NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071516

Metagenome / Metatranscriptome Family F071516

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071516
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 46 residues
Representative Sequence MSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEIHAKTL
Number of Associated Samples 112
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.38 %
% of genes near scaffold ends (potentially truncated) 92.62 %
% of genes from short scaffolds (< 2000 bps) 95.90 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.082 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(13.115 % of family members)
Environment Ontology (ENVO) Unclassified
(26.230 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.344 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.32%    β-sheet: 0.00%    Coil/Unstructured: 50.68%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF05717TnpB_IS66 77.05
PF01527HTH_Tnp_1 11.48
PF13817DDE_Tnp_IS66_C 1.64
PF13408Zn_ribbon_recom 0.82
PF00891Methyltransf_2 0.82
PF13340DUF4096 0.82
PF01609DDE_Tnp_1 0.82
PF13007LZ_Tnp_IS66 0.82
PF01526DDE_Tnp_Tn3 0.82
PF07592DDE_Tnp_ISAZ013 0.82
PF00753Lactamase_B 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG3436TransposaseMobilome: prophages, transposons [X] 77.05
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.82
COG3293TransposaseMobilome: prophages, transposons [X] 0.82
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.82
COG4644Transposase and inactivated derivatives, TnpA familyMobilome: prophages, transposons [X] 0.82
COG5421TransposaseMobilome: prophages, transposons [X] 0.82
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.82
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.08 %
UnclassifiedrootN/A4.92 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001661|JGI12053J15887_10403532All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria657Open in IMG/M
3300001867|JGI12627J18819_10096660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1221Open in IMG/M
3300004081|Ga0063454_102015273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria511Open in IMG/M
3300004082|Ga0062384_100575107All Organisms → cellular organisms → Bacteria → Proteobacteria759Open in IMG/M
3300004153|Ga0063455_100075829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1280Open in IMG/M
3300005093|Ga0062594_102049622All Organisms → cellular organisms → Bacteria → Proteobacteria613Open in IMG/M
3300005187|Ga0066675_11129398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria584Open in IMG/M
3300005327|Ga0070658_11609674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria563Open in IMG/M
3300005328|Ga0070676_10723930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria728Open in IMG/M
3300005329|Ga0070683_100926976All Organisms → cellular organisms → Bacteria → Proteobacteria836Open in IMG/M
3300005332|Ga0066388_101029431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1383Open in IMG/M
3300005437|Ga0070710_10638338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria745Open in IMG/M
3300005542|Ga0070732_10280979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria998Open in IMG/M
3300005568|Ga0066703_10726337All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria570Open in IMG/M
3300005602|Ga0070762_10500710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales796Open in IMG/M
3300005602|Ga0070762_10835431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales625Open in IMG/M
3300006028|Ga0070717_11411371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria632Open in IMG/M
3300006047|Ga0075024_100045205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1829Open in IMG/M
3300006047|Ga0075024_100143907All Organisms → cellular organisms → Bacteria → Proteobacteria1081Open in IMG/M
3300006052|Ga0075029_100973375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria585Open in IMG/M
3300006174|Ga0075014_100604489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria627Open in IMG/M
3300006176|Ga0070765_100652812All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria993Open in IMG/M
3300006237|Ga0097621_102215660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria526Open in IMG/M
3300009144|Ga0058702_10252593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria700Open in IMG/M
3300009500|Ga0116229_10313743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1322Open in IMG/M
3300009709|Ga0116227_11151315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria583Open in IMG/M
3300010339|Ga0074046_10823107All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300010341|Ga0074045_10438876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria843Open in IMG/M
3300010341|Ga0074045_10612209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria694Open in IMG/M
3300010343|Ga0074044_10037944All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. SK-33355Open in IMG/M
3300010343|Ga0074044_10039115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3300Open in IMG/M
3300010371|Ga0134125_11075172All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria881Open in IMG/M
3300010373|Ga0134128_10512529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1337Open in IMG/M
3300010395|Ga0058701_10782668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300011119|Ga0105246_11250226All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300012498|Ga0157345_1030875Not Available600Open in IMG/M
3300012509|Ga0157334_1056665Not Available555Open in IMG/M
3300012683|Ga0137398_10906329All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria614Open in IMG/M
3300012957|Ga0164303_11227666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria550Open in IMG/M
3300012960|Ga0164301_11545237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria548Open in IMG/M
3300012984|Ga0164309_10840631All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300013308|Ga0157375_11150447All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300014745|Ga0157377_10810577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria691Open in IMG/M
3300015372|Ga0132256_100109327All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2707Open in IMG/M
3300015374|Ga0132255_105668877All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria528Open in IMG/M
3300017656|Ga0134112_10270372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria678Open in IMG/M
3300018067|Ga0184611_1177938Not Available756Open in IMG/M
3300018072|Ga0184635_10274966Not Available665Open in IMG/M
3300020582|Ga0210395_10278607All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1257Open in IMG/M
3300020583|Ga0210401_11454689All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria543Open in IMG/M
3300021078|Ga0210381_10109692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria904Open in IMG/M
3300021086|Ga0179596_10342458All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria750Open in IMG/M
3300021171|Ga0210405_10300238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1269Open in IMG/M
3300021180|Ga0210396_10967059All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria723Open in IMG/M
3300021377|Ga0213874_10126382All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria874Open in IMG/M
3300021441|Ga0213871_10040723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1246Open in IMG/M
3300021441|Ga0213871_10171966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria667Open in IMG/M
3300021444|Ga0213878_10052837All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1589Open in IMG/M
3300025878|Ga0209584_10037375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1693Open in IMG/M
3300025914|Ga0207671_10307365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1253Open in IMG/M
3300025915|Ga0207693_10353165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1150Open in IMG/M
3300025941|Ga0207711_11587371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300025944|Ga0207661_11068056All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300026023|Ga0207677_10863911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria814Open in IMG/M
3300026121|Ga0207683_10791368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria880Open in IMG/M
3300026142|Ga0207698_11821347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300027097|Ga0208861_101026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1196Open in IMG/M
3300027257|Ga0208996_1059832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300028268|Ga0255348_1067723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria621Open in IMG/M
3300028566|Ga0302147_10333037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria503Open in IMG/M
3300028574|Ga0302153_10124643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense880Open in IMG/M
3300028665|Ga0302160_10045866All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria876Open in IMG/M
3300028747|Ga0302219_10321358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria603Open in IMG/M
3300028748|Ga0302156_10130483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1241Open in IMG/M
3300028778|Ga0307288_10114840All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria991Open in IMG/M
3300028813|Ga0302157_10151753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1376Open in IMG/M
3300029636|Ga0222749_10321653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria804Open in IMG/M
3300029911|Ga0311361_10447508All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1322Open in IMG/M
3300029913|Ga0311362_10434552All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1261Open in IMG/M
3300029915|Ga0311358_10330623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1272Open in IMG/M
3300029920|Ga0302142_1188347All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300029922|Ga0311363_11159823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria656Open in IMG/M
3300029954|Ga0311331_11601193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300029956|Ga0302150_10019112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2734Open in IMG/M
3300029984|Ga0311332_10368485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1111Open in IMG/M
3300029990|Ga0311336_10786351All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria819Open in IMG/M
3300029992|Ga0302276_10137784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1214Open in IMG/M
3300030020|Ga0311344_10375889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1319Open in IMG/M
3300030020|Ga0311344_10390696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1284Open in IMG/M
3300030688|Ga0311345_10331126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1415Open in IMG/M
3300030740|Ga0265460_10941461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria786Open in IMG/M
3300030743|Ga0265461_13202528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria552Open in IMG/M
3300031057|Ga0170834_108775484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1304Open in IMG/M
3300031092|Ga0308204_10365054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria500Open in IMG/M
3300031231|Ga0170824_123223028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria673Open in IMG/M
3300031261|Ga0302140_11134017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria527Open in IMG/M
3300031469|Ga0170819_13698846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria512Open in IMG/M
3300031472|Ga0272437_1024905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5906Open in IMG/M
3300031472|Ga0272437_1306950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria725Open in IMG/M
3300031474|Ga0170818_114991683All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria525Open in IMG/M
3300031520|Ga0272428_1159283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1207Open in IMG/M
3300031524|Ga0302320_10613411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1267Open in IMG/M
3300031708|Ga0310686_104101566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1372Open in IMG/M
3300031708|Ga0310686_116698474Not Available850Open in IMG/M
3300031880|Ga0318544_10416295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria523Open in IMG/M
3300031938|Ga0308175_102499620All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales578Open in IMG/M
3300031996|Ga0308176_12074433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria607Open in IMG/M
3300032008|Ga0318562_10460889All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria738Open in IMG/M
3300032008|Ga0318562_10687022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria589Open in IMG/M
3300032059|Ga0318533_11350581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria521Open in IMG/M
3300032063|Ga0318504_10131037All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1144Open in IMG/M
3300032074|Ga0308173_12234279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria516Open in IMG/M
3300032829|Ga0335070_11655950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria581Open in IMG/M
3300033168|Ga0272423_1162868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1049Open in IMG/M
3300033168|Ga0272423_1165192All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Rhodovastum → Rhodovastum atsumiense1034Open in IMG/M
3300033402|Ga0326728_10234173All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1779Open in IMG/M
3300034127|Ga0370489_0091149All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria887Open in IMG/M
3300034129|Ga0370493_0107197All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria897Open in IMG/M
3300034159|Ga0370509_0324384All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria564Open in IMG/M
3300034163|Ga0370515_0127883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium multivorum1092Open in IMG/M
3300034196|Ga0370503_0089140Not Available1040Open in IMG/M
3300034691|Ga0370488_189626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog13.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.56%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil4.92%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil4.10%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock4.10%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.28%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.28%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.28%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.46%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.64%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.64%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.64%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave1.64%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.82%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.82%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.82%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.82%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.82%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.82%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.82%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.82%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300009144Agave microbial communities from Guanajuato, Mexico - Or.Sf.eHost-AssociatedOpen in IMG/M
3300009500Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010395Agave microbial communities from Guanajuato, Mexico - Or.Ma.eHost-AssociatedOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012498Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410Host-AssociatedOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027097Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF019 (SPAdes)EnvironmentalOpen in IMG/M
3300027257Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300028268Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v5EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028574Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2EnvironmentalOpen in IMG/M
3300028665Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029920Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031472Rock endolithic microbial communities from Victoria Land, Antarctica - Richard Nunatak red sandstoneEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031520Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nordEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033168Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand sudEnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300034127Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16EnvironmentalOpen in IMG/M
3300034129Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16EnvironmentalOpen in IMG/M
3300034159Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M
3300034196Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_18EnvironmentalOpen in IMG/M
3300034691Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12053J15887_1040353213300001661Forest SoilMSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIH
JGI12627J18819_1009666043300001867Forest SoilMSLATEPLPANPSVLRIFAADLQAELARKDIEIAANAAEI
Ga0063454_10201527313300004081SoilLVHSGMSLASIPLPSDPTALRAFAAGLQAELARKELEIAANAAEIHAKTLHIEK
Ga0062384_10057510733300004082Bog Forest SoilMSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIHAKTLHI
Ga0063455_10007582933300004153SoilMFLANQPLPADPEALRAFAADLQAELARKDIELAANAAEIHAKTLHIEKL
Ga0062594_10204962213300005093SoilVSLANHPLPADPSALRVFAADLQAELARKNIELERKTIEIAANAAEIHAKTLHIEKLKM
Ga0066675_1112939823300005187SoilMSLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHIEKLK
Ga0070658_1160967413300005327Corn RhizosphereMSLASMALPSDPAALRALAAGLQAELARKELEIAANAAEIH
Ga0070676_1072393033300005328Miscanthus RhizosphereLANHPLPADPSALRVFAADLQAELARKNIELAANAAEIHAKALHI
Ga0070683_10092697613300005329Corn RhizosphereMSLASDALPTDPQELRQFAVSLQAELARKEIELAANAAEIHAKTLH
Ga0066388_10102943143300005332Tropical Forest SoilMSLATDPLPTNPSALRIFAADLQAELARKDIEIAANAAEIHA
Ga0070710_1063833833300005437Corn, Switchgrass And Miscanthus RhizosphereLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHIEKLK
Ga0070732_1028097913300005542Surface SoilMSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEI
Ga0066703_1072633723300005568SoilMSLAHQPLPVDPQALQLFAADLQAELARKEIELAAN
Ga0070762_1050071033300005602SoilMSLATEPLPANPSVLRIFAADLQAELARKDIEIAANADEIHAKTLHIEKLKM
Ga0070762_1083543133300005602SoilMSLVNTPLPADPEALRRFAASLQAELARKDIEIAAH
Ga0070717_1141137113300006028Corn, Switchgrass And Miscanthus RhizosphereMSLASLPLPSDPAALRALAAGLQAELARKELEIAANAA
Ga0075024_10004520523300006047WatershedsMSLATQPLPDDPTALRNFAVDLQAELARKDIEIAANAAEIHAKTLVSAQPG*
Ga0075024_10014390713300006047WatershedsMSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIHAKTL
Ga0075029_10097337513300006052WatershedsMSLATDPLPANPSALRIFAADLQAELARKDIEIAANAAEIHAK
Ga0075014_10060448933300006174WatershedsVSLANSPLPSDPLALRIFAADLQAELARKDIELAANAAEI
Ga0070765_10065281213300006176SoilMSLANSPLPPDPEALRSFAVDLQAELARKEIELAANAAEIYAKTLHIEKL
Ga0097621_10221566013300006237Miscanthus RhizosphereMSLATDPLPASPSALRIFAADLQAELARKDIEIAANA
Ga0058702_1025259333300009144AgaveMFLATHPLPADPAELRSFAVSLRAELARKDLELAAN
Ga0116229_1031374343300009500Host-AssociatedMSLASAPLPTDPDALRLFAAGLQAELARKELEIAANAAEIHAKTLHIEKL
Ga0116227_1115131513300009709Host-AssociatedMSLATHPLPTDPAELRRFAVGLQAELARKEIELAANAAEIHAKTLH
Ga0074046_1082310713300010339Bog Forest SoilMSLAHHPLPTDPLALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKLKMQ
Ga0074045_1043887643300010341Bog Forest SoilMSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKL
Ga0074045_1061220933300010341Bog Forest SoilMSLAHHPLPSDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKL
Ga0074044_1003794463300010343Bog Forest SoilMSLAHHPLPTDPQTLHLFAADLQAELARKEIELAANAAEIHAKTLHIEKLK
Ga0074044_1003911533300010343Bog Forest SoilMSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIE
Ga0134125_1107517223300010371Terrestrial SoilMSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTRS*
Ga0134128_1051252943300010373Terrestrial SoilMSLASMALPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTL
Ga0058701_1078266823300010395AgaveVSLANHPLPTDLSALRSFAADLQAELARKTIELERKTIEIAANAADPRQDAAH*
Ga0105246_1125022633300011119Miscanthus RhizosphereMSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTLHIEKL
Ga0157345_103087513300012498Arabidopsis RhizosphereMSLASDPLPTDPEALRQFAAGLQTELARKEIEIAA
Ga0157334_105666513300012509SoilMSLASDPLPTDPEALRQFAAGLQTELARKEIEIAANAA
Ga0137398_1090632913300012683Vadose Zone SoilMSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEIHAKTLHIEKLKMQL
Ga0164303_1122766613300012957SoilMSLATLPLPDDPTALRDLAVDLQAELARKEIEIAANAAEIHAK
Ga0164301_1154523723300012960SoilMSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHA
Ga0164309_1084063133300012984SoilMSLASLPLRDDPDALRAFATGLQAELARRDIEITARDA
Ga0157375_1115044733300013308Miscanthus RhizosphereMHPLPADPAELRSFAVSLQAELARKDLELAANAAEIHA
Ga0157377_1081057713300014745Miscanthus RhizosphereMSLATLPLPDDPTALRDLAVDLQAELACKDIEIAANAAEIHAKTLHIEKLKMQLA
Ga0132256_10010932743300015372Arabidopsis RhizosphereMSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTLHIEKLK
Ga0132255_10566887713300015374Arabidopsis RhizosphereMSLATLQLPDDPTALRNLAVDLQAELARKDIEIAANAAEIYAK
Ga0134112_1027037213300017656Grasslands SoilMSLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIY
Ga0184611_117793823300018067Groundwater SedimentDDPTALRNLAVGLQAELARKDIEIAANAAEIHAKSKRSPCHV
Ga0184635_1027496613300018072Groundwater SedimentLPLTDDPTALRNLAVGLQAELARKDIEIAANAAEIHAKSKRSPCHV
Ga0210395_1027860743300020582SoilMSLATEPLPANPSVLRIFAADLQAELARKDIEIAANAAEIHAKTLHI
Ga0210401_1145468923300020583SoilMSLATDPLPANPSALRIFAADLRAELARKDIEVAANSAEIP
Ga0210381_1010969233300021078Groundwater SedimentMSLANLPLPDDPTALRNLAVDLQAELARKDIEIAANAAEIHAKTLH
Ga0179596_1034245833300021086Vadose Zone SoilMSLAILPLPDDPSALRSFAVDLQAELARKDIEIAANAA
Ga0210405_1030023843300021171SoilMSLATLPLPDDPTALRSFAVDLQAELARRDIEIAANAA
Ga0210396_1096705913300021180SoilMSLATEPLPANPSALRIFAADLQAELARKDIEIAANA
Ga0213874_1012638213300021377Plant RootsMSLASAPLPTDPEALRVFAANLQAELARKDLEIAANAAEIH
Ga0213871_1004072313300021441RhizosphereMSLAHQPLPADPQALQLFAADLQAELARKEIELAANAAEIYAKTLHIE
Ga0213871_1017196633300021441RhizosphereMSLASMPLPSDPTALRALAAGLQAELARKELEIAAN
Ga0213878_1005283723300021444Bulk SoilMSLASVPLPDDPTALRVLAASLQAELARKDMEMQKS
Ga0209584_1003737543300025878Arctic Peat SoilMSLVNSPLPTDPQALRSFAADLQAELARKDIEIAANAAEIHAKTLHIEQ
Ga0207671_1030736513300025914Corn RhizosphereVSLANHPLPADPSALRVFAADLQAELARKNIELERKT
Ga0207693_1035316533300025915Corn, Switchgrass And Miscanthus RhizosphereMSLATLPLPDDPTALRDLAVDLQAELARKDSEIAANAAEIHAKTL
Ga0207711_1158737123300025941Switchgrass RhizosphereMSLATDPLPASPSALRIFAADLQAELARKDIEIAASAAEIHAKALHIEKLKMQLAV
Ga0207661_1106805613300025944Corn RhizosphereMHPLPADPAELRSFAVSLQAELARKDIELAANAAEIHAKTL
Ga0207677_1086391113300026023Miscanthus RhizosphereMHPLPADPAELRSFAVSLQAELARKDIELAANAAE
Ga0207683_1079136813300026121Miscanthus RhizosphereMSLATEPLPANPSALRIFAAGLQAELARKDIEIAANAA
Ga0207698_1182134723300026142Corn RhizosphereMSLATEPLPANPSALRIFAAGLQAELARKDIEIAANAAEIHAKTL
Ga0208861_10102613300027097Forest SoilMSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEIHAKT
Ga0208996_105983213300027257Forest SoilMSLASAPLPIDLDALRAFAAELQAELARKDIEIAANAAEIYAKFAASHADKDFSAVIETL
Ga0255348_106772323300028268SoilMSLATEPLPVDPAALRAFAADLQAELARKDIELAANAAEIHAKTLHIEKLK
Ga0302147_1033303713300028566BogMSLATNPLPADLPALRAFAAELQAELARKDIELAANAAEIHPRQERV
Ga0302153_1012464313300028574BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTL
Ga0302160_1004586633300028665FenMSLVHHPLPTDPQALRAFAADLQAELAHRDIELARKDIELAANAAEIHAK
Ga0302219_1032135823300028747PalsaMSLVSEPLPTDLDALRLFAENLQAELARKDREIAANAAEIYAKTLH
Ga0302156_1013048313300028748BogMSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEI
Ga0307288_1011484013300028778SoilMSLATEPLPANPSALRIFAAGLQAELARKDIEIAA
Ga0302157_1015175313300028813BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIE
Ga0222749_1032165333300029636SoilMSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAAEI
Ga0311361_1044750843300029911BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQLA
Ga0311362_1043455233300029913BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKT
Ga0311358_1033062343300029915BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAE
Ga0302142_118834713300029920BogVSLANHPLPTNPRALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQ
Ga0311363_1115982313300029922FenMSLASHPIPNEFEALRSFAANLQSELARKEIEIAANA
Ga0311331_1160119323300029954BogMSLAHHPLPTDPQALHLFAADLQAELARKEIELAANA
Ga0302150_1001911213300029956BogMSLATEPLPVDPAALRAFAADLQAELARKDIELAANAAEIHAKTLHIE
Ga0311332_1036848513300029984FenMSLVHHPLPTDPQALRAFAADLQAELAHRDIELARKDIELAANAAEIH
Ga0311336_1078635113300029990FenMQPLPADPAELRSFAAGLQAELARKDIELAANAAEIHAKTL
Ga0302276_1013778433300029992BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEK
Ga0311344_1037588933300030020BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQLATLR
Ga0311344_1039069613300030020BogMSLAHHPLPTDPQALQLFAAALQAELARKEIELAANAAEIHAKTLH
Ga0311345_1033112643300030688BogVSLANHPLPTNPRALRSFAADLQAELARKDTELARKDIELERKDIEIAANAAEIY
Ga0265460_1094146113300030740SoilMSLATLPLPDDPTELRDLAVDLQAELARKDIEIAANAA
Ga0265461_1320252813300030743SoilMSLATLPLPDDPTALRNFAVDLQAELARRDIEIAANAAEIHAKT
Ga0170834_10877548443300031057Forest SoilMSLAILPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKTLHIEKLK
Ga0308204_1036505423300031092SoilMSLATLPLPDDPTALRNLAEGLQAELARKDIEIAANAAEIHAK
Ga0170824_12322302813300031231Forest SoilMSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKTLHIEKLK
Ga0302140_1113401713300031261BogVSLANHPLPTDPSALRIFAADLQAELARKDIELERKDIEIAANAAEIYAKTLHIEKLKMQ
Ga0170819_1369884613300031469Forest SoilMSLAILPLPDDPTALRSFAVDLQAELARKDIEIAANAAEIHAKTL
Ga0272437_102490523300031472RockMSLASAPLSIGLDALRAFAADLQAELARKDVEIAANAAEILPRRCTSRS
Ga0272437_130695023300031472RockMSLASVPLPIDLDALRAFAADLQSELARKDIEITANAAEIYAKTLHIRS
Ga0170818_11499168313300031474Forest SoilMSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIH
Ga0272428_115928313300031520RockMSLAHDPLPSDPEVLRAFAAGLQAELARKDVQIAANAAEIHAKTLHIEKLRMQL
Ga0302320_1061341143300031524BogMSLAHHPLPTDPQALHLFAADLQAELARKEIELAANAAEIHAKTLHIEKLKMQ
Ga0310686_10410156633300031708SoilMSLATLPLPDDPIALRNLAVDLQAELARKDIEIAVNAAEIHAKTLYIEKLKMQLA
Ga0310686_11669847413300031708SoilMSLMTLPLPEDPDALRSFAADLQAELARKDIEILARDAEIHAKTLRIEKLKR
Ga0318544_1041629523300031880SoilMSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKT
Ga0308175_10249962013300031938SoilLAGWAMSLASMPLPSDPAALRALAAGLQAELARKELQIAANAAEIHAKTLHIE
Ga0308176_1207443313300031996SoilMSLASTPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHIEKLKVEL
Ga0318562_1046088913300032008SoilMSLATDPLPANLSALRIFAADLQAELARKDIEIAANAAEIHA
Ga0318562_1068702213300032008SoilMSLAIQPLPEDPDALRRFAADLQAELARKTIEITARDAEIHAKTLHIE
Ga0318533_1135058113300032059SoilMSLATLPLPDDPTALRDLAVDLQAELARKDIEIAA
Ga0318504_1013103733300032063SoilMSLATLPLPDDPTALRDLAVDLQAELARKDIEIAANAAEIHAKTLHIEKLKMQ
Ga0308173_1223427913300032074SoilMSLASLPLPSDPAALRALAAGLQAELARKELEIAANAAEIHAKTLHI
Ga0335070_1165595023300032829SoilMSLANQPLPADPEALRAFAADLQAELARKDIELAANAAE
Ga0272423_116286833300033168RockMFLAIQPLPEDPDALRGFAAELQAELARKEIEITAR
Ga0272423_116519233300033168RockMSLAIQPLPADPDALRGFAAELQAELARKDIEITARDAEIHAKT
Ga0326728_1023417313300033402Peat SoilLAHHPLPTDPQALQLFAAALQAELARKEIEIAANAAEIHAKTLHIEKLKMQLA
Ga0370489_0091149_1_1773300034127Untreated Peat SoilVSLANHPLPTDPSALRIFAADLQAELARKNIELERKTIEIAANAAEIHAKTVHIEKLKI
Ga0370493_0107197_747_8963300034129Untreated Peat SoilMSLVHQPLPADPQALRAFAADLQAELAHRDTELAHRDTELAHRDIELAHR
Ga0370509_0324384_1_1203300034159Untreated Peat SoilMSLATRPLPDDAPALRALAAELQAELARKEIELAANAAEI
Ga0370515_0127883_1_1113300034163Untreated Peat SoilVSLANSPLPSDPLALRIFAAGLQTELARKDIELAANA
Ga0370503_0089140_1_1353300034196Untreated Peat SoilPTDPQALRAFAADLQAELARKDIELAANAAEIHAKTLHHCCPVR
Ga0370488_189626_2_1483300034691Untreated Peat SoilMSLATSPLPTDPQALRSFAADLQAEIVRKNDELARKDIEIAANAAEIHA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.