Basic Information | |
---|---|
Family ID | F071298 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 41 residues |
Representative Sequence | IAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.64 % |
% of genes near scaffold ends (potentially truncated) | 99.18 % |
% of genes from short scaffolds (< 2000 bps) | 93.44 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.541 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.393 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.230 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.279 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF03446 | NAD_binding_2 | 68.85 |
PF14833 | NAD_binding_11 | 20.49 |
PF03301 | Trp_dioxygenase | 3.28 |
PF13417 | GST_N_3 | 1.64 |
PF05145 | AbrB | 1.64 |
PF08241 | Methyltransf_11 | 0.82 |
PF00043 | GST_C | 0.82 |
PF02894 | GFO_IDH_MocA_C | 0.82 |
PF14237 | GYF_2 | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG3483 | Tryptophan 2,3-dioxygenase (vermilion) | Amino acid transport and metabolism [E] | 3.28 |
COG3180 | Uncharacterized membrane protein AbrB, regulator of aidB expression | General function prediction only [R] | 1.64 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 0.82 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.54 % |
Unclassified | root | N/A | 2.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000597|AF_2010_repII_A1DRAFT_10018862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1895 | Open in IMG/M |
3300001686|C688J18823_10088394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2151 | Open in IMG/M |
3300004479|Ga0062595_100817281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
3300005334|Ga0068869_101231733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
3300005363|Ga0008090_10206893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 659 | Open in IMG/M |
3300005543|Ga0070672_100762585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 850 | Open in IMG/M |
3300005546|Ga0070696_101388733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
3300005548|Ga0070665_100489875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
3300005558|Ga0066698_10974858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300005559|Ga0066700_10034316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2999 | Open in IMG/M |
3300005574|Ga0066694_10100772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1350 | Open in IMG/M |
3300005574|Ga0066694_10284070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
3300005577|Ga0068857_100239476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1661 | Open in IMG/M |
3300005764|Ga0066903_106631087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
3300005764|Ga0066903_107558040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
3300005937|Ga0081455_10707824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
3300006034|Ga0066656_10454440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
3300006048|Ga0075363_100887042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
3300006353|Ga0075370_10391197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
3300006575|Ga0074053_10008821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300006575|Ga0074053_12004822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
3300006579|Ga0074054_11921062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1261 | Open in IMG/M |
3300006852|Ga0075433_11452778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
3300006854|Ga0075425_100446050 | Not Available | 1490 | Open in IMG/M |
3300006871|Ga0075434_100486036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1256 | Open in IMG/M |
3300009088|Ga0099830_10043302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3135 | Open in IMG/M |
3300010043|Ga0126380_10762682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
3300010043|Ga0126380_10778935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 780 | Open in IMG/M |
3300010046|Ga0126384_12492569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 502 | Open in IMG/M |
3300010047|Ga0126382_10576495 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300010047|Ga0126382_11428117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 633 | Open in IMG/M |
3300010047|Ga0126382_11810067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
3300010048|Ga0126373_13170145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
3300010337|Ga0134062_10086895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1326 | Open in IMG/M |
3300010362|Ga0126377_12532090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300010362|Ga0126377_13502591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
3300010366|Ga0126379_13286491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300010375|Ga0105239_13655581 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010397|Ga0134124_12942462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
3300010398|Ga0126383_10824770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
3300010868|Ga0124844_1036359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1625 | Open in IMG/M |
3300012021|Ga0120192_10019577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1056 | Open in IMG/M |
3300012022|Ga0120191_10039925 | Not Available | 773 | Open in IMG/M |
3300012096|Ga0137389_10727126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 853 | Open in IMG/M |
3300012202|Ga0137363_10785204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
3300012204|Ga0137374_10058694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3885 | Open in IMG/M |
3300012208|Ga0137376_10754768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
3300012211|Ga0137377_11059002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
3300012355|Ga0137369_10381747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1021 | Open in IMG/M |
3300012360|Ga0137375_11087223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
3300012362|Ga0137361_11755598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300012910|Ga0157308_10198414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
3300012916|Ga0157310_10169031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
3300012929|Ga0137404_11657304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
3300012930|Ga0137407_10363401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1335 | Open in IMG/M |
3300012951|Ga0164300_10715855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
3300015374|Ga0132255_105138074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
3300016270|Ga0182036_11361254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
3300016341|Ga0182035_10574850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 971 | Open in IMG/M |
3300016357|Ga0182032_11232529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 644 | Open in IMG/M |
3300016404|Ga0182037_12087818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
3300016422|Ga0182039_10437654 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300018027|Ga0184605_10382417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 632 | Open in IMG/M |
3300018074|Ga0184640_10229303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
3300018081|Ga0184625_10129444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1314 | Open in IMG/M |
3300018089|Ga0187774_10844065 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300018476|Ga0190274_13704017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
3300019356|Ga0173481_10041465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1538 | Open in IMG/M |
3300019873|Ga0193700_1020592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1090 | Open in IMG/M |
3300021406|Ga0210386_10253728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1501 | Open in IMG/M |
3300021432|Ga0210384_11033378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
3300021439|Ga0213879_10067278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 970 | Open in IMG/M |
3300021560|Ga0126371_11011015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 973 | Open in IMG/M |
3300025914|Ga0207671_10593534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 883 | Open in IMG/M |
3300025915|Ga0207693_10013032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6709 | Open in IMG/M |
3300025916|Ga0207663_11226208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300026547|Ga0209156_10273095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
3300027521|Ga0209524_1001542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3924 | Open in IMG/M |
3300027521|Ga0209524_1021660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1329 | Open in IMG/M |
3300027824|Ga0209040_10130459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1381 | Open in IMG/M |
3300027846|Ga0209180_10166970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1269 | Open in IMG/M |
3300027884|Ga0209275_10616244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
3300027894|Ga0209068_10823073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 547 | Open in IMG/M |
3300027907|Ga0207428_10108229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2141 | Open in IMG/M |
3300028715|Ga0307313_10036206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1410 | Open in IMG/M |
3300028720|Ga0307317_10091148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1005 | Open in IMG/M |
3300028755|Ga0307316_10092312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1050 | Open in IMG/M |
3300028755|Ga0307316_10175026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
3300028782|Ga0307306_10203545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
3300028811|Ga0307292_10127203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1018 | Open in IMG/M |
3300028824|Ga0307310_10322204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 756 | Open in IMG/M |
3300028885|Ga0307304_10542283 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300031446|Ga0170820_12572319 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300031572|Ga0318515_10115082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1418 | Open in IMG/M |
3300031640|Ga0318555_10267774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 923 | Open in IMG/M |
3300031719|Ga0306917_10495098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 959 | Open in IMG/M |
3300031744|Ga0306918_10544230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 909 | Open in IMG/M |
3300031770|Ga0318521_10169416 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
3300031771|Ga0318546_10842437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
3300031779|Ga0318566_10140812 | Not Available | 1194 | Open in IMG/M |
3300031780|Ga0318508_1179151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
3300031781|Ga0318547_10237072 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
3300031792|Ga0318529_10162442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
3300031880|Ga0318544_10307285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300031902|Ga0302322_103109345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
3300031912|Ga0306921_11893134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 638 | Open in IMG/M |
3300031947|Ga0310909_10315669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1310 | Open in IMG/M |
3300031947|Ga0310909_11447926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300032009|Ga0318563_10454635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 692 | Open in IMG/M |
3300032010|Ga0318569_10578237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300032060|Ga0318505_10375981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 671 | Open in IMG/M |
3300032064|Ga0318510_10137891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 955 | Open in IMG/M |
3300032066|Ga0318514_10320989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
3300032076|Ga0306924_10121532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2971 | Open in IMG/M |
3300032076|Ga0306924_10525460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1345 | Open in IMG/M |
3300032076|Ga0306924_10555076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1303 | Open in IMG/M |
3300032076|Ga0306924_12404201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300032076|Ga0306924_12511655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300032089|Ga0318525_10304015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
3300032094|Ga0318540_10125918 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300032174|Ga0307470_10169517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1359 | Open in IMG/M |
3300032261|Ga0306920_101831759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.28% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.46% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.64% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.82% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.82% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.82% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.82% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.82% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.82% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.82% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006353 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Host-Associated | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
AF_2010_repII_A1DRAFT_100188621 | 3300000597 | Forest Soil | DSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGTPPDPSSS* |
C688J18823_100883941 | 3300001686 | Soil | TMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGPPPNDKRA* |
Ga0062595_1008172812 | 3300004479 | Soil | TLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ* |
Ga0068869_1012317332 | 3300005334 | Miscanthus Rhizosphere | MIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGLPSDDKRA* |
Ga0008090_102068931 | 3300005363 | Tropical Rainforest Soil | LIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0070672_1007625851 | 3300005543 | Miscanthus Rhizosphere | DSTMIAGFQLMRILIVLVWCRTALFMFRRVAEWTFGLPPDDEPA* |
Ga0070696_1013887332 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAGFQLMRIIIVLIWCRTALVLFRWLADWAFGKPPITSCSPD* |
Ga0070665_1004898752 | 3300005548 | Switchgrass Rhizosphere | IAGFQLMRILIVLVWCRTALVLFRRVAEWTFGLPSDDKRA* |
Ga0066698_109748581 | 3300005558 | Soil | GFQLMRIIIVLIWCRTALVLFQRVADWAFGKPPDARL* |
Ga0066700_100343164 | 3300005559 | Soil | LDSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ* |
Ga0066694_101007722 | 3300005574 | Soil | LGLDATLIAGFQLMRIIIVLIWCRTALVLFQRVADWAFGKPPDARL* |
Ga0066694_102840702 | 3300005574 | Soil | FQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ* |
Ga0068857_1002394763 | 3300005577 | Corn Rhizosphere | MIAGFQLMRILIVLVWCRTALVLFRRVAEWAFGPPPDDTRA* |
Ga0066903_1066310871 | 3300005764 | Tropical Forest Soil | STLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPE* |
Ga0066903_1075580401 | 3300005764 | Tropical Forest Soil | TLIAGFQLMRIIIVLIWCRTALVLFQRTAERVFGKPPEPPSS* |
Ga0081455_107078242 | 3300005937 | Tabebuia Heterophylla Rhizosphere | QLMRIIIVLIWCRTALALFRRVADWIYGKPVEPPSC* |
Ga0066656_104544402 | 3300006034 | Soil | FQLMRIIIVLIWCRTALVLFQRATERVFGKPPSQ* |
Ga0075363_1008870421 | 3300006048 | Populus Endosphere | LDSTMIAGFQLMRILIVLVWCRTALVLFRRVAEWAFGPPPDDTRA* |
Ga0075370_103911971 | 3300006353 | Populus Endosphere | MIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGPPSDEKRA* |
Ga0074053_100088211 | 3300006575 | Soil | GLDSTMIAGFQLMRILIVLVWCRTALVVFRRVAEWTFGLPPDDKRA* |
Ga0074053_120048221 | 3300006575 | Soil | LMRILIVLVWCRTALVLFRRVAEWTFGLPSDDKRA* |
Ga0074054_119210621 | 3300006579 | Soil | IAGFQLMRILIVLVWCRTALVVSRRVAEWTFGLPPDDKRA* |
Ga0075433_114527781 | 3300006852 | Populus Rhizosphere | FQLMRIIIVLIWCRTALVLFHRVADWAFGKPPITNCSPD* |
Ga0075425_1004460503 | 3300006854 | Populus Rhizosphere | TLIAGFQLMRIIIVLIWCRTALVLFHRVADWAFGKPPITNCSPD* |
Ga0075434_1004860361 | 3300006871 | Populus Rhizosphere | FQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0099830_100433024 | 3300009088 | Vadose Zone Soil | IAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ* |
Ga0126380_107626822 | 3300010043 | Tropical Forest Soil | GFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPDPSSS* |
Ga0126380_107789351 | 3300010043 | Tropical Forest Soil | FQLMRIIIVLIWCRTALVLFHRVADWVFGKPPGTSCSPD* |
Ga0126384_124925691 | 3300010046 | Tropical Forest Soil | GFQLMRIVIVLIWCRTALVLFNWAADRTFGKPPRP* |
Ga0126382_105764952 | 3300010047 | Tropical Forest Soil | IAGFQLMRIIIVLIWCRTALVLFRRVAEWTFGKPADTG* |
Ga0126382_114281172 | 3300010047 | Tropical Forest Soil | GLDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0126382_118100671 | 3300010047 | Tropical Forest Soil | TMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGTPPDPSSS* |
Ga0126373_131701452 | 3300010048 | Tropical Forest Soil | GFQLMRIIIVLIWCRTALVLFQRTAERVFGKPPEPPSS* |
Ga0134062_100868952 | 3300010337 | Grasslands Soil | FQLMRIIIVLIWCRTALVLFQRVADWAFGKPPDAGL* |
Ga0126377_125320901 | 3300010362 | Tropical Forest Soil | AGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDPPSS* |
Ga0126377_135025911 | 3300010362 | Tropical Forest Soil | MIAGFQLMRIIIVLIWCRTALVLFRRVAEWTFGKPADPGEHSAAS* |
Ga0126379_132864912 | 3300010366 | Tropical Forest Soil | STMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0105239_136555812 | 3300010375 | Corn Rhizosphere | STMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGTAPDKRA* |
Ga0134124_129424622 | 3300010397 | Terrestrial Soil | LGLDSTMIAGFQLMRILIVLVWCRTALFMFRRVAEWTFGLPPDDEPA* |
Ga0126383_108247702 | 3300010398 | Tropical Forest Soil | MRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0124844_10363591 | 3300010868 | Tropical Forest Soil | DSTMIAGFQLMRIIIVLIWCRTALILFKQVADWTYGKPPDSA* |
Ga0120192_100195771 | 3300012021 | Terrestrial | GFQLMRIIIVLIWCRTALVLFRHVAECTYGKEDPPSS* |
Ga0120191_100399251 | 3300012022 | Terrestrial | GFQLMRIIIVLIWCRTALILFKQVADWTYGKPPHSASP* |
Ga0137389_107271262 | 3300012096 | Vadose Zone Soil | GLDSTMIAGFQLMRIIIVLIWCRTALILFERVADWTFGKAPDSE* |
Ga0137363_107852041 | 3300012202 | Vadose Zone Soil | TMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPRDAE* |
Ga0137374_100586941 | 3300012204 | Vadose Zone Soil | LDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPDPPSS* |
Ga0137376_107547682 | 3300012208 | Vadose Zone Soil | LGLDSTLIAGFQLMRFIIVLIWCRTALVLFQRAAERVFGKPPSQ* |
Ga0137377_110590021 | 3300012211 | Vadose Zone Soil | TLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0137369_103817472 | 3300012355 | Vadose Zone Soil | GLDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPDPPSS* |
Ga0137375_110872231 | 3300012360 | Vadose Zone Soil | QLMRIIIVLIWCRTALVLFQRAAERVFGKPPDPPSS* |
Ga0137361_117555982 | 3300012362 | Vadose Zone Soil | IAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS* |
Ga0157308_101984142 | 3300012910 | Soil | STMIAGFQLMRILIVLVWCRTALFMFRRVAEWTFGLPPDDEPA* |
Ga0157310_101690311 | 3300012916 | Soil | GFQLMRILIVLVWCRTALFMFRRVAEWTFGLPPDDEPA* |
Ga0137404_116573042 | 3300012929 | Vadose Zone Soil | MIAGFQLMRILIVLVWCRTALILFKRVADWTFGKPLDPPHP* |
Ga0137407_103634012 | 3300012930 | Vadose Zone Soil | STLIAGFQLMRIIIVLIWCRTALVLFQRATERVFGKPPSQ* |
Ga0164300_107158551 | 3300012951 | Soil | LDATLIAGFQLMRIIIVLIWCRTALVLFHRVADWAFGKPLL* |
Ga0132255_1051380741 | 3300015374 | Arabidopsis Rhizosphere | STMIAGFQLMRIIIVLIWCRTALILFKQVADWIYGKALDPPGDDSWPMIHGP* |
Ga0182036_113612542 | 3300016270 | Soil | AGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ |
Ga0182035_105748502 | 3300016341 | Soil | GLDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAEHVFGKPPEPPSS |
Ga0182032_112325292 | 3300016357 | Soil | FQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0182037_120878182 | 3300016404 | Soil | LDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0182039_104376541 | 3300016422 | Soil | GLDSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0184605_103824171 | 3300018027 | Groundwater Sediment | IAGFQLMRILIVLVWCRTALFLFRRVAEWTFGLPPDDKRA |
Ga0184640_102293031 | 3300018074 | Groundwater Sediment | MIAGFQLMRILIVLVWCRTALFLFRRVAEWTFGLPPDDKR |
Ga0184625_101294442 | 3300018081 | Groundwater Sediment | IAGFQLMRIVIVLVWTRTALVLFRRVADEIYGKPEDHA |
Ga0187774_108440652 | 3300018089 | Tropical Peatland | QLTRIIIVLIWCRTALVLFDRLADWTYGKRPPSKDRP |
Ga0190274_137040171 | 3300018476 | Soil | QLMRILIVLVWCRTALVLFRRVAEWTFGPPDDTRA |
Ga0173481_100414651 | 3300019356 | Soil | LMRILIVLVWCRTALVLFRRVAEWTFGPPPDDTRV |
Ga0193700_10205921 | 3300019873 | Soil | MIAGFQLMRILIVLVWCRTALFLFRRVAEWTFGLPPDDKRA |
Ga0210386_102537283 | 3300021406 | Soil | DSTVIAGFQLARIIIVLIWSRTALQLFGPLADWACGKKDAKT |
Ga0210384_110333782 | 3300021432 | Soil | LMRIIIVLIWCRTALVLFRWLADWAFGKPPITNCSPD |
Ga0213879_100672782 | 3300021439 | Bulk Soil | LGLDSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPNGSL |
Ga0126371_110110152 | 3300021560 | Tropical Forest Soil | DSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPAEPPSS |
Ga0207671_105935341 | 3300025914 | Corn Rhizosphere | DSTMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGLPSDDKRA |
Ga0207693_100130321 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGFQLARIIIVLIWSRTALQLFGPLADWALGKPPPQINTRSE |
Ga0207663_112262082 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TLIAGFQLMRIIIVLIWCRTALVLFHRVADWAFGKPPITNCSPD |
Ga0209156_102730951 | 3300026547 | Soil | LDATLIAGFQLMRIIIVLIWCRTALVLFQRVADWAFGKPPDARL |
Ga0209524_10015425 | 3300027521 | Forest Soil | IAGFQLARIIIVLIWSRTALQLFGPLADWACGKKDAKT |
Ga0209524_10216601 | 3300027521 | Forest Soil | IAGFQLARIIIVLIWSRTALQLFGPLADWACGKPPRQINTSTE |
Ga0209040_101304591 | 3300027824 | Bog Forest Soil | GLDSTVIAGFQLMRVIVVLIWCRTALQLFGTLADWTVGKRS |
Ga0209180_101669702 | 3300027846 | Vadose Zone Soil | LDSTMIAGFQLMRIIIVLIWCRTALILFERVADWTFGKAPDSE |
Ga0209275_106162442 | 3300027884 | Soil | KVLGLDATVIAGFQLARIIIVLIWSRTALQLFGPLADWALGKKDAKT |
Ga0209068_108230731 | 3300027894 | Watersheds | LDATVITGFQLTRIIIVLIWCRTALILFERLADWTFGKK |
Ga0207428_101082291 | 3300027907 | Populus Rhizosphere | IAGFQLMRILIVLVWCRTALFMFRRVAEWTFGLPPDDEPA |
Ga0307313_100362061 | 3300028715 | Soil | GFQLMRILIVLVWCRTALFLFRRVAEWTFGLPPDDKRA |
Ga0307317_100911482 | 3300028720 | Soil | GFQLMRILIVLVWCRTALVLFRRVAEWTFGPPPNDKRA |
Ga0307316_100923122 | 3300028755 | Soil | VLGLDSTMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGPPPNDKRA |
Ga0307316_101750261 | 3300028755 | Soil | MIAGFQLMRILIVLVWCRTALVVFRRVAEWTFGLPPDDKQA |
Ga0307306_102035451 | 3300028782 | Soil | GLDSTMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGPPSDEKRV |
Ga0307292_101272031 | 3300028811 | Soil | VLGLDSTMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGPPSDEKRV |
Ga0307310_103222042 | 3300028824 | Soil | GLDSTTIAGFQLMRIIIVLIWCRTALILFKRVADWVYGKPADS |
Ga0307304_105422832 | 3300028885 | Soil | GLDSTMIAGFQLMRILIVLVWCRTALVLFRRVAEWTFGPPPNDKRA |
Ga0170820_125723192 | 3300031446 | Forest Soil | GLDSTMIAGFQLMRILIVLVWCRTALVVFRRVAEWTFGLPPDDKRA |
Ga0318515_101150823 | 3300031572 | Soil | TLIAGFQLMRIVIVLIWCRTALVLFNWAADRTFGKPPRP |
Ga0318555_102677741 | 3300031640 | Soil | GLDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDG |
Ga0306917_104950982 | 3300031719 | Soil | DSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERAFGKPPEPPSS |
Ga0306918_105442302 | 3300031744 | Soil | TLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0318521_101694161 | 3300031770 | Soil | GFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0318546_108424372 | 3300031771 | Soil | FQLMRVIIVLIWCRTALVLFQRAAERVFGKPPDPPSS |
Ga0318566_101408122 | 3300031779 | Soil | LDATLIAGFQLMRIVIVLIWCRTALVLFNWAADRTFGKPPRP |
Ga0318508_11791511 | 3300031780 | Soil | LGLDSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0318547_102370721 | 3300031781 | Soil | STMIAGFQLMRIIIVLIWCRTALVLFQRAAERAFGKPPEPPSS |
Ga0318529_101624422 | 3300031792 | Soil | GFQLMRIIIVLIWCRTALVLFQRAAERAFGKPPEPPSS |
Ga0318544_103072852 | 3300031880 | Soil | LIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0302322_1031093451 | 3300031902 | Fen | AAVITGFQLTRIIVVLIWCRTALIFFNWLADRAFGPAPGPQ |
Ga0306921_118931341 | 3300031912 | Soil | LDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDPSSS |
Ga0310909_103156692 | 3300031947 | Soil | MIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDG |
Ga0310909_114479262 | 3300031947 | Soil | LIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ |
Ga0318563_104546352 | 3300032009 | Soil | STMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDG |
Ga0318569_105782372 | 3300032010 | Soil | DSTMIAGFQLMRIIIVLIWCRTALVLFQRAAEHVFGKPPDQ |
Ga0318505_103759811 | 3300032060 | Soil | TMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKTPEG |
Ga0318510_101378911 | 3300032064 | Soil | AGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDPSSS |
Ga0318514_103209892 | 3300032066 | Soil | FQLMRIIIVLIWCRTALVLFQRAAEHVFGKPPEPPSS |
Ga0306924_101215321 | 3300032076 | Soil | GLDSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPSQ |
Ga0306924_105254601 | 3300032076 | Soil | GFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDPSSS |
Ga0306924_105550762 | 3300032076 | Soil | AGFQLMRIIIVLIWCRTALVLFQRAAEHVFGKPPEPPSS |
Ga0306924_124042012 | 3300032076 | Soil | GLDSTLIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGKPPDPPSS |
Ga0306924_125116551 | 3300032076 | Soil | TMIAGFQLMRIIVVLIWCRTALVLFQRAAEHVFGKPPDQ |
Ga0318525_103040152 | 3300032089 | Soil | KVLGLDSTMIAGFQLMRIIIVLIWCRTALVLFQRAAERVFGAPPDG |
Ga0318540_101259182 | 3300032094 | Soil | QLMRIIIVLIWCRTALVLFQRAAERVFGKPPEPPSS |
Ga0307470_101695172 | 3300032174 | Hardwood Forest Soil | MIAGFQLMRILIVLVWCRTALVLFRRVAEWTFSPPPNDKRA |
Ga0306920_1018317592 | 3300032261 | Soil | FQLMRIIIVLIWCRTALVLFKRAAERVFGAPPDSSSS |
⦗Top⦘ |