NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071423

Metagenome / Metatranscriptome Family F071423

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071423
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 40 residues
Representative Sequence EPEDGWVTLLSETLWPSEVIRRVRPAVQPFDIHIARPN
Number of Associated Samples 104
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.18 %
% of genes from short scaffolds (< 2000 bps) 91.80 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(22.951 % of family members)
Environment Ontology (ENVO) Unclassified
(26.230 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.180 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.12%    β-sheet: 0.00%    Coil/Unstructured: 87.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF12704MacB_PCD 11.48
PF14125DUF4292 4.10
PF02687FtsX 3.28
PF00005ABC_tran 1.64
PF00891Methyltransf_2 0.82
PF01128IspD 0.82
PF17131LolA_like 0.82
PF13927Ig_3 0.82
PF07969Amidohydro_3 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0746Molybdopterin-guanine dinucleotide biosynthesis protein ACoenzyme transport and metabolism [H] 0.82
COG1207Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferaseCell wall/membrane/envelope biogenesis [M] 0.82
COG12112-C-methyl-D-erythritol 4-phosphate cytidylyltransferaseLipid transport and metabolism [I] 0.82
COG2068CTP:molybdopterin cytidylyltransferase MocACoenzyme transport and metabolism [H] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c1186061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3122Open in IMG/M
2228664022|INPgaii200_c1186172All Organisms → cellular organisms → Bacteria → Acidobacteria709Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101325543All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300000955|JGI1027J12803_102611400All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300001154|JGI12636J13339_1046679All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300001431|F14TB_104809488All Organisms → cellular organisms → Bacteria → Acidobacteria992Open in IMG/M
3300002558|JGI25385J37094_10190003All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300005177|Ga0066690_10268241All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300005440|Ga0070705_100879111All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300005526|Ga0073909_10147425All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300005586|Ga0066691_10241910All Organisms → cellular organisms → Bacteria → Acidobacteria1058Open in IMG/M
3300005610|Ga0070763_10799812All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300005712|Ga0070764_10341030All Organisms → cellular organisms → Bacteria → Acidobacteria873Open in IMG/M
3300006162|Ga0075030_101386608All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300006176|Ga0070765_101918887All Organisms → cellular organisms → Bacteria → Acidobacteria555Open in IMG/M
3300006354|Ga0075021_10970986All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300006603|Ga0074064_10553251All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300006806|Ga0079220_10181347All Organisms → cellular organisms → Bacteria → Acidobacteria1196Open in IMG/M
3300006893|Ga0073928_10330750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1134Open in IMG/M
3300006904|Ga0075424_100007895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae10353Open in IMG/M
3300006954|Ga0079219_10951788All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium703Open in IMG/M
3300007255|Ga0099791_10128735All Organisms → cellular organisms → Bacteria → Acidobacteria1175Open in IMG/M
3300007265|Ga0099794_10292387All Organisms → cellular organisms → Bacteria → Acidobacteria843Open in IMG/M
3300009090|Ga0099827_10056557All Organisms → cellular organisms → Bacteria → Acidobacteria2972Open in IMG/M
3300009522|Ga0116218_1351298All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300009523|Ga0116221_1393788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales603Open in IMG/M
3300009665|Ga0116135_1384462All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300009792|Ga0126374_10615591All Organisms → cellular organisms → Bacteria → Acidobacteria804Open in IMG/M
3300010046|Ga0126384_10983446All Organisms → cellular organisms → Bacteria → Acidobacteria767Open in IMG/M
3300010303|Ga0134082_10043251All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1717Open in IMG/M
3300010341|Ga0074045_11066340All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300011269|Ga0137392_10903700All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300011269|Ga0137392_11258147All Organisms → cellular organisms → Bacteria → Acidobacteria599Open in IMG/M
3300011271|Ga0137393_11533842All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300012096|Ga0137389_10244177All Organisms → cellular organisms → Bacteria → Acidobacteria1507Open in IMG/M
3300012202|Ga0137363_10887024All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300012203|Ga0137399_10136971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1942Open in IMG/M
3300012205|Ga0137362_10357110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1265Open in IMG/M
3300012205|Ga0137362_11691607All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300012361|Ga0137360_11847464All Organisms → cellular organisms → Bacteria → Acidobacteria510Open in IMG/M
3300012363|Ga0137390_10015816All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6849Open in IMG/M
3300012363|Ga0137390_10852940All Organisms → cellular organisms → Bacteria → Acidobacteria867Open in IMG/M
3300012925|Ga0137419_10341328All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300012929|Ga0137404_11077848All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300012931|Ga0153915_10519737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1362Open in IMG/M
3300012944|Ga0137410_11953227All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300015053|Ga0137405_1229700All Organisms → cellular organisms → Bacteria → Acidobacteria1013Open in IMG/M
3300015054|Ga0137420_1106063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3560Open in IMG/M
3300015193|Ga0167668_1019573All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300015241|Ga0137418_10114566All Organisms → cellular organisms → Bacteria → Acidobacteria2411Open in IMG/M
3300017955|Ga0187817_10471291All Organisms → cellular organisms → Bacteria → Acidobacteria801Open in IMG/M
3300018006|Ga0187804_10097163All Organisms → cellular organisms → Bacteria1206Open in IMG/M
3300018006|Ga0187804_10160157All Organisms → cellular organisms → Bacteria → Acidobacteria951Open in IMG/M
3300018086|Ga0187769_11322268All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300018088|Ga0187771_10057950All Organisms → cellular organisms → Bacteria3034Open in IMG/M
3300018088|Ga0187771_10414846All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300019789|Ga0137408_1041127All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300020140|Ga0179590_1097317All Organisms → cellular organisms → Bacteria → Acidobacteria791Open in IMG/M
3300020199|Ga0179592_10012989All Organisms → cellular organisms → Bacteria → Acidobacteria3629Open in IMG/M
3300020579|Ga0210407_11101530All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300020580|Ga0210403_10218292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1565Open in IMG/M
3300020580|Ga0210403_11360068All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300020581|Ga0210399_11346949All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300021088|Ga0210404_10293683All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300021088|Ga0210404_10298375All Organisms → cellular organisms → Bacteria → Acidobacteria886Open in IMG/M
3300021171|Ga0210405_11214836All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300021180|Ga0210396_10327453All Organisms → cellular organisms → Bacteria → Acidobacteria1353Open in IMG/M
3300021180|Ga0210396_10589550All Organisms → cellular organisms → Bacteria → Acidobacteria967Open in IMG/M
3300021403|Ga0210397_10636772All Organisms → cellular organisms → Bacteria → Acidobacteria817Open in IMG/M
3300021406|Ga0210386_11590098All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300021433|Ga0210391_11275684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300021433|Ga0210391_11425477All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300021476|Ga0187846_10191910All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300021478|Ga0210402_11538588All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300021478|Ga0210402_11925952All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300021559|Ga0210409_11392818All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300021559|Ga0210409_11663338All Organisms → cellular organisms → Bacteria → Acidobacteria515Open in IMG/M
3300022557|Ga0212123_10245612All Organisms → cellular organisms → Bacteria → Acidobacteria1289Open in IMG/M
3300024310|Ga0247681_1056389All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300024330|Ga0137417_1121097All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300025905|Ga0207685_10057545All Organisms → cellular organisms → Bacteria → Acidobacteria1525Open in IMG/M
3300026301|Ga0209238_1129214All Organisms → cellular organisms → Bacteria → Acidobacteria819Open in IMG/M
3300026325|Ga0209152_10346328All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300026959|Ga0207852_1001003All Organisms → cellular organisms → Bacteria → Acidobacteria3427Open in IMG/M
3300027023|Ga0207736_104427All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300027034|Ga0209730_1044561All Organisms → cellular organisms → Bacteria → Acidobacteria518Open in IMG/M
3300027297|Ga0208241_1070449All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300027576|Ga0209003_1080756All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300027643|Ga0209076_1178593All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300027655|Ga0209388_1067480All Organisms → cellular organisms → Bacteria → Acidobacteria1031Open in IMG/M
3300027674|Ga0209118_1182566All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300027745|Ga0209908_10046364All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300028536|Ga0137415_10927278All Organisms → cellular organisms → Bacteria → Acidobacteria681Open in IMG/M
3300028746|Ga0302233_10429765All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300028884|Ga0307308_10073648All Organisms → cellular organisms → Bacteria → Acidobacteria1614Open in IMG/M
3300029636|Ga0222749_10123268All Organisms → cellular organisms → Bacteria → Acidobacteria1239Open in IMG/M
3300030617|Ga0311356_11584658All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300031170|Ga0307498_10321452All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300031543|Ga0318516_10853709All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300031708|Ga0310686_102644889All Organisms → cellular organisms → Bacteria → Acidobacteria1190Open in IMG/M
3300031708|Ga0310686_109993245All Organisms → cellular organisms → Bacteria → Acidobacteria1385Open in IMG/M
3300031740|Ga0307468_101084503All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300031753|Ga0307477_10671487All Organisms → cellular organisms → Bacteria → Acidobacteria695Open in IMG/M
3300031753|Ga0307477_10815118All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300031770|Ga0318521_10474002All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300031820|Ga0307473_11056668All Organisms → cellular organisms → Bacteria → Acidobacteria596Open in IMG/M
3300031823|Ga0307478_10261090All Organisms → cellular organisms → Bacteria → Acidobacteria1410Open in IMG/M
3300031879|Ga0306919_10249667All Organisms → cellular organisms → Bacteria → Acidobacteria1334Open in IMG/M
3300031893|Ga0318536_10642484All Organisms → cellular organisms → Bacteria → Acidobacteria529Open in IMG/M
3300031912|Ga0306921_12559914All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300031945|Ga0310913_10203502All Organisms → cellular organisms → Bacteria → Acidobacteria1383Open in IMG/M
3300031945|Ga0310913_11074763All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300031946|Ga0310910_11017577All Organisms → cellular organisms → Bacteria → Acidobacteria647Open in IMG/M
3300031947|Ga0310909_10308933All Organisms → cellular organisms → Bacteria → Acidobacteria1325Open in IMG/M
3300031962|Ga0307479_10499279All Organisms → cellular organisms → Bacteria → Acidobacteria1200Open in IMG/M
3300031981|Ga0318531_10499653All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300032180|Ga0307471_100045348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3570Open in IMG/M
3300032180|Ga0307471_100361161All Organisms → cellular organisms → Bacteria → Acidobacteria1566Open in IMG/M
3300032180|Ga0307471_101247993All Organisms → cellular organisms → Bacteria → Acidobacteria906Open in IMG/M
3300032180|Ga0307471_101329480All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300033158|Ga0335077_10593030All Organisms → cellular organisms → Bacteria → Acidobacteria1157Open in IMG/M
3300033289|Ga0310914_10209759All Organisms → cellular organisms → Bacteria → Acidobacteria1741Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil22.95%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.13%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.28%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.46%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.46%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.46%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.64%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.64%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.64%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.64%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.64%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.82%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.82%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.82%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.82%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.82%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027023Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes)EnvironmentalOpen in IMG/M
3300027034Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_118606152228664022SoilRYSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFDVHIARPN
INPgaii200_118617222228664022SoilSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFHVHIARPN
INPhiseqgaiiFebDRAFT_10132554323300000364SoilICELDDGWVTLLSEALWPSEIVRRLRPAAQSFNVHIARPN*
JGI1027J12803_10261140023300000955SoilYSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFDVHIARPN*
JGI12636J13339_104667923300001154Forest SoilICEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN*
F14TB_10480948823300001431SoilADGWVALLSETLWSSEVIRRVRPAAQSFDVYVARPH*
JGI25385J37094_1019000313300002558Grasslands SoilICEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIYIARPN*
Ga0066690_1026824123300005177SoilICEPEDGWVTLLSESLWPSEVIRRVRPAIRPFDIHIARPN*
Ga0070705_10087911123300005440Corn, Switchgrass And Miscanthus RhizosphereRYSFCAICEIDDGWVTLLSETLWPSEVVRRLRPAAQSFHVHIARPN*
Ga0073909_1014742513300005526Surface SoilFEDGWVTLLSESMWSSEVIRRVRPAAQSFDVHINRPQ*
Ga0066691_1024191023300005586SoilYTFCAICEPDDGWMTLLSQRLWPSEIIRRARPALQPFDVHIARPQ*
Ga0070763_1079981223300005610SoilGRRVVTLLSATLWASEVIRRVRPAVLPFDIYIARPQ*
Ga0070764_1034103023300005712SoilDGWVTLLSATLWASEIIRRARPAALPFDIYLARPQ*
Ga0075030_10138660813300006162WatershedsPEDAWVTLLSEGLWPSEVIRRLRPALQPFDVYIARPQ*
Ga0070765_10191888723300006176SoilDGWVTLLSATLWASEVIRRARPAVLPFDIYIARPQ*
Ga0075021_1097098623300006354WatershedsCEPDDGWMTLLSKTLWPSEIIRRARPALQPFDVHIARPQ*
Ga0074064_1055325113300006603SoilELEDGWLTILSETLWPSEVIRRVRPAAQPFDVHIARPN*
Ga0079220_1018134713300006806Agricultural SoilTFCAVCEPGDGWVTVLSQTLWPSEVIRRARPVVQRFDVHIARPN*
Ga0073928_1033075013300006893Iron-Sulfur Acid SpringEDGWVTLLSKTLWPTEIIRRIRPAAQKFDVYIARPH*
Ga0075424_100007895103300006904Populus RhizosphereCELDDGWVTLLSEGLWPSEVVRRLRPAAQSFDVHIARPN*
Ga0079219_1095178823300006954Agricultural SoilVCEPEDGWVTLLSKTLWASEVIRRLRPAVERFDVYLARPQ*
Ga0099791_1012873513300007255Vadose Zone SoilEDGWVTLLSEFLWPSEVIRRVRPAVQPFDIHIARPN*
Ga0099794_1029238723300007265Vadose Zone SoilAICEPEDGWVTLLSETLWPSEVIRRLRPVVQPFDVHIARPN*
Ga0099827_1005655743300009090Vadose Zone SoilCAICEPEDGWVTLLSESLWPSELIRRLRPALLPFDMHIARPN*
Ga0116218_135129823300009522Peatlands SoilPEDAWVTLLSEGPWPSEGIRRVRPALQPFDVYIARPQ*
Ga0116221_139378813300009523Peatlands SoilYTRYTFCSVVQPEDAWGTPLSQGLWPSEVTRRVRPALQPFDVYIARPQ*
Ga0116135_138446223300009665PeatlandEPEDGWVTLLSKTLWPTEVIRRVRPAVQRFDVYIARPH*
Ga0126374_1061559113300009792Tropical Forest SoilGWVTLLSEGLWPSEVVRRLRPAAKSFDVHIARPN*
Ga0126384_1098344613300010046Tropical Forest SoilAICELEDGWMTLLSDTLWPSEVVRRLRPAAQSFDVRISRPR*
Ga0134082_1004325113300010303Grasslands SoilGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN*
Ga0074045_1106634023300010341Bog Forest SoilCAVAEPEDGWVTLLSATLWPSEVIRRVRPAVQPFDIHIARPN*
Ga0137392_1090370023300011269Vadose Zone SoilEDGWVTLLSETLWPTEIIRRIRPAAQKFDVYIARPQ*
Ga0137392_1125814713300011269Vadose Zone SoilEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN*
Ga0137393_1153384213300011271Vadose Zone SoilDGWVTLLSDNIWSSEVIRRVRPAAQSFDVYIARPQ*
Ga0137389_1024417733300012096Vadose Zone SoilCEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYIARPH*
Ga0137363_1088702423300012202Vadose Zone SoilDGWVTLLSETIWSSEVIRRVRPAAQSFDVYIARPQ*
Ga0137399_1013697113300012203Vadose Zone SoilICEPEDGWVTLLSESLWPSEVIRRLRPAVQPFDIYIARPN*
Ga0137362_1035711013300012205Vadose Zone SoilICEPEDGWVTLLSKSLWPSEIIRRLRPAVQPFDIYIARPN*
Ga0137362_1169160723300012205Vadose Zone SoilCEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIYIARPN*
Ga0137360_1184746423300012361Vadose Zone SoilEDGWVTLLSETLWPSEVIRRVRPAVQPFDIHIARPN*
Ga0137390_1001581693300012363Vadose Zone SoilCAICEPEDGWVTLLSESLWPSEIIRRLRPAVQPFDIHIARPN*
Ga0137390_1085294023300012363Vadose Zone SoilEPEDGWVTLLSQTLWSTEVIRRIRPAVQKFDVYLARPY*
Ga0137419_1034132813300012925Vadose Zone SoilDAYQPAYGRYTFCGVCEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYLARPH*
Ga0137404_1107784823300012929Vadose Zone SoilGGYTFCGVCEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYLARPH*
Ga0153915_1051973713300012931Freshwater WetlandsCDLADGWMTMLSETLWPSEILRRVRPALASFEVELARPN*
Ga0137410_1195322723300012944Vadose Zone SoilCAICEPEDGWVTLLSETLWPSEIIRRLRPAVQPFDVHIARPN*
Ga0137405_122970013300015053Vadose Zone SoilTRYTFCAICETDDGWVTLLSQTLWPSEIIRRARPALQPFDVHIARPQ*
Ga0137420_110606363300015054Vadose Zone SoilAYTRYTFCAICEPNDGWVTLLSQTLWPSEIIRRARPALQPFDVHIARPQ*
Ga0167668_101957333300015193Glacier Forefield SoilPEDGWVTLLSETLWPTEVIRRIRPAAQKFDVYIARPH*
Ga0137418_1011456613300015241Vadose Zone SoilEDGWVTLLSETLWPSEVIRRLRPAVQPFDVHIARPN*
Ga0187817_1047129123300017955Freshwater SedimentCEPSNGWVTLLSESLWPTEVIRRVRPALQTLDVNIARPQ
Ga0187804_1009716313300018006Freshwater SedimentCEPEDGWITLLSKTLWPTEVIRRIRPAVQRFDVYISRPH
Ga0187804_1016015723300018006Freshwater SedimentCAVVEPEDAWVTVLSETLWASEVIRRVRPALQPFDVYIARPQ
Ga0187769_1132226823300018086Tropical PeatlandDGWVTLLSESLWPSEIIRRVRPALQPFDVYIARPQ
Ga0187771_1005795043300018088Tropical PeatlandCELSDGWVTLLSESLWPSEIIRRVRPALQPFDVYIACPQ
Ga0187771_1041484613300018088Tropical PeatlandYPRYTFCAICELSDAWVTLLSESLWASEIIRRVRRALQPFDVYIARPQ
Ga0137408_104112723300019789Vadose Zone SoilEPEDGWVTLLSESLWPSEVIRRVRPAVQSFDIHIARPN
Ga0179590_109731713300020140Vadose Zone SoilCAICEPEDGWVTLLSESLWPSEVIRLVRPAIHPFDIHIARPN
Ga0179592_1001298953300020199Vadose Zone SoilDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN
Ga0210407_1110153013300020579SoilEDGWVTLLSQTLWPTEVIRRIRPALQKFDVYIARPH
Ga0210403_1021829213300020580SoilEPEDGWVTLLSESLWTSEVIRRVRPAVQPFDIYIARPN
Ga0210403_1136006813300020580SoilEPEDGWVTLLSETLWPSEVIRRVRPAVQPFDIHIARPN
Ga0210399_1134694923300020581SoilDGWVTILSETLWPSEIIRRLRPAVEPFDVHLARPN
Ga0210404_1029368313300021088SoilDDGWMTLLSQSLWPSEIIRRARPALQPFDVHIARPQ
Ga0210404_1029837523300021088SoilAICEPDDGWMTLLSTSLWPSEIIRRARPALQPFDVHIARPQ
Ga0210405_1121483613300021171SoilAVCEPEDGWVTLLSAALWASEVIRRLRPAVLPFDIYIARPQ
Ga0210396_1032745333300021180SoilFLAVCEPEDGWVTLLSATLWASEVIRRVRPAALPFDIYIARPQ
Ga0210396_1058955013300021180SoilAGCGPEDGWVTLLSATLWASEVIRRVRPAVQPFDIYIARPQ
Ga0210397_1063677213300021403SoilVCEPEDGWVTLLSKTLWASEVIRRLRSAVERFDVYLARPQ
Ga0210386_1159009823300021406SoilPEDGWVTLLSPTLWPTEVIRLIRGAVQKFDVYIARPH
Ga0210391_1127568413300021433SoilICEPEDGWVTLLSKTLWPSEVIRRIRPAVQRFDVYLARPQ
Ga0210391_1142547723300021433SoilICEPDDGWVTLLSPALWASEVIRRVRPAVLPFDIYIARPQ
Ga0187846_1019191013300021476BiofilmAICEPEDGWVTLLSETLWPSELIRRLRPAVQRFDLHIARPN
Ga0210402_1153858823300021478SoilRYTFCAICEPEDGWVTILSETLWPSEIIRRLRPAVEPFDVHLARPN
Ga0210402_1192595213300021478SoilTFCGICEPEDGWVTLLSQTLWPTEVIRRIRPAVQKFDVYLARPH
Ga0210409_1139281823300021559SoilAYARYTFCAICEPDDGWVTLLSQTLWPSEIIRRARPALQPFDVLIARPQ
Ga0210409_1166333823300021559SoilYGGYTFCGICEPEDGWVTLLSQTLWPTEVIRRIRPAVQKFDVYLARPH
Ga0212123_1024561213300022557Iron-Sulfur Acid SpringDGWFTLLSDSLWSSEVIRRIRPAVEPFDVYLARPQ
Ga0247681_105638913300024310SoilLDDGWVTLLSETLWPSEVVRRLRPAAQSFNVHIARPN
Ga0137417_112109713300024330Vadose Zone SoilTFCAICEPEDGWVTLLSESLWPSEVIIRRVRPAIHSFDIHIARPN
Ga0207685_1005754533300025905Corn, Switchgrass And Miscanthus RhizosphereFEDGWVTVLSQTLWSSEVIRRVRPAAQLFDVHISRPH
Ga0209238_112921413300026301Grasslands SoilELEDGWLTILSETLWPSEAIRRVRPAMQPFDVHIARPH
Ga0209152_1034632823300026325SoilEPEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN
Ga0207852_100100313300026959Tropical Forest SoilCAICEAAEGWVTVLSETLWPSEIIRRVRPVLQSFDVYIARPQ
Ga0207736_10442723300027023Tropical Forest SoilAAEGWVTVLSETLWPSEIIRRVRPVLQSFDVYIARPQ
Ga0209730_104456123300027034Forest SoilSFCAICEPEDGWVTLLSETLWPSELIRRLRPAVQRFDVHISRPN
Ga0208241_107044913300027297Forest SoilRYKFCAICEPEDGWITLLSESLWPSEIIRLLRPALRPFDVHIARPN
Ga0209003_108075613300027576Forest SoilEFEDGWVTLLSETIWSSEVIRRVRPAAQSFDVYISRPQ
Ga0209076_117859313300027643Vadose Zone SoilCGVCEPEDGWVTLLSETLWATEIIRRIRPAAQKFDVYIARPQ
Ga0209388_106748023300027655Vadose Zone SoilFCAVCEPEDGWVTLLSPILWPTEVIRRIRGAVQKFDIYVARPH
Ga0209118_118256613300027674Forest SoilEDGWVTLLSETLWPSEVIRRLRPAVQPFDVHIARPN
Ga0209908_1004636413300027745Thawing PermafrostGICEPEDGWVTLLSKTLWPTEVIRRLRPAVQRFDVYIARPH
Ga0137415_1092727813300028536Vadose Zone SoilDGWVTRLSEKIWSSEVIRRVRPAAQSFDVYIARPQ
Ga0302233_1042976513300028746PalsaWEAEDGWVTVLSDKLWPTEIIRRVRPAVQRFDVYISRPH
Ga0307308_1007364813300028884SoilYQPVYARYTFCAICEPEDGWVTLLSESLWPSEVIRLVRPAIHPFDIHIARPN
Ga0222749_1012326833300029636SoilFCAICEPEDGWVTILSETLWPSEIIRRLRPAVEPFDVHLARPN
Ga0311356_1158465823300030617PalsaICEPNDGWLTLLSDTLWSSEVIRRVRPALQPFDVYISRPQ
Ga0307498_1032145223300031170SoilPEDGWVTLLSDKLWPSEVMRRVRPALQPFDVYLARPQ
Ga0318516_1085370923300031543SoilAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ
Ga0310686_10264488923300031708SoilCEPEDGWVTLLSASLWASEVIRRVRPAVLPFDIYIARPQ
Ga0310686_10999324543300031708SoilVCEPEDGWVTLLSASLWASEVIRRVRPAVLPFEIYIARPQ
Ga0307468_10108450313300031740Hardwood Forest SoilRYTFCAICEPDDGWVTMLSQTLWPSEIIRRARPALQPFDVHIARPQ
Ga0307477_1067148713300031753Hardwood Forest SoilMFCAICEPDDGWVTLLSTSLWPTEIIRRARPALQPFDVHIARPQ
Ga0307477_1081511823300031753Hardwood Forest SoilEDGWVTLLSESLWPSEVIRRVRPAVQPFDIHIARPN
Ga0318521_1047400223300031770SoilCAVCEPEDAWVTLLSESLRPSEIIRRVRPALQQFDVYIARPQ
Ga0307473_1105666813300031820Hardwood Forest SoilAYGHYTFCGICQPDDGWVTLLSQTLWPTEVIRRIRPAVQKFDVYLARPH
Ga0307478_1026109013300031823Hardwood Forest SoilLDDGWVTLLSETLWPSEVVRRLRPAAQEFSIYISRPH
Ga0306919_1024966713300031879SoilICEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ
Ga0318536_1064248423300031893SoilEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ
Ga0306921_1255991423300031912SoilPEDGWMTVLSNSLWPSEVIRRIRPALQRFDVYIARPH
Ga0310913_1020350233300031945SoilAAEGWVTVLSETLWPSEIIRRVRPVLEPFDVYIARPQ
Ga0310913_1107476323300031945SoilAICEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ
Ga0310910_1101757713300031946SoilEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ
Ga0310909_1030893323300031947SoilEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIVRPQ
Ga0307479_1049927913300031962Hardwood Forest SoilDAYQPAFARYTLCAICEPEDGWATLLSQTLWPTEVIRRIRPAVQKFDVYIARPH
Ga0318531_1049965323300031981SoilDDGWVTLLSEGLWPSEVVRRLRPAAKSFNVHIARPN
Ga0307471_10004534813300032180Hardwood Forest SoilSDGWVTILSQSLWPSEIIRRVRPALQPFDVYIARPQ
Ga0307471_10036116113300032180Hardwood Forest SoilDAYTRYTFCAICEPDDGWVTLLSRTLWPSEIIRRARPALQPFDVHIARPQ
Ga0307471_10124799323300032180Hardwood Forest SoilELEDGCVTLLSETLWPSEVIRRLRPAVQPFDVHIARPN
Ga0307471_10132948023300032180Hardwood Forest SoilYTFCAICEPDDGWVTMLSQTLWPSEIIRRARPALQPFDVHIARPQ
Ga0335077_1059303013300033158SoilDGWVTVLSESLWPSEIIRRVRPSLQAFAVYIARPQ
Ga0310914_1020975913300033289SoilCEAAEGWVTVLSETLWPSEIIRRVRPVLQPFDVYIARPQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.