG2987	Urocanate hydratase	Amino acid transport and metabolism [E]	1.64
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	0.82
COG0719	Fe-S cluster assembly scaffold protein SufB	Posttranslational modification, protein turnover, chaperones [O]	0.82
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	0.82
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	0.82
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	0.82

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	90.98 %
Unclassified	root	N/A	9.02 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	90.98 %
Unclassified	root	N/A	9.02 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	90.16 %
Unclassified	root	N/A	9.02 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	24.59 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	9.02 %
Unclassified	root	N/A	9.02 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.64 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.82 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	23.77 %
Unclassified	root	N/A	9.02 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.64 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	23.77 %
Unclassified	root	N/A	9.02 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.64 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	23.77 %
Unclassified	root	N/A	9.02 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.82 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	23.77 %
Unclassified	root	N/A	9.02 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
unclassified Myxococcales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales	0.82 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	23.77 %
Unclassified	root	N/A	9.02 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.82 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	23.77 %
Unclassified	root	N/A	9.02 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
unclassified Symbiodinium	no rank	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium	0.82 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	23.77 %
Unclassified	root	N/A	9.02 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.64 %
Symbiodinium sp. CCMP2592	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592	0.82 %
Myxococcales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	0.82 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001372\|YBBDRAFT_1171787	Not Available	928	Open in IMG/M
3300001536\|A1565W1_10571401	All Organisms → cellular organisms → Bacteria	917	Open in IMG/M
3300002155\|JGI24033J26618_1013593	All Organisms → cellular organisms → Bacteria	990	Open in IMG/M
3300005340\|Ga0070689_100110874	All Organisms → cellular organisms → Bacteria	2182	Open in IMG/M
3300005445\|Ga0070708_100439748	All Organisms → cellular organisms → Bacteria → Proteobacteria	1230	Open in IMG/M
3300005537\|Ga0070730_10346986	All Organisms → cellular organisms → Bacteria	967	Open in IMG/M
3300005552\|Ga0066701_10542645	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	715	Open in IMG/M
3300005553\|Ga0066695_10892593	All Organisms → cellular organisms → Bacteria → Proteobacteria	508	Open in IMG/M
3300005554\|Ga0066661_10529498	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	708	Open in IMG/M
3300005561\|Ga0066699_10141463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1633	Open in IMG/M
3300005561\|Ga0066699_10736897	All Organisms → cellular organisms → Bacteria	700	Open in IMG/M
3300005564\|Ga0070664_100716102	All Organisms → cellular organisms → Bacteria	933	Open in IMG/M
3300005564\|Ga0070664_101757867	All Organisms → cellular organisms → Bacteria → Proteobacteria	588	Open in IMG/M
3300005566\|Ga0066693_10101792	All Organisms → cellular organisms → Bacteria	1037	Open in IMG/M
3300005566\|Ga0066693_10136442	All Organisms → cellular organisms → Bacteria	913	Open in IMG/M
3300005569\|Ga0066705_10175351	All Organisms → cellular organisms → Bacteria	1331	Open in IMG/M
3300005575\|Ga0066702_10062853	All Organisms → cellular organisms → Bacteria	2032	Open in IMG/M
3300005587\|Ga0066654_10280368	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300005587\|Ga0066654_10834311	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300005836\|Ga0074470_10145897	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	10779	Open in IMG/M
3300005840\|Ga0068870_10019344	All Organisms → cellular organisms → Bacteria	3303	Open in IMG/M
3300005842\|Ga0068858_100000223	All Organisms → cellular organisms → Bacteria	61546	Open in IMG/M
3300005842\|Ga0068858_101713031	All Organisms → cellular organisms → Bacteria → Proteobacteria	621	Open in IMG/M
3300005892\|Ga0075275_1013288	All Organisms → cellular organisms → Bacteria	1128	Open in IMG/M
3300006028\|Ga0070717_10000068	All Organisms → cellular organisms → Bacteria	86088	Open in IMG/M
3300006032\|Ga0066696_10161033	All Organisms → cellular organisms → Bacteria	1407	Open in IMG/M
3300006173\|Ga0070716_100024017	All Organisms → cellular organisms → Bacteria	3241	Open in IMG/M
3300006237\|Ga0097621_100429110	All Organisms → cellular organisms → Bacteria	1187	Open in IMG/M
3300006358\|Ga0068871_100593529	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1007	Open in IMG/M
3300006358\|Ga0068871_100608058	All Organisms → cellular organisms → Bacteria	995	Open in IMG/M
3300006358\|Ga0068871_101441089	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300006854\|Ga0075425_100000007	All Organisms → cellular organisms → Bacteria	223104	Open in IMG/M
3300006903\|Ga0075426_10001219	All Organisms → cellular organisms → Bacteria	18203	Open in IMG/M
3300006903\|Ga0075426_10382057	All Organisms → cellular organisms → Bacteria → Proteobacteria	1038	Open in IMG/M
3300009012\|Ga0066710_102331576	All Organisms → cellular organisms → Bacteria	778	Open in IMG/M
3300009088\|Ga0099830_10539306	All Organisms → cellular organisms → Bacteria	954	Open in IMG/M
3300009088\|Ga0099830_10639280	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300009093\|Ga0105240_12725652	All Organisms → cellular organisms → Bacteria	509	Open in IMG/M
3300009098\|Ga0105245_10000010	All Organisms → cellular organisms → Bacteria	278233	Open in IMG/M
3300009098\|Ga0105245_10000376	All Organisms → cellular organisms → Bacteria	41489	Open in IMG/M
3300009098\|Ga0105245_10070195	All Organisms → cellular organisms → Bacteria	3178	Open in IMG/M
3300009098\|Ga0105245_11202070	All Organisms → cellular organisms → Bacteria → Proteobacteria	806	Open in IMG/M
3300009143\|Ga0099792_10189306	All Organisms → cellular organisms → Bacteria	1163	Open in IMG/M
3300010044\|Ga0126310_10307947	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1094	Open in IMG/M
3300010229\|Ga0136218_1017934	Not Available	769	Open in IMG/M
3300010335\|Ga0134063_10635419	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	546	Open in IMG/M
3300010337\|Ga0134062_10694750	Not Available	534	Open in IMG/M
3300010397\|Ga0134124_11524923	All Organisms → cellular organisms → Bacteria	697	Open in IMG/M
3300010403\|Ga0134123_10217351	All Organisms → cellular organisms → Bacteria	1639	Open in IMG/M
3300011269\|Ga0137392_11053717	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	667	Open in IMG/M
3300011270\|Ga0137391_10280332	All Organisms → cellular organisms → Bacteria	1440	Open in IMG/M
3300011998\|Ga0120114_1100326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557	Open in IMG/M
3300012189\|Ga0137388_10185613	All Organisms → cellular organisms → Bacteria	1866	Open in IMG/M
3300012189\|Ga0137388_10576354	Not Available	1046	Open in IMG/M
3300012204\|Ga0137374_10053605	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4123	Open in IMG/M
3300012212\|Ga0150985_102390790	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300012212\|Ga0150985_107418006	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	557	Open in IMG/M
3300012212\|Ga0150985_113322185	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	887	Open in IMG/M
3300012285\|Ga0137370_10296153	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	965	Open in IMG/M
3300012353\|Ga0137367_10076588	All Organisms → cellular organisms → Bacteria	2476	Open in IMG/M
3300012353\|Ga0137367_10981224	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	577	Open in IMG/M
3300012355\|Ga0137369_10913300	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	589	Open in IMG/M
3300012375\|Ga0134034_1063357	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300012384\|Ga0134036_1173947	Not Available	570	Open in IMG/M
3300012406\|Ga0134053_1326360	Not Available	617	Open in IMG/M
3300012469\|Ga0150984_113094577	Not Available	553	Open in IMG/M
3300012685\|Ga0137397_10980162	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	623	Open in IMG/M
3300012907\|Ga0157283_10242808	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	593	Open in IMG/M
3300012927\|Ga0137416_11465745	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300012944\|Ga0137410_10857584	Not Available	766	Open in IMG/M
3300012960\|Ga0164301_11576145	Not Available	544	Open in IMG/M
3300012961\|Ga0164302_10969961	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300013308\|Ga0157375_10000191	All Organisms → cellular organisms → Bacteria	57524	Open in IMG/M
3300013503\|Ga0120127_10028504	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1031	Open in IMG/M
3300013764\|Ga0120111_1055643	All Organisms → cellular organisms → Bacteria	982	Open in IMG/M
3300014052\|Ga0120109_1004400	All Organisms → cellular organisms → Bacteria	3179	Open in IMG/M
3300014745\|Ga0157377_11050554	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300015171\|Ga0167648_1011810	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2165	Open in IMG/M
3300017659\|Ga0134083_10389827	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	606	Open in IMG/M
3300018059\|Ga0184615_10040812	All Organisms → cellular organisms → Bacteria → Proteobacteria	2578	Open in IMG/M
3300018468\|Ga0066662_10117984	All Organisms → cellular organisms → Bacteria	1928	Open in IMG/M
3300018468\|Ga0066662_12677474	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	528	Open in IMG/M
3300018468\|Ga0066662_13005311	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300020215\|Ga0196963_10146985	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1006	Open in IMG/M
3300021358\|Ga0213873_10213296	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	602	Open in IMG/M
3300021377\|Ga0213874_10043928	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → unclassified Symbiodinium → Symbiodinium sp. CCMP2592	1348	Open in IMG/M
3300021384\|Ga0213876_10499530	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	647	Open in IMG/M
3300022756\|Ga0222622_10676650	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300023046\|Ga0233356_1011198	All Organisms → cellular organisms → Bacteria	981	Open in IMG/M
3300023268\|Ga0247765_1017766	All Organisms → cellular organisms → Bacteria	1549	Open in IMG/M
3300024177\|Ga0247686_1004099	All Organisms → cellular organisms → Bacteria	1499	Open in IMG/M
3300024246\|Ga0247680_1000372	All Organisms → cellular organisms → Bacteria	13025	Open in IMG/M
3300025481\|Ga0208079_1023235	All Organisms → cellular organisms → Bacteria	1809	Open in IMG/M
3300025908\|Ga0207643_10014998	All Organisms → cellular organisms → Bacteria	4216	Open in IMG/M
3300025909\|Ga0207705_10032504	All Organisms → cellular organisms → Bacteria	3729	Open in IMG/M
3300025912\|Ga0207707_10410088	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1162	Open in IMG/M
3300025918\|Ga0207662_10257288	All Organisms → cellular organisms → Bacteria	1148	Open in IMG/M
3300025918\|Ga0207662_10531270	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	813	Open in IMG/M
3300025919\|Ga0207657_10933325	Not Available	668	Open in IMG/M
3300025922\|Ga0207646_10329171	All Organisms → cellular organisms → Bacteria	1380	Open in IMG/M
3300025925\|Ga0207650_10000035	All Organisms → cellular organisms → Bacteria	215488	Open in IMG/M
3300025927\|Ga0207687_10025965	All Organisms → cellular organisms → Bacteria → Proteobacteria	3921	Open in IMG/M
3300025936\|Ga0207670_10277408	All Organisms → cellular organisms → Bacteria	1305	Open in IMG/M
3300025939\|Ga0207665_11080778	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	639	Open in IMG/M
3300025944\|Ga0207661_10283861	All Organisms → cellular organisms → Bacteria	1480	Open in IMG/M
3300026089\|Ga0207648_10541202	All Organisms → cellular organisms → Bacteria	1069	Open in IMG/M
3300026335\|Ga0209804_1062953	All Organisms → cellular organisms → Bacteria	1778	Open in IMG/M
3300026550\|Ga0209474_10190194	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1314	Open in IMG/M
3300027164\|Ga0208994_1004294	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1624	Open in IMG/M
3300027459\|Ga0207505_100527	All Organisms → cellular organisms → Bacteria	1986	Open in IMG/M
3300027496\|Ga0208987_1046309	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	778	Open in IMG/M
3300027831\|Ga0209797_10216613	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	811	Open in IMG/M
3300027875\|Ga0209283_10149696	All Organisms → cellular organisms → Bacteria	1547	Open in IMG/M
3300028536\|Ga0137415_10521275	All Organisms → cellular organisms → Bacteria	997	Open in IMG/M
3300029636\|Ga0222749_10192143	All Organisms → cellular organisms → Bacteria	1016	Open in IMG/M
3300029636\|Ga0222749_10833354	Not Available	504	Open in IMG/M
3300031366\|Ga0307506_10482509	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	522	Open in IMG/M
3300031446\|Ga0170820_16499106	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	527	Open in IMG/M
3300031720\|Ga0307469_12058879	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300031949\|Ga0214473_10886906	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300034143\|Ga0334961_000011	All Organisms → cellular organisms → Bacteria → Acidobacteria	127936	Open in IMG/M
3300034164\|Ga0364940_0161833	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	648	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	72.13%
Host-Associated	Host-Associated	27.05%
Engineered	Engineered	0.82%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	68.03%
Plants	Host-Associated → Plants	27.05%
Aquatic	Environmental → Aquatic	4.10%
Lab Enrichment	Engineered → Lab Enrichment	0.82%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	66.39%
Rhizosphere	Host-Associated → Plants → Rhizosphere	14.75%
Rhizoplane	Host-Associated → Plants → Rhizoplane	7.38%
Roots	Host-Associated → Plants → Roots	4.92%
Sediment	Environmental → Aquatic → Sediment	2.46%
Freshwater	Environmental → Aquatic → Freshwater	0.82%
Marine	Environmental → Aquatic → Marine	0.82%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.82%
Floodplain	Environmental → Terrestrial → Floodplain	0.82%
Unclassified	Engineered → Lab Enrichment → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.10%
Loam	Environmental → Terrestrial → Soil → Loam	10.66%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	9.84%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.92%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	3.28%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.46%
Unclassified	Host-Associated → Plants → Roots → Unclassified	1.64%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.82%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.82%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.82%
Sand	Environmental → Terrestrial → Soil → Sand	0.82%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.82%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.82%
Unclassified	Engineered → Lab Enrichment → Unclassified → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.23%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	14.75%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	9.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.02%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.74%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	4.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.92%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.92%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	3.28%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.46%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.46%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.64%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	1.64%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.82%
Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment	0.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.82%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.82%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.82%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.82%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.82%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.82%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.82%
Unclassified	Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	11.48%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.92%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	4.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.10%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.10%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	4.10%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.28%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.28%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.28%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	3.28%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.28%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.46%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.46%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.64%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.64%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.64%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	1.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.64%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.82%
Marine Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine	0.82%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.82%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.82%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.82%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.82%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.82%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.82%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.82%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.82%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.82%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.82%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.82%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.82%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.82%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.82%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.82%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.82%
Soil	Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001372	YB-Back-sed	Environmental	Open in IMG/M
3300001536	Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina	Environmental	Open in IMG/M
3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Host-Associated	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005553	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005569	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154	Environmental	Open in IMG/M
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental	Open in IMG/M
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005892	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305	Environmental	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental	Open in IMG/M
3300010044	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60	Environmental	Open in IMG/M
3300010229	Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1	Engineered	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300011998	Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012355	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG	Environmental	Open in IMG/M
3300012375	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012384	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012406	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012685	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300013503	Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M	Environmental	Open in IMG/M
3300013764	Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M	Environmental	Open in IMG/M
3300014052	Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015171	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300018059	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300020215	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5	Environmental	Open in IMG/M
3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Host-Associated	Open in IMG/M
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated	Open in IMG/M
3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Host-Associated	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300023046	Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS	Environmental	Open in IMG/M
3300023268	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L106-311C-6	Environmental	Open in IMG/M
3300024177	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27	Environmental	Open in IMG/M
3300024246	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21	Environmental	Open in IMG/M
3300025481	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental	Open in IMG/M
3300027164	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes)	Environmental	Open in IMG/M
3300027459	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A (SPAdes)	Environmental	Open in IMG/M
3300027496	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300029636	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031949	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197	Environmental	Open in IMG/M
3300034143	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS	Environmental	Open in IMG/M
3300034164	Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
YBBDRAFT_11717871	3300001372	Marine Estuarine	VLDLNAHGIENTAALLGGWNGWLEAKLATESSTVKE*
A1565W1_105714013	3300001536	Permafrost	VLDLNAHGVKNTAALLGGWNQWVSLGLPTESNIGKKKK*
JGI24033J26618_10135933	3300002155	Corn, Switchgrass And Miscanthus Rhizosphere	VLDLNAKGIKNTAALLGGWNEWKSHNLPTATTTKK*
Ga0070689_1001108742	3300005340	Switchgrass Rhizosphere	VLDLNAHKIMNTAALLGGWNEWKAAGLPTQSATPTATKK*
Ga0070708_1004397481	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	ARAVLDMNAHNIKNAAALLGGWSGWQQAKLPVEATAVKKN*
Ga0070730_103469863	3300005537	Surface Soil	VLDLNAHGIKNTAALLGGWNGWIQAKLPIVTGPNKNGPEKK*
Ga0066701_105426451	3300005552	Soil	MNAHNIKNAAALLGGWSGWQQAKLPVESTAVKKK*
Ga0066695_108925931	3300005553	Soil	MNAHNIKNAAALLGGWSGWQQAKLPVEATPVKKN*
Ga0066661_105294982	3300005554	Soil	MNAHNIKNAAALLGGWSGWQQAKLPVESAAVKKK*
Ga0066699_101414632	3300005561	Soil	VLDLNAHGIKNTAALLGGWNAWLAAGLPTEKTAEKK*
Ga0066699_107368971	3300005561	Soil	VLDLNAHGIKNAAALTGGWNGWNEARLPIEATSKK*
Ga0070664_1007161022	3300005564	Corn Rhizosphere	VLDLNAHGIKNAAALLGGWNGWNEARLPIESTPKK*
Ga0070664_1017578672	3300005564	Corn Rhizosphere	RAVLDLNAHGIKNTAALLGGWNSWVEAKLPTEKTPTK*
Ga0066693_101017922	3300005566	Soil	VLNLNAHKIMNTAALLGGWNDWKAAGLPTESAIAKK*
Ga0066693_101364422	3300005566	Soil	VLDLNAHGVKNTAALLGGWNGWLAAGLPTEKTIEKK*
Ga0066705_101753512	3300005569	Soil	VLDLNAHGIKNTADLLGGWNAWLAAGLPTEKTAEKK*
Ga0066702_100628533	3300005575	Soil	VLDLNAHGIKNAAALLGGWNGWNEAKLPIESTSKK*
Ga0066654_102803682	3300005587	Soil	VLDLNAHGIKNAAALLGGWSGWNEARLPVEATPRK*
Ga0066654_108343111	3300005587	Soil	VLDLNAHNVKNTAALLGGWNGWIAAGLPTAKTPIK*
Ga0074470_101458976	3300005836	Sediment (Intertidal)	VLDLNAHGIENTAALLGGWNGWLEAKQATESSTAKAQP*
Ga0068870_100193441	3300005840	Miscanthus Rhizosphere	ARAVLDLNAKGIKNTAALLGGWNEWKSHNLPTATTTKK*
Ga0068858_10000022347	3300005842	Switchgrass Rhizosphere	VLDLNSKGIKNTACLLGGWNAWTAANMPIEKGSK*
Ga0068858_1017130311	3300005842	Switchgrass Rhizosphere	VLDLNAHGVKNTAALLGGWNDWKAKGLPTESGLPKK*
Ga0075275_10132883	3300005892	Rice Paddy Soil	VLDLNAHKIKNTAALLGGWNGWVAAGLPTETTPMK*
Ga0070717_1000006882	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	VLDMNTHGIKNAAALLGGWNGWLQAKEPTVATPKKK*
Ga0066696_101610332	3300006032	Soil	VLDLNAHGIKNTAALLGGWNGWNEAKLPIEATSKK*
Ga0070716_1000240172	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWNGWVAAGLPTEPTKK*
Ga0097621_1004291103	3300006237	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWTGWTEAKLPTESSVKK*
Ga0068871_1005935293	3300006358	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWNGWTEAKLPTESSVKK*
Ga0068871_1006080583	3300006358	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWNSWVEAKLPTEKTPTK*
Ga0068871_1014410892	3300006358	Miscanthus Rhizosphere	VLDLNAHGIKNAAALTGGWNGWNEARLPIEATTKK*
Ga0075425_10000000757	3300006854	Populus Rhizosphere	MNAHGIKNAAALLGGWNGWQQAKLPTVSAAAAKKP*
Ga0075426_1000121917	3300006903	Populus Rhizosphere	VLDMNAHGIKNAAALLGGWNGWQQAKLPTVSAAAAKKP*
Ga0075426_103820572	3300006903	Populus Rhizosphere	VLDLNAHGVKKTAALLGGWTGWVAANLPTEKTPIK*
Ga0066710_1023315762	3300009012	Grasslands Soil	VLDLNAHGIKETAALLGGWNGWKDAGLPVEVTPVKK
Ga0099830_105393063	3300009088	Vadose Zone Soil	VLDLNAHGVKNTAALLGGWNGWVAAGLPVTKTPIK*
Ga0099830_106392802	3300009088	Vadose Zone Soil	MNAHGIKNAAALLDGWNGWKDAHLPVTAAKKKVAT*
Ga0105240_127256522	3300009093	Corn Rhizosphere	VLDLNAHGVKNTAALLGGWNEWKAKGLPTESGLPKK*
Ga0105245_10000010223	3300009098	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWNGWVEAKLPTEKAETK*
Ga0105245_100003765	3300009098	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWNGWLAAKMPVETTAVKK*
Ga0105245_100701953	3300009098	Miscanthus Rhizosphere	VLDLNAHGVKNTAALLGGWNGWTAAGLPVEKTPIK*
Ga0105245_112020702	3300009098	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWSGWNEAKLPIESSVKK*
Ga0099792_101893062	3300009143	Vadose Zone Soil	VLDLNAHGIKNTAALLGGWNSWVEAKLPTEKTKTK*
Ga0126310_103079471	3300010044	Serpentine Soil	VLDLNAHQIKNAAALLGGWNEWKAAGLPTESKKK*
Ga0136218_10179342	3300010229	Soil	VLDLKGHGNNNATALLGGWNEWTALGLPVEKTKLK*
Ga0134063_106354191	3300010335	Grasslands Soil	VLDLNAHGVKKTAALLGGWNGWVAANLPTEKTPIK*
Ga0134062_106947501	3300010337	Grasslands Soil	MNAHNIKNAAALLGGWSGWQQAKLPVEATPVKKK*
Ga0134124_115249232	3300010397	Terrestrial Soil	VLDLNAHGVKNTAALLGGWNEWKAKGLPTDTGLPKK*
Ga0134123_102173512	3300010403	Terrestrial Soil	VQELNAHGVKNTAALLGGWNEWAALGLPTESNIGKKK*
Ga0137392_110537172	3300011269	Vadose Zone Soil	VLDLNAHGIKNTAALLGGWNGWNEAHLPIETAVKK*
Ga0137391_102803322	3300011270	Vadose Zone Soil	VLDLNKRGIKNTAALRGGWNEWKAAGLPVEQTAVK*
Ga0120114_11003262	3300011998	Permafrost	VLDLNAHGVKNTAALLGGWNQWVALGLPTESNIGKKKK*
Ga0137388_101856132	3300012189	Vadose Zone Soil	MNAHGIKNAAALLDGWNEWKDAHLPVTAPKKKVAT*
Ga0137388_105763543	3300012189	Vadose Zone Soil	VLDLNAHGVKKTAALLGGWNGWVAAGLPVTKTPIK*
Ga0137374_100536055	3300012204	Vadose Zone Soil	MNAHNLKNAAALLGGWNGWQQAKLAVESTAVKKK*
Ga0150985_1023907901	3300012212	Avena Fatua Rhizosphere	VLDLNAHGIKNTAALLGGWNGWKDAKLPTEVTIVKMQ*
Ga0150985_1074180062	3300012212	Avena Fatua Rhizosphere	VLDLNARGIKNTAALLGGWNGWIGAGLPTEKSELK*
Ga0150985_1133221853	3300012212	Avena Fatua Rhizosphere	VLDLNAHGVKNAAALLGGWNGWRDAKLPTEVTIVKMQ*
Ga0137370_102961532	3300012285	Vadose Zone Soil	MNAHNVKNAAALLGGWSGWQQAKLPVESAAVKKK*
Ga0137367_100765884	3300012353	Vadose Zone Soil	MNAHGITHAAALLGGWNGWQQAKLPIETTAVKKK*
Ga0137367_109812241	3300012353	Vadose Zone Soil	VLDLNAHGIKNTAALLGGWSGWTAAKLPIESSVKK*
Ga0137369_109133002	3300012355	Vadose Zone Soil	MNAPNLKNAAALLGGWNGWQQAKLPVESAVVKKK*
Ga0134034_10633572	3300012375	Grasslands Soil	VLDLNAHGIKNTAALKDGWNGWNEAKLPIEATPKK*
Ga0134036_11739471	3300012384	Grasslands Soil	VLDLNAHGVKNTAALLGGWNEWKAAGMPVEVTGLKR*
Ga0134053_13263602	3300012406	Grasslands Soil	VLDLNAHGVKNTAALLGGWNGWKAANLPTESSLKK*
Ga0150984_1130945772	3300012469	Avena Fatua Rhizosphere	VLDLNAHVVKNTAALLGGWNEWKAKGLPTESGLPKK*
Ga0137397_109801622	3300012685	Vadose Zone Soil	VLDLNAHGIKNTAALLGGWHAWIAAGLPTEQAPVPATTP
Ga0157283_102428082	3300012907	Soil	VLDLKGHGNNNAAALLGGWNEWTALGLPVEKTKLK*
Ga0137416_114657452	3300012927	Vadose Zone Soil	MNAHGIKNAAALLGGWNGWNDAHLPVAAAKKKVAT*
Ga0137410_108575842	3300012944	Vadose Zone Soil	VLDLNAHGIKNAAALLGGWNGWNEAKLPIESSVKK*
Ga0164301_115761452	3300012960	Soil	VLDLNAHGIKNTAALLGGWNGWNEARLPIEATKK*
Ga0164302_109699612	3300012961	Soil	VLDLNAHGVTNAAALLGGWNQWAALGLPTESNLGKKK*
Ga0157375_1000019149	3300013308	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWSGWNEAKLPVESSVKK*
Ga0120127_100285043	3300013503	Permafrost	VLDLNEHGITNTAALLGGWNGWKDAKLPIAVSKKK*
Ga0120111_10556433	3300013764	Permafrost	VLDLNKHGIKNTAALRGGWNEWKAAGLPMEQATLK*
Ga0120109_10044002	3300014052	Permafrost	VLDLNAHGVKNTAALLGGWNQWAALGLPTESNVGKPKKN*
Ga0157377_110505542	3300014745	Miscanthus Rhizosphere	VLDLNAHGVKNTAALLGGWNQWAALGLPTESNIGKKK*
Ga0167648_10118102	3300015171	Glacier Forefield Soil	MNAHGIKNAAALLGGWSGWKEAKLPTEITKVKKK*
Ga0134083_103898272	3300017659	Grasslands Soil	MNAHGIKNAAALLGGWSGWQQAKLPVEATPVKKKN
Ga0184615_100408122	3300018059	Groundwater Sediment	VVLDLNAHGIKNTAALLGGWNEWKAAGLPVEKPEMK
Ga0066662_101179842	3300018468	Grasslands Soil	VLDLNAHGIKNTAALKDGWNGWNEAKLPIEATPKK
Ga0066662_126774742	3300018468	Grasslands Soil	VLDLNAHGIKNTAALLGGWNAWLAAGLPTEKTAEKK
Ga0066662_130053112	3300018468	Grasslands Soil	VLDLNAHGIKNTAALLGGWSGWNEAKLPIEATRRK
Ga0196963_101469852	3300020215	Soil	VLDLKPKGIENTAALLGGWHAWTEKKLPTEKSSQKQ
Ga0213873_102132962	3300021358	Rhizosphere	VLDLNAHNVTNTAALLGGWNAWKEAKLPTETTPPPKPTTKK
Ga0213874_100439283	3300021377	Plant Roots	VLELNAHGVKNTAALLGGWNGWTVANLPVEMTPPPK
Ga0213876_104995302	3300021384	Plant Roots	VLDLNAHGIKNTAALLGGWNGWKDAKLPIETAAEKK
Ga0222622_106766501	3300022756	Groundwater Sediment	VLELNAHGVTNTAALIGGWNEWSALGLPTESTFSKKK
Ga0233356_10111981	3300023046	Soil	LSVLELNAHGVKNTAALVDGWKGWLAARLPTETGSN
Ga0247765_10177662	3300023268	Plant Litter	VLDLNAHGVKNTAALLGGWNEWKAANLPTQKTITKK
Ga0247686_10040994	3300024177	Soil	VLDLNAHGIKNTAALLGGWNGWTQAHLPIETAVKK
Ga0247680_100037211	3300024246	Soil	VLDLNAHGIKNTAALLGGWNGWTQAHLPTETAVKK
Ga0208079_10232352	3300025481	Arctic Peat Soil	VLDLNAVGIKNTAALLGGWNEWLAAKEPTESTSAKKK
Ga0207643_100149984	3300025908	Miscanthus Rhizosphere	VLDLNAKGIKNTAALLGGWNEWKSHNLPTATTTKK
Ga0207705_100325044	3300025909	Corn Rhizosphere	VLDLNAHGIKNTAALLGGWSGWNEAKLPIESSVKK
Ga0207707_104100883	3300025912	Corn Rhizosphere	VLDLNAHGIKNTAALLGGWNGWTEAKLPTESSVKK
Ga0207662_102572882	3300025918	Switchgrass Rhizosphere	VLDLNAHGVKNTAALLGGWNGWTAAGLPVEKTPIK
Ga0207662_105312702	3300025918	Switchgrass Rhizosphere	VLDLNAHGVKNTAALLGGWNSWRDAKLPIEVTKTK
Ga0207657_109333251	3300025919	Corn Rhizosphere	VLDLNAHGIKNTACLLGGWNGWTAAKLPTETTPMK
Ga0207646_103291711	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MNAHGIKNAAALLGGWNGWKDAHLPVTAAKKKVAT
Ga0207650_10000035159	3300025925	Switchgrass Rhizosphere	VLDLNAHGIKNAAALLGGWNGWNEARLPIESTPKK
Ga0207687_100259653	3300025927	Miscanthus Rhizosphere	VLDLNAHGIKNTAALLGGWNGWLAAKMPVETTAVKK
Ga0207670_102774083	3300025936	Switchgrass Rhizosphere	VLDLNAHKIMNTAALLGGWNEWKAAGLPTQSATPTATKK
Ga0207665_110807782	3300025939	Corn, Switchgrass And Miscanthus Rhizosphere	VLDLNAHGIKNTAALEGGWNGWNEARLPIESTPLKK
Ga0207661_102838612	3300025944	Corn Rhizosphere	VLDLNAHGVKNTAALLGGWNDWKAKGLPTESGLPKK
Ga0207648_105412023	3300026089	Miscanthus Rhizosphere	VLDLNAHKIMNTAALLGGWNEWKAAGLPTESAAATAKK
Ga0209804_10629532	3300026335	Soil	VLDLNAHGIKNAAALLGGWNGWNEARLPIEPTSKK
Ga0209474_101901942	3300026550	Soil	VLDLNAHGIKNTAALLGGWNGWNEAKLPIEATSKK
Ga0208994_10042944	3300027164	Forest Soil	VLDLNAHGNKNTAALLGGWNGWNEARLPVETAANVKK
Ga0207505_1005272	3300027459	Soil	VLDLNAHGVKNTAALLGGWNGWIAANLPTEKTPIK
Ga0208987_10463092	3300027496	Forest Soil	VLDLNAHGIKNTAALLGGWSGWNEAHLPIETSAPK
Ga0209797_102166132	3300027831	Wetland Sediment	VLDLNALGIKNTAALLGGWNEWKAAGLPIEKPELK
Ga0209283_101496964	3300027875	Vadose Zone Soil	VLDLNAHGIKNAAALLSGWNGWKDAGLPIATAKKRP
Ga0137415_105212752	3300028536	Vadose Zone Soil	MNAHGIKNAAALLGGWNGWNDAHLPVAAAKKKVAT
Ga0222749_101921432	3300029636	Soil	VLDLNAHGISNTAALLGGWNGWNEAHLPIETAAKK
Ga0222749_108333542	3300029636	Soil	VLDLNAHGIKNTACLLGGWNDWQKASLPIEMTPVKK
Ga0307506_104825091	3300031366	Soil	VLDLNAHNVKNTAALLGGWNGWITAGLPTEKTPIK
Ga0170820_164991061	3300031446	Forest Soil	VLDLNAKGIKNTAALLGGWNGWLEAKLPVESTQVKK
Ga0307469_120588792	3300031720	Hardwood Forest Soil	VLDLNAHGVKKTAALLGGWTGWVAANLPTEKTPIK
Ga0214473_108869062	3300031949	Soil	VLDLNAHGIKNTAALIGGWNEWKAAGLPVQKTEMK
Ga0334961_000011_102834_102944	3300034143	Sub-Biocrust Soil	VLELKQKGIERGAALLGGWNAWLAQHLPTETSEQEE
Ga0364940_0161833_11_118	3300034164	Sediment	VLDLNKRGIKNAAALIGGWNEWKAAGLPVEKSELK

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.27
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.27
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F071587

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign