NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071491

Metagenome Family F071491

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071491
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 43 residues
Representative Sequence GSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Number of Associated Samples 85
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.82 %
% of genes near scaffold ends (potentially truncated) 96.72 %
% of genes from short scaffolds (< 2000 bps) 85.25 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.525 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(45.082 % of family members)
Environment Ontology (ENVO) Unclassified
(48.361 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(45.082 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.72%    β-sheet: 0.00%    Coil/Unstructured: 90.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00005ABC_tran 4.10
PF00486Trans_reg_C 4.10
PF13238AAA_18 4.10
PF03706LPG_synthase_TM 3.28
PF00196GerE 2.46
PF00583Acetyltransf_1 2.46
PF12680SnoaL_2 2.46
PF01243Putative_PNPOx 2.46
PF09339HTH_IclR 1.64
PF01244Peptidase_M19 1.64
PF07690MFS_1 1.64
PF02417Chromate_transp 1.64
PF01850PIN 1.64
PF13847Methyltransf_31 1.64
PF04964Flp_Fap 0.82
PF00990GGDEF 0.82
PF13424TPR_12 0.82
PF02896PEP-utilizers_C 0.82
PF02518HATPase_c 0.82
PF02687FtsX 0.82
PF01548DEDD_Tnp_IS110 0.82
PF03537Glyco_hydro_114 0.82
PF12006DUF3500 0.82
PF01433Peptidase_M1 0.82
PF02894GFO_IDH_MocA_C 0.82
PF01425Amidase 0.82
PF02733Dak1 0.82
PF00381PTS-HPr 0.82
PF01791DeoC 0.82
PF05988DUF899 0.82
PF00664ABC_membrane 0.82
PF13522GATase_6 0.82
PF01571GCV_T 0.82
PF13420Acetyltransf_4 0.82
PF04264YceI 0.82
PF03176MMPL 0.82
PF11838ERAP1_C 0.82
PF08327AHSA1 0.82
PF13302Acetyltransf_3 0.82
PF02720DUF222 0.82
PF03729DUF308 0.82
PF01636APH 0.82
PF00440TetR_N 0.82
PF13561adh_short_C2 0.82
PF01152Bac_globin 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0392Predicted membrane flippase AglD2/YbhN, UPF0104 familyCell wall/membrane/envelope biogenesis [M] 3.28
COG2059Chromate transport protein ChrAInorganic ion transport and metabolism [P] 1.64
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 1.64
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.82
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.82
COG3868Alpha-1,4 polygalactosaminidase, glycosyl hydrolase family GH114Carbohydrate transport and metabolism [G] 0.82
COG3847Flp pilus assembly protein, pilin FlpExtracellular structures [W] 0.82
COG3547TransposaseMobilome: prophages, transposons [X] 0.82
COG3247Acid resistance membrane protein HdeD, DUF308 familyGeneral function prediction only [R] 0.82
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.82
COG2376Dihydroxyacetone kinaseCarbohydrate transport and metabolism [G] 0.82
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 0.82
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.82
COG2342Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase)Carbohydrate transport and metabolism [G] 0.82
COG1925HPr or related phosphotransfer proteinSignal transduction mechanisms [T] 0.82
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.82
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.82
COG0308Aminopeptidase N, contains DUF3458 domainAmino acid transport and metabolism [E] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.52 %
UnclassifiedrootN/A11.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF01BCJBNAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora azurea504Open in IMG/M
3300005332|Ga0066388_106209943All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005445|Ga0070708_101197040All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005445|Ga0070708_101267673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300005467|Ga0070706_100813169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300005586|Ga0066691_10317118All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300005764|Ga0066903_100153233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3318Open in IMG/M
3300005764|Ga0066903_100542036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1991Open in IMG/M
3300005764|Ga0066903_101212243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1402Open in IMG/M
3300005764|Ga0066903_102024895All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300006028|Ga0070717_10359518All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300006028|Ga0070717_11519095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Kitasatospora → unclassified Kitasatospora → Kitasatospora sp. SolWspMP-SS2h607Open in IMG/M
3300006175|Ga0070712_100564203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales960Open in IMG/M
3300006794|Ga0066658_10335365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300006804|Ga0079221_10228912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1040Open in IMG/M
3300006854|Ga0075425_100069682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae3959Open in IMG/M
3300006903|Ga0075426_10017480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5122Open in IMG/M
3300009090|Ga0099827_10521273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1022Open in IMG/M
3300009792|Ga0126374_10839748All Organisms → cellular organisms → Bacteria → Terrabacteria group706Open in IMG/M
3300010046|Ga0126384_10643940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300010046|Ga0126384_10829352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia830Open in IMG/M
3300010046|Ga0126384_11214846Not Available696Open in IMG/M
3300010048|Ga0126373_10070681All Organisms → cellular organisms → Bacteria3153Open in IMG/M
3300010048|Ga0126373_10198992All Organisms → cellular organisms → Bacteria1940Open in IMG/M
3300010048|Ga0126373_11503991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300010048|Ga0126373_12510633Not Available574Open in IMG/M
3300010048|Ga0126373_12951509All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300010358|Ga0126370_11570934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi628Open in IMG/M
3300010358|Ga0126370_12030483All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300010359|Ga0126376_10038215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3313Open in IMG/M
3300010360|Ga0126372_10386880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1271Open in IMG/M
3300010360|Ga0126372_11247368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium770Open in IMG/M
3300010361|Ga0126378_10219741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1983Open in IMG/M
3300010361|Ga0126378_10835225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300010361|Ga0126378_10961883All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300010361|Ga0126378_12392923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300010366|Ga0126379_12482701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300010376|Ga0126381_100102346Not Available3660Open in IMG/M
3300010376|Ga0126381_101469128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300010376|Ga0126381_104826374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010398|Ga0126383_11023472Not Available915Open in IMG/M
3300010398|Ga0126383_11535036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium756Open in IMG/M
3300011270|Ga0137391_10484930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300012096|Ga0137389_10048953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3183Open in IMG/M
3300012201|Ga0137365_11010380All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300012357|Ga0137384_10387347All Organisms → cellular organisms → Bacteria1155Open in IMG/M
3300012929|Ga0137404_11877207All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300012971|Ga0126369_13013846Not Available551Open in IMG/M
3300016404|Ga0182037_10391888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1142Open in IMG/M
3300017822|Ga0187802_10337625Not Available591Open in IMG/M
3300021478|Ga0210402_11086968All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300021560|Ga0126371_10548848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1305Open in IMG/M
3300021560|Ga0126371_10926164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1015Open in IMG/M
3300021560|Ga0126371_12254995Not Available657Open in IMG/M
3300021560|Ga0126371_13591603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300025898|Ga0207692_10195529All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300025910|Ga0207684_10589948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300025928|Ga0207700_10388203All Organisms → cellular organisms → Bacteria1222Open in IMG/M
3300025929|Ga0207664_10911973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium789Open in IMG/M
3300026490|Ga0257153_1118675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300027725|Ga0209178_1196975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium712Open in IMG/M
3300027862|Ga0209701_10554710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300031549|Ga0318571_10374823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia551Open in IMG/M
3300031561|Ga0318528_10509463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300031561|Ga0318528_10552793All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia618Open in IMG/M
3300031564|Ga0318573_10102760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1468Open in IMG/M
3300031564|Ga0318573_10285195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria883Open in IMG/M
3300031640|Ga0318555_10532859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300031668|Ga0318542_10452554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300031682|Ga0318560_10646969All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300031719|Ga0306917_10013955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4734Open in IMG/M
3300031723|Ga0318493_10039818All Organisms → cellular organisms → Bacteria2180Open in IMG/M
3300031723|Ga0318493_10290716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium880Open in IMG/M
3300031724|Ga0318500_10001128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria6984Open in IMG/M
3300031736|Ga0318501_10002578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora5800Open in IMG/M
3300031736|Ga0318501_10736921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300031748|Ga0318492_10564066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium606Open in IMG/M
3300031764|Ga0318535_10032217All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2108Open in IMG/M
3300031764|Ga0318535_10292857Not Available728Open in IMG/M
3300031764|Ga0318535_10402951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300031765|Ga0318554_10100925All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1622Open in IMG/M
3300031765|Ga0318554_10695412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia africana571Open in IMG/M
3300031768|Ga0318509_10318772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia870Open in IMG/M
3300031770|Ga0318521_10102866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1575Open in IMG/M
3300031770|Ga0318521_10645832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300031779|Ga0318566_10301992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300031780|Ga0318508_1025791All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300031782|Ga0318552_10031465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2435Open in IMG/M
3300031795|Ga0318557_10046775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1808Open in IMG/M
3300031795|Ga0318557_10472553All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300031797|Ga0318550_10039033Not Available2086Open in IMG/M
3300031798|Ga0318523_10122570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1284Open in IMG/M
3300031821|Ga0318567_10162501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1238Open in IMG/M
3300031831|Ga0318564_10270040Not Available753Open in IMG/M
3300031832|Ga0318499_10299628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300031835|Ga0318517_10519361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031880|Ga0318544_10322721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300031890|Ga0306925_10470441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1341Open in IMG/M
3300031897|Ga0318520_10433637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CME 23806Open in IMG/M
3300031910|Ga0306923_12366717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300031945|Ga0310913_11148676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300031947|Ga0310909_10223566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1569Open in IMG/M
3300032009|Ga0318563_10489100All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium665Open in IMG/M
3300032009|Ga0318563_10667044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300032025|Ga0318507_10012401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2836Open in IMG/M
3300032041|Ga0318549_10244731All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300032043|Ga0318556_10107072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1420Open in IMG/M
3300032055|Ga0318575_10004228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae4931Open in IMG/M
3300032055|Ga0318575_10157564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1131Open in IMG/M
3300032064|Ga0318510_10554675Not Available502Open in IMG/M
3300032066|Ga0318514_10462690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium674Open in IMG/M
3300032066|Ga0318514_10541125Not Available620Open in IMG/M
3300032067|Ga0318524_10610550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300032067|Ga0318524_10654928All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300032076|Ga0306924_12300110Not Available547Open in IMG/M
3300032089|Ga0318525_10236372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia939Open in IMG/M
3300032089|Ga0318525_10639654Not Available542Open in IMG/M
3300032091|Ga0318577_10587395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300032180|Ga0307471_100020130All Organisms → cellular organisms → Bacteria4860Open in IMG/M
3300032180|Ga0307471_103482436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300032261|Ga0306920_100016330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10221Open in IMG/M
3300033289|Ga0310914_11383350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil45.08%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil23.77%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.64%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_065899202189573002Grass SoilYYHFSVLRTLEDGFGLPSYLGSANDVTPIAVWRTLTS
Ga0066388_10620994333300005332Tropical Forest SoilAVPGSYGAKHYAYSLLRTFEDGFGLGSYLGDANAVTPVNEIWR*
Ga0070708_10119704023300005445Corn, Switchgrass And Miscanthus RhizospherePQVVPGSYDTQWFHYSLLRTLEDGFGLPAYLGDANEVAPINTIWQSP*
Ga0070708_10126767323300005445Corn, Switchgrass And Miscanthus RhizosphereGSYDQKYFHYSVLRTIEDGFALPGYLGNANDVTPIASIWRAPAG*
Ga0070706_10081316923300005467Corn, Switchgrass And Miscanthus RhizosphereSYDTQWFHYSLLRTLEDGFALPEYLGDANAVTPIDSIWQSP*
Ga0066691_1031711813300005586SoilYDTQWFHYSLLRTLEDGFALPEYLGDANAVTPIDAIWRSP*
Ga0066903_10015323343300005764Tropical Forest SoilPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVTPIASIWRPPAS*
Ga0066903_10054203623300005764Tropical Forest SoilMFQFVHYSLLRTIEDGFRLDEYLGNSDAVTPIASVWSAPAG*
Ga0066903_10121224323300005764Tropical Forest SoilAIISPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAISPIASIWRAPSR*
Ga0066903_10202489513300005764Tropical Forest SoilCAILSPLATPGSYGQKYYHYSLLRTIEDGFRLRGYLGNASAVAPIASIWRTPTG*
Ga0070717_1035951823300006028Corn, Switchgrass And Miscanthus RhizosphereYSLLRTLEDGFGLRAYLGNANAVTPIASIWRTPAG*
Ga0070717_1151909513300006028Corn, Switchgrass And Miscanthus RhizosphereGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPIASIWRPPPG*
Ga0070712_10056420313300006175Corn, Switchgrass And Miscanthus RhizosphereAGTYGQTYYHYSLLRTLEDGFGLRAYLGNANAVTPIATIWRTPTG*
Ga0066658_1033536513300006794SoilRAHYSLLRTLEDGFRLDGYVGYANDVKPITGMWR*
Ga0079221_1022891223300006804Agricultural SoilAAAGSYAHKYYHYSLLRTLEDGFRLGGYLGNAAAVGPIASIWRTPAG*
Ga0075425_10006968213300006854Populus RhizosphereHYSLLRTLEDGFGLAPYLGNANAVTPIASIWRPPPG*
Ga0075426_1001748013300006903Populus RhizosphereDQKYYHYSVLRTIEDGFRLNSYLGNANAVTPVNDIWR*
Ga0099827_1052127323300009090Vadose Zone SoilAILSPLAIPGSYGQQFFHYSLLRTIEDGFRLAGHLGNANDVAPVAGIWNSQ*
Ga0126374_1083974823300009792Tropical Forest SoilSYAHKYYHYSVLRTLEDGFRLGGHLGNANAVPPIAGTWRTPAR*
Ga0126384_1064394023300010046Tropical Forest SoilGRKYYHYSVLRTLEDGFRLGSYLGDANAVKPVNNIWR*
Ga0126384_1082935213300010046Tropical Forest SoilGSYGQKYYHYSVLRTVEDGFRLGGHLGAANAVPPIAGIWRAPAG*
Ga0126384_1121484613300010046Tropical Forest SoilQKYYHYSVLRTVEDGFRLGGHLGAANAVTPIAGIWRAPAG*
Ga0126373_1007068113300010048Tropical Forest SoilAIISPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVSPIASIWRAPSG*
Ga0126373_1019899223300010048Tropical Forest SoilVCAIISPLATAGSYDQQYYHDSLLRTIEDGFRLDGYLGNADAVTPIASIWHAPAS*
Ga0126373_1150399123300010048Tropical Forest SoilAIISPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVTPIASIWRPPAS*
Ga0126373_1251063313300010048Tropical Forest SoilSLLRTIEDGFRLDGYLGNADAVTPIASVWSATAG*
Ga0126373_1295150913300010048Tropical Forest SoilIISPLAIPGRYPQAYYHYSVLRTVEDGFRLAGYLGNANDVTPIASVWR*
Ga0126370_1157093423300010358Tropical Forest SoilCAIISPLAVAGSYGQKYYHYSLLRTIEDGFGLSSYLGNANAVTPINAVWQTRG*
Ga0126370_1203048323300010358Tropical Forest SoilPGSYDTKWYHYSLLRTLEDGFGISTYLGDANEVTPLSSIWRQT*
Ga0126376_1003821513300010359Tropical Forest SoilPGSYGQKYYHYSLLRTLEDGFSLGGYLGNANAVTPIARIWRTPAG*
Ga0126372_1038688013300010360Tropical Forest SoilSLLRTLEDGFRLGGYLGNANAVAPIASIWRPPAS*
Ga0126372_1124736813300010360Tropical Forest SoilPLAVPGSYGQKYYHYSLLRTLEDGFRLGGYLGNANAVSPIASIWRAPSG*
Ga0126378_1021974143300010361Tropical Forest SoilPGSYGQKYYHYSLLRTLEDGFRLRGYLGNASAVAPIASIWHAPTG*
Ga0126378_1083522533300010361Tropical Forest SoilCAIISPLAVPGSYGHKYYHYSLLRTLEDGFRLGGYLGNANNVTPIASIWRTPAN*
Ga0126378_1096188313300010361Tropical Forest SoilYHYSLLRTLEDGFRLGGYLGNAAAVGPIASIWRTPAG*
Ga0126378_1239292313300010361Tropical Forest SoilGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIARIWRTRAG*
Ga0126379_1248270113300010366Tropical Forest SoilYYHYSLLRTLEDGFRLRGYLGNASAVAPIASIWHTPAG*
Ga0126381_10010234613300010376Tropical Forest SoilYGQQYYHYCLPRTIEDGFRLGGYLGNADAVTPIASVWRAPAS*
Ga0126381_10146912813300010376Tropical Forest SoilPLAVPGSYGHKYYHYSLLRTLEDGFGLRQYLGNANAVTPIASIWRTPAN*
Ga0126381_10482637423300010376Tropical Forest SoilGSYGHKYYHYSLLRTLEDGFQLGRYLGNANAVTPIASIWQTPAN*
Ga0126383_1102347213300010398Tropical Forest SoilSLLRTLEDGFGLGAYLGNANAVTPIARIWRTPAG*
Ga0126383_1153503623300010398Tropical Forest SoilLAAAGSYGHTYYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRRPAN*
Ga0137391_1048493013300011270Vadose Zone SoilHYSLLRTIEDGLGLTGHVGNANDVTAINTIWRTPSS*
Ga0137389_1004895363300012096Vadose Zone SoilLSPLAIAGSYGQQFFHYSLLRTIEDGFRLAGHLGNANDVAPVAGIWNSQ*
Ga0137365_1101038023300012201Vadose Zone SoilLTHYSVLRTLEDGFGISEYVGNANAVTAISEIWR*
Ga0137384_1038734713300012357Vadose Zone SoilLAVPGSYGQKYYHYSVLRTLEDGFGITSYLGDANEVSPISSIWRR*
Ga0137404_1187720723300012929Vadose Zone SoilQRLTHYSLLRTIEDGFGLGPYLGNANAVTPIASIWRAPVG*
Ga0126369_1301384613300012971Tropical Forest SoilGSYGQKYYHYSLLRTLEDGFDLGAYLGNANAVTPLARIWRTPTG*
Ga0182037_1039188813300016404SoilYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG
Ga0187802_1033762523300017822Freshwater SedimentMFHVSSLLRTLEDGFGLPGYVGNANDVTPINGIWY
Ga0210402_1108696813300021478SoilATAGSYGQQYFHYSLLRTLEDGFGLGPYLGSANAVTPIASIWRAPVH
Ga0126371_1054884833300021560Tropical Forest SoilSYGQKYYHYSLLRTLEDGFSLGGYLGNANAVTPIARIWRTPAG
Ga0126371_1092616433300021560Tropical Forest SoilSYGQKYYHYSLLRTLEDGFRLGGYLGNANNVTPIASIWRTPAN
Ga0126371_1225499523300021560Tropical Forest SoilVCAIISPLATAGSYDQQYYHDSLLRTIEDGFRLDGYLGNADAVTPIASIWHAPAS
Ga0126371_1359160313300021560Tropical Forest SoilGQKYYHYSLLRTLEDGFSLGAYLGNANAVTPIAGIWRTPAG
Ga0207692_1019552923300025898Corn, Switchgrass And Miscanthus RhizosphereLATTATYGQTYYHYSLLRTLEDGFGLTPYLGNANAVTPIASIWRPPAS
Ga0207684_1058994813300025910Corn, Switchgrass And Miscanthus RhizosphereQTYYHYSVLRTIEDGFALPGYLGNANDVTPIASIWRAPAG
Ga0207700_1038820313300025928Corn, Switchgrass And Miscanthus RhizosphereLAAVGSYRQKYYHYSLLRTLEDGFGLRGYLGHASAVTPIASIWRTPAGRR
Ga0207664_1091197323300025929Agricultural SoilAYAQKYFHYSLLRTLEDGFRLSGYLGNAGAVTPIASIWRTPAG
Ga0257153_111867513300026490SoilHYSLLRTLEDGFRLGGYLGNANAVTPIASIWRTPAG
Ga0209178_119697513300027725Agricultural SoilISPLAFAGSYGQKYYHYSLLRTLEDGFRLDGYLGNANAVTAIGGIWRAPAG
Ga0209701_1055471023300027862Vadose Zone SoilILSPLAISGSYGQQFFHYSLLRTIEDGFRLAGHLGNANDVAPVAGIWNSQ
Ga0318571_1037482313300031549SoilKYYHYSLLRTVEDGFRLRGYLGDANRVAPIASVWRAPAG
Ga0318528_1050946313300031561SoilAVVIVLLAVPGSHGQKYYHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS
Ga0318528_1055279313300031561SoilKYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG
Ga0318573_1010276013300031564SoilHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAN
Ga0318573_1028519513300031564SoilYYHYSLLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG
Ga0318555_1053285913300031640SoilCAIISPLAVAGSYGRQYYHYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG
Ga0318542_1045255413300031668SoilILSPLATPGSYGQKYYHYSLLRTLEDGFRLHGYLGNANAVAPIASIWHTPTG
Ga0318560_1064696913300031682SoilYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPINSIWRPPGG
Ga0306917_1001395573300031719SoilLATAGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG
Ga0318493_1003981843300031723SoilYSLLRTVEDGFRLRGYLGKARAVAPIASIWRTPAG
Ga0318493_1029071613300031723SoilHYSLLRTIEDGFNLGQYLGNANAVTPVTSIWRPPGG
Ga0318500_10001128103300031724SoilRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET
Ga0318501_1000257813300031736SoilGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG
Ga0318501_1073692113300031736SoilHKYYHYSLLRTIQDGFGLRPYLGNASAVPPIARIWRPPAN
Ga0318492_1056406623300031748SoilSYGQTYYHYSLLRTIEDGFNLGQYLGNANAVTPVTSIWRPPGG
Ga0318535_1003221713300031764SoilHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0318535_1029285723300031764SoilSYSHKYYHYSLLRTIQDGFGLRPYLGNASAVPPIARIWRPPAN
Ga0318535_1040295113300031764SoilTYYHYSLLRTLEDGFGLAPYLGNANAVTPINSIWRPPGG
Ga0318554_1010092513300031765SoilKYYHYSLLRTLEDGFGLGAYLGNANAVTPIASIWHPPAG
Ga0318554_1069541213300031765SoilLATAGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPINSIWRPPGG
Ga0318509_1031877213300031768SoilYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG
Ga0318521_1010286613300031770SoilYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG
Ga0318521_1064583213300031770SoilYYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAG
Ga0318566_1030199223300031779SoilIISRLAVPGSHGQKYYHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS
Ga0318508_102579113300031780SoilSPLAIAGAYGQTYYHYSLLRTLEDGFNLGGYLGNANAVTPIASIWRPPAN
Ga0318552_1003146513300031782SoilTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG
Ga0318557_1004677513300031795SoilTYYHYSLLRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET
Ga0318557_1047255313300031795SoilHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS
Ga0318550_1003903333300031797SoilYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAN
Ga0318523_1012257013300031798SoilYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAN
Ga0318567_1016250113300031821SoilAQKYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG
Ga0318564_1027004023300031831SoilYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0318499_1029962813300031832SoilVCAIISPLAVAGSYGRKYYHYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG
Ga0318517_1051936113300031835SoilKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0318544_1032272123300031880SoilGQKYYHYSLLRTIEDGFSLRPYLGNANAVTPITGIWRPPAG
Ga0306925_1047044123300031890SoilSYARKYYHYSLLHTVEDGFRLRGYLGNAGAVAPIASIWRTPAG
Ga0318520_1043363723300031897SoilGSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0306923_1236671713300031910SoilYHYSLLRTLEDGFGLGAYLGNANAVTPIASIWHPPAG
Ga0310913_1114867613300031945SoilIISPLAVAGSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0310909_1022356613300031947SoilPLAVAGSYGHKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0318563_1048910013300032009SoilAGSYGQKYYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0318563_1066704423300032009SoilYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG
Ga0318507_1001240153300032025SoilYHYSLLRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET
Ga0318549_1024473123300032041SoilYGQTYYHYSLLRTLEDGFGLGGYLGNANAVTPINSIWQTPPG
Ga0318556_1010707223300032043SoilHYSVLRTVEDGFRLRGYLGNAGAVAPIASIWRTPAG
Ga0318575_1000422873300032055SoilATAGTYGQTYYHYSLLRTLEDGFGLAPYLGNANAVTPITSIWRPPAG
Ga0318575_1015756423300032055SoilYYSYSLLRTLEDGFRLGGYLGNANTVAPIATIWRPPGG
Ga0318510_1055467523300032064SoilTAGSYAQKYYHYSLLRTLEDGFRLGGYLGNANKVAPIAGIWGAPGG
Ga0318514_1046269013300032066SoilISPLAIAGAYGQTYYHYSLLRTLEDGFNLGGYLGNANAVTPIARIWRVPAAHAAAHET
Ga0318514_1054112523300032066SoilSPLATAGSYAQKYYHYSLLRTLEDGFRLGGYLGNANKVAPIAGIWGAPGG
Ga0318524_1061055013300032067SoilYHYSLLRTLEDGFGLGGYLGNANAVTPIASIWRTPAG
Ga0318524_1065492813300032067SoilAVGAGDGQKYYHYSLLRTLEDGFGLGAYLGNANAVTPIGRIWRTPAS
Ga0306924_1230011023300032076SoilGSYGQKYYHYSLLRTIEDGFSLRPYLGSANAVTPITGIWRPPAG
Ga0318525_1023637233300032089SoilQKYYHYSLLRTLEDGFRLGGYLGDANRVAPIASIWRAPAG
Ga0318525_1063965423300032089SoilYSLLRTLEDGFGLGGYLGNANAVTPINSIWQTPPG
Ga0318577_1058739523300032091SoilTYYHYSLLRTIEDGFGLRPYLGNANAVTPIASIWRPPAG
Ga0307471_10002013063300032180Hardwood Forest SoilPGSYGQKYYHYSLLRTLEDGFGLRPYLGNANAVTPIASIWRTPAG
Ga0307471_10348243623300032180Hardwood Forest SoilPGSYGQKYYHYSLLRTFEDGYRLGTYLGDANAVTPVSDIWR
Ga0306920_10001633013300032261SoilPLAIAGSYGQTYYHYSLLRTIEDGFNLGQYLGNANAVTPVTSIWRPPGG
Ga0310914_1138335023300033289SoilHYSLLRTLEDGFRLGGYLGNANTVAPIATIWRPPGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.