NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071285

Metagenome Family F071285

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071285
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 116 residues
Representative Sequence FFLLARNIKPLARFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Number of Associated Samples 105
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.54 %
% of genes from short scaffolds (< 2000 bps) 94.26 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.902 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(30.328 % of family members)
Environment Ontology (ENVO) Unclassified
(40.164 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.623 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 61.18%    β-sheet: 0.00%    Coil/Unstructured: 38.82%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF030614HBT 73.77
PF02163Peptidase_M50 8.20
PF00994MoCF_biosynth 1.64



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.90 %
UnclassifiedrootN/A4.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_164998All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium926Open in IMG/M
3300004156|Ga0062589_102709948All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300004157|Ga0062590_102566008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium541Open in IMG/M
3300004157|Ga0062590_102719813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300004463|Ga0063356_102041277All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium869Open in IMG/M
3300004643|Ga0062591_100985870All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium800Open in IMG/M
3300005166|Ga0066674_10162058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1058Open in IMG/M
3300005288|Ga0065714_10337147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300005288|Ga0065714_10429757Not Available566Open in IMG/M
3300005290|Ga0065712_10442316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium693Open in IMG/M
3300005290|Ga0065712_10560639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium612Open in IMG/M
3300005293|Ga0065715_10547269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium743Open in IMG/M
3300005330|Ga0070690_100631974All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium816Open in IMG/M
3300005333|Ga0070677_10518049All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300005335|Ga0070666_10564148All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium829Open in IMG/M
3300005345|Ga0070692_10756871All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300005354|Ga0070675_100099186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2451Open in IMG/M
3300005354|Ga0070675_101486505All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium625Open in IMG/M
3300005355|Ga0070671_101265611All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium650Open in IMG/M
3300005364|Ga0070673_100119841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2193Open in IMG/M
3300005364|Ga0070673_102092122All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300005444|Ga0070694_101298970Not Available612Open in IMG/M
3300005466|Ga0070685_10911818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium654Open in IMG/M
3300005539|Ga0068853_100186980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea1881Open in IMG/M
3300005543|Ga0070672_100147369All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1945Open in IMG/M
3300005577|Ga0068857_102108809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium553Open in IMG/M
3300005616|Ga0068852_101829170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium630Open in IMG/M
3300005617|Ga0068859_101141745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Terrimonas → Terrimonas ferruginea857Open in IMG/M
3300005618|Ga0068864_101261904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium738Open in IMG/M
3300005834|Ga0068851_10676178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium634Open in IMG/M
3300005841|Ga0068863_102169096All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300006358|Ga0068871_100734051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae907Open in IMG/M
3300006358|Ga0068871_102007090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300007004|Ga0079218_11071797All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium818Open in IMG/M
3300009094|Ga0111539_10242651All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2098Open in IMG/M
3300009100|Ga0075418_10042107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4930Open in IMG/M
3300009101|Ga0105247_10573964All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium833Open in IMG/M
3300009156|Ga0111538_10348145All Organisms → cellular organisms → Bacteria1875Open in IMG/M
3300009176|Ga0105242_11200683All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium778Open in IMG/M
3300010364|Ga0134066_10283121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300010397|Ga0134124_11641118All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium674Open in IMG/M
3300010400|Ga0134122_10243893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1514Open in IMG/M
3300011435|Ga0137426_1169050All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium648Open in IMG/M
3300012882|Ga0157304_1094141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300012885|Ga0157287_1005585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1281Open in IMG/M
3300012892|Ga0157294_10074417All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium824Open in IMG/M
3300012893|Ga0157284_10102350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium750Open in IMG/M
3300012895|Ga0157309_10158593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300012896|Ga0157303_10135852All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium643Open in IMG/M
3300012898|Ga0157293_10069005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium837Open in IMG/M
3300012898|Ga0157293_10152621Not Available654Open in IMG/M
3300012899|Ga0157299_10259795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium555Open in IMG/M
3300012901|Ga0157288_10402523All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300012902|Ga0157291_10277564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300012903|Ga0157289_10334033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium548Open in IMG/M
3300012904|Ga0157282_10011091All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1639Open in IMG/M
3300012906|Ga0157295_10364650All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300012907|Ga0157283_10324928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300012908|Ga0157286_10055712All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1031Open in IMG/M
3300012909|Ga0157290_10152115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium742Open in IMG/M
3300012910|Ga0157308_10100464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium852Open in IMG/M
3300012913|Ga0157298_10363387All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300012915|Ga0157302_10240076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium673Open in IMG/M
3300012916|Ga0157310_10523779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300012984|Ga0164309_10659323All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium825Open in IMG/M
3300013308|Ga0157375_10987693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium982Open in IMG/M
3300014326|Ga0157380_11454120All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300014326|Ga0157380_11486001All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium730Open in IMG/M
3300014326|Ga0157380_12061632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium633Open in IMG/M
3300014969|Ga0157376_10267604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1604Open in IMG/M
3300015077|Ga0173483_10413753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium696Open in IMG/M
3300015077|Ga0173483_10748893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300015200|Ga0173480_11230055All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300015201|Ga0173478_10238295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium788Open in IMG/M
3300015201|Ga0173478_10830308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300015372|Ga0132256_101657749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium749Open in IMG/M
3300015373|Ga0132257_102460813All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium676Open in IMG/M
3300017792|Ga0163161_11965324All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium520Open in IMG/M
3300018067|Ga0184611_1270311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium597Open in IMG/M
3300018072|Ga0184635_10046646All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1666Open in IMG/M
3300018073|Ga0184624_10201939All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium887Open in IMG/M
3300018081|Ga0184625_10056607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1971Open in IMG/M
3300018081|Ga0184625_10479660All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium632Open in IMG/M
3300018083|Ga0184628_10352228All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium772Open in IMG/M
3300018476|Ga0190274_10133607All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2056Open in IMG/M
3300018481|Ga0190271_10824921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1052Open in IMG/M
3300019362|Ga0173479_10075860All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1180Open in IMG/M
3300019362|Ga0173479_10189501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium858Open in IMG/M
3300019362|Ga0173479_10232866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium799Open in IMG/M
3300019362|Ga0173479_10426450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium648Open in IMG/M
3300019871|Ga0193702_1013359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1063Open in IMG/M
3300019876|Ga0193703_1068115All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium529Open in IMG/M
3300020005|Ga0193697_1010716All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2232Open in IMG/M
3300021510|Ga0222621_1061471All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium790Open in IMG/M
3300022898|Ga0247745_1080779All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium545Open in IMG/M
3300022901|Ga0247788_1051110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium769Open in IMG/M
3300022915|Ga0247790_10040703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1051Open in IMG/M
3300023064|Ga0247801_1036542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium717Open in IMG/M
3300023077|Ga0247802_1005040All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1607Open in IMG/M
3300023078|Ga0247756_1044315All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium763Open in IMG/M
3300023260|Ga0247798_1029981All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium708Open in IMG/M
3300023261|Ga0247796_1118219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300023265|Ga0247780_1069319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes903Open in IMG/M
3300023266|Ga0247789_1108431All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300025905|Ga0207685_10546677All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300025931|Ga0207644_10669419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium865Open in IMG/M
3300025986|Ga0207658_11406195All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium638Open in IMG/M
3300026067|Ga0207678_11676347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium559Open in IMG/M
3300026142|Ga0207698_10510444All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1171Open in IMG/M
3300026316|Ga0209155_1124760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium891Open in IMG/M
3300031538|Ga0310888_10109274All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB21420Open in IMG/M
3300031547|Ga0310887_10466434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium755Open in IMG/M
3300031547|Ga0310887_10498556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium733Open in IMG/M
3300031854|Ga0310904_11168594All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium554Open in IMG/M
3300031854|Ga0310904_11302949All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium526Open in IMG/M
3300031892|Ga0310893_10453048All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300031908|Ga0310900_11879971Not Available510Open in IMG/M
3300031944|Ga0310884_10439710Not Available756Open in IMG/M
3300032012|Ga0310902_10117416All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1454Open in IMG/M
3300032013|Ga0310906_10582547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium769Open in IMG/M
3300032075|Ga0310890_10157841All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1509Open in IMG/M
3300033412|Ga0310810_10070701All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4217Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil30.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere4.10%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.64%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.64%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.64%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.82%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005288Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300019876Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300023265Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L079-202R-5EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_027560102199352025SoilVIIIAICLSSFLQTIPHIIQYIASKFINISQYGEELEPAELRSVKIRFSNSLIGLILSVVLLITSKNIASFFGKEEPSYEIG
Ga0062589_10270994823300004156SoilPDIIQYMASKFISVDPYGADPEPAEWRAAKIKFWNSLTGFIISVILLIISKNIASFFGKEEPSFEIGGEKIESNL*
Ga0062590_10256600813300004157SoilALFFAFYTITFFLLARNIRPLATFICRDNEEFFELKLNKVAVLHVIIIAICFTSFLQTIPDIIQYMASKFISVDPYGADPEPAEWRAAKIKFWNSLTGFIISVILLIISKNIASFFGKEEPSFEIGGEKIESNL*
Ga0062590_10271981313300004157SoilNLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKAAVLHVVIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPGELRTIKIRFWNSLIGFMISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0063356_10204127723300004463Arabidopsis Thaliana RhizosphereNVMMAILPTALFFAFYAITFFLLARNIKPLARFICRDNEESLKFKLNKVAVLHVIIIAVCLSSFLQTIPDIIQYMASKFINTDQYGEDFEPAEWRTGKIKFWNSLIGFIVSVVLLVTSRNIASFFGKEEPSYEIGGEKIESNL*
Ga0062591_10098587023300004643SoilIAICLSTFLQTIPEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0066674_1016205813300005166SoilTVLFFAFYTITFFLLARNIKLLARFICRENEELLEFKLNKTAVLHVIIIAICLSAFLQTIPDIIQYMASKFISINQYNEDLEPSEIRTSKIKFWNSLIGFVISILLLIASKNIASFFGKEEPTYEIGGEKIESNL*
Ga0065714_1033714713300005288Miscanthus RhizosphereNKTAILHVIIIAICLSSFLQTLPEIIQYIASKFININQYGEDFEPAEWRTVKIKFWNSLIGFIISIVLLITSKNIASFFGKEEPSYEIGGEKIESNI*
Ga0065714_1042975723300005288Miscanthus RhizospherePEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0065712_1044231613300005290Miscanthus RhizosphereAICLSSFLQTLPEIIQYIASKFININQYGEDFEPAEWRTVKIKFWNSLIGFIISIVLLITSKNIASFFGKEEPSYEIGGEKIESNI*
Ga0065712_1056063913300005290Miscanthus RhizosphereIIIAICLSSFLQTIPDIIQYVANKFINPNQFGEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0065715_1054726923300005293Miscanthus RhizosphereAALHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0070690_10063197423300005330Switchgrass RhizosphereITFFLLARNIKSLARFICRENEELLDFKLTKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFININQYSEDYEPAEWRTNKIRFWNSLIGFILSVALLITSKSIASFFGNDEPSYEIGGEKIESNL*
Ga0070677_1051804923300005333Miscanthus RhizosphereAVLHVIIIAICLSSFLQTIPDIIQYIASKFIDTNQYGGDFEPSELRTSKIRFWNSLIGFIISVVLLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0070666_1056414823300005335Switchgrass RhizospherePTVLFFAFYTIAFFLLAKNIKPLARFICRENEELLEFKLTKVAVLHVIIIAICLSTFLQTIPEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0070692_1075687113300005345Corn, Switchgrass And Miscanthus RhizosphereLLEFKLTKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL*
Ga0070675_10009918653300005354Miscanthus RhizosphereLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLTKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL*
Ga0070675_10148650513300005354Miscanthus RhizosphereMAILPTALFFAFYTITFFLLARNIKSLARFICRDNEESLELKLNKVAVLHVIIIAVCLSSFLQTIPDIIQYIASKFINVDQYGEDFEPAEWRAGKIKFWNSLIGFIISIVLLITSKNIASFLGKEERSYEIGGEKIESNL*
Ga0070671_10126561123300005355Switchgrass RhizosphereCRDDEEFFELKLNKVAVLHVIIIAICFSSFLQTIPDLVQYMASKFISVDPYGADLEPAEWRAAKIKFWNSLTGFIISVILLIISKNIASFFGKEEPSYEIGGEKIESNL*
Ga0070673_10011984113300005364Switchgrass RhizosphereLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLTKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISIALLITSKNISSFFGKEEPSYEIGGEKIESNL*
Ga0070673_10209212213300005364Switchgrass RhizosphereLLARNIKPLAKFICRENKELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0070694_10129897023300005444Corn, Switchgrass And Miscanthus RhizosphereIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0070685_1091181823300005466Switchgrass RhizosphereLMMAILPTVLFFAFYTITFFLLARNIKPLARFICRENEESLELKLNKTAVLHVIIIAICLSSFLQTIPDIIQYVANKFINPNQFGEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0068853_10018698033300005539Corn RhizosphereLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLTKAAVLHVIIIAICLSAFLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISIALLITSKNISSFFGKEEPSYEIGGEKIESNL*
Ga0070672_10014736913300005543Miscanthus RhizosphereLSAFLQTIPEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0068857_10210880913300005577Corn RhizosphereIAVCLSSFLQTIPDIIQYIASKFIKVGQYGEDFERAEWRAGKIKFWNSLIGFIISIVLLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0068852_10182917023300005616Corn RhizosphereRNIKPLARFICRENEELLEFKLNKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFININQYSEDYEPAEWRTNKIRFWNSLIGFILSVALLITSKSIASFFGNDEPSYEIGGEKIESNL*
Ga0068859_10114174533300005617Switchgrass RhizosphereSFLQTIPDIIQYIASKFINVDQYGEDFEPAEWRAGKFKFWNSLIGFIISIVLLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0068864_10126190423300005618Switchgrass RhizosphereICRENEELLEFKLTKAAVLHVIIIAICLSAFLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISIALLITSKNISSFFGKEEPSYEIGGEKIESNL*
Ga0068851_1067617823300005834Corn RhizosphereILPTVLFFAFYTITFFLLARNIKPLARFICRENEELLEFKLNKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFININQYSEDYEPAEWRTNKIRFWNSLIGFILSVALLITSKSIASFFGNDEPSYEIGGEKIESNL*
Ga0068863_10216909623300005841Switchgrass RhizosphereLMMAILPTVLFFAFYTIAFFLLAKNIKPLARFICRENEELLEFKLTKVAVLHVIIIAICLSTFLQTIPEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0068871_10073405133300006358Miscanthus RhizosphereLQTIPEIIQYIASKFISTNQPDENFEPSEWRTSKIRFWNSMIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0068871_10200709023300006358Miscanthus RhizosphereTVLFFAFYTIAFFLLAKNIKPLARFICRENEELLEFKLTKVAVLHVIIIAICLSTFLQTIPEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0079218_1107179713300007004Agricultural SoilLNKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFISINQYDEDFEPAEWRTNKIRFFNSLIGFIISVALLITSKNIAAFFGKDEPSYEIGSEKIESNL*
Ga0111539_1024265143300009094Populus RhizosphereVFFLLARNIKAIARFFCRDKDEALEFNLNKVAVLHVIIIAVCLSSFLQTMPDIIQVIAGKFINTDQYREDLEPAEWRADKIKFWNSLIGFLISVILLITSKNIASFFGKEDPSYEIGGEKIESNL*
Ga0075418_1004210713300009100Populus RhizosphereIIIVVCLTSFLQTIPDIIQYIASKFIKADQYGEDFEPAEWRAGKIKFWTSLIGLIISVVLLITSKNIASFFGKEEPSYEIGGEKIETNL*
Ga0105247_1057396423300009101Switchgrass RhizosphereFFLLAKNIKPLARFICRENEELLEFKLTKVAVLHVIIIAICLSTFLQTIPEIIQYIASKFININQYDEDYEPAEWRTNKIRFWNSLIGFIISVALLITSKSIASFFGKEEPSYEIGGEKIESNL*
Ga0111538_1034814513300009156Populus RhizosphereIKAIARFFCRDKDEALEFNLNKVAVLHVIIIAVCLSSFLQTMPDIIQVIAGKFINTDQYREDLEPAEWRADKIKFWNSLIGFLISVILLITSKNIASFFGKEDPSYEIGGEKIESNL*
Ga0105242_1120068323300009176Miscanthus RhizosphereSLELKLNKTAVLHVIIIAICLSSFLQTIPDIIQYVANKFINPNQFSEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEETSYEIGGEKIESNL*
Ga0134066_1028312123300010364Grasslands SoilENEELLEFKLNKTAVLHVIIIAISLSAFLQTIPDIIQYMASKFISINQYNEDLEPSEIRTSKIKFWNSLIGFVISILLLIASKNIASFFGKEEPTYEIGGEKIESNL*
Ga0134124_1164111823300010397Terrestrial SoilLFFAFYTITFFLLARNIKPLARFICRENDELLEFKLNKTAVLHVIIIAICLSSFLQTIPDIIQYVANKFINPNQFGEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEETSYEIGGEKIESNL*
Ga0134122_1024389333300010400Terrestrial SoilFAFYTITFFFLARNIKPLARFICRDNEGFLELKLTKPSILHVIIVAVCLISFLQTIPDIIQYLLNKFINVDQNSNEIERMEWRTRKVGFWNSLIGFIISVLLLIASRKIASFFGKEDESFEIGDEKIESNL*
Ga0137426_116905013300011435SoilNIKPLARFICREKEELLEFKLNKAAVLHVIIIAICLSSFLQTMPEIIQYIASKFININQYGEDFEPAEWRTNKIRFFNSLIGFIISVALLITSKNIAAFFGKDEPSYEIGGEKIESNL*
Ga0157304_109414113300012882SoilTITFFLLARNIKLLAKFICRENEELLEFKLNKTAVLHVIIIGICLSYLLQTIPDIIQYIAGKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISIALLITSKNISSFFGKEEPSYEIGGEKIESNL*
Ga0157287_100558533300012885SoilARNIKPLAKFICHENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0157294_1007441713300012892SoilGNLMMAILPTALFFAFYTITFFLLARNIKPLARFICRGNEESLEFKLTKVAVLHVIIIAICLSTFLQTIPDIMQYIASKFIDTNQYSGDFEPSELRTGKIRFWNSLIGFIISVVLLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0157284_1010235013300012893SoilVLHVIIIAICLSTFLQTIPDIMQYIASKFIDTNQYSGDFEPSELRTGKIRFWNSLIGFIISVVLLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0157309_1015859313300012895SoilLLEFKLNKAAVLHVIIIAICLSSLLQTIPEIIQYITGKFINITQYGEDFEPTELRTSKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0157303_1013585223300012896SoilLPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKAAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157293_1006900533300012898SoilCLSSLLQTIPEIIQYITGKFINITQYGEDFEPTELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157293_1015262113300012898SoilIPDIIQYMASKFISVDPYGADLEPAEWSAAKIQFWNSLTGFIISVILLIISKNIASFFGKEEPSFEIGGEKIESIL*
Ga0157299_1025979523300012899SoilDLKLTKVAVLHVIIIAICLSSFLQTIPDILHYIASKLMNVDRYAEGLEPAELRSDKIIFWNSVIGFIISVVLLITSKNIASFFGKEEPSYEIGGEKIESNI*
Ga0157288_1040252323300012901SoilKTAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPTELRTSKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL*
Ga0157291_1027756423300012902SoilLSSLLQTIPEIIQYMAGKFINITQYGEDFEPAELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157289_1033403323300012903SoilLLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEDFEPAELRSGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157282_1001109113300012904SoilTILFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKAAVLHVIIIGICLSSLLQTIPEIIQYIASKFINITQYGEEFESTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157295_1036465023300012906SoilAVLHVIIIAICLSSLLQTIPEIIQYMAGKFINITQYGEDFEPAELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157283_1032492823300012907SoilMMAILPTVLFFAFYTITFFLLARNIRPLAKFICRENEELLEFKLNKAAALHVIIIAICLSSLLQTIPEIIQYITGKFINITPYGEDFEPTELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157286_1005571213300012908SoilRENEELLEFKLNKAAVLHVIIIAICLSSLLQTIPEIIQYTAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157290_1015211513300012909SoilLFFAFYTITFFNIRPLATFICRDNEEFFELKLNKVAVLHVIIIAICFTSFLQTIPDIIQYMASKFISVDPYGADLEPAEWRAAKIKFWNSLTGFIISVILLIISKNIASFFGKEEPSFEIGGEKIESNL*
Ga0157308_1010046413300012910SoilGNLMMAILPTALFFAFYTITFFLLARNIKPLARFICRGNEESLEFKLTKVAVLHVIIIAICLSTFLQTIPDIMQYIASKFIDTNQYGGDFEPSELRTSKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0157298_1036338723300012913SoilLAKFICRENEELLEFKLNKTAVLHVIIIGICLSYLLQTIPDIIQYIAGKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157302_1024007623300012915SoilFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157310_1052377923300012916SoilFAFYTITFFLLARNIKPLARFICRGNEESLEFKLTKVAVLHVIIIAICLSTFLQTLPDIMQYIASKFIDTNQYSGDFEPSELRTGKIRFWNSLIGFIISVVLLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0164309_1065932323300012984SoilKPLARFICRENDDLLEFKLTKVAVLHVIIIAICLSSFLQTIPDIIQYVASKFININQYGEDLEPAELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEESSYEIGGEKIESNL*
Ga0157375_1098769323300013308Miscanthus RhizosphereLLEFKLNKTAVLHVIIIAICLSSFLQTIPDIIQYVANKFINPNQFSEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEETSYEIGGEKIESNL*
Ga0157380_1145412013300014326Switchgrass RhizosphereRNIKPLAKFICRENEELLEFKLNKTSVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPGELRTIKIRFWNSLIGFMISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157380_1148600113300014326Switchgrass RhizosphereICRENEELLEFKLNKTAVLHVIIIAICLSSFLQTIPEIIQYIASKFISTNQPDENFEPSEWRTSKIRFWNSMIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0157380_1206163223300014326Switchgrass RhizosphereLEFKLNKTAVLHVIIIAICLSSLLQTIPDIIQYIAGKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0157376_1026760413300014969Miscanthus RhizosphereTGIGGNLMMAILPTVLFFAFYTITFFLLARNIKPLARFICRENEELLEFKLNKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFININQYSEDYEPAEWRTNKIRFWNSLIGFILSVALLITSKSIASFFGNDEPSYEIGGEKIESNL*
Ga0173483_1041375323300015077SoilGIGGNLMMAILPTILFFSFYTITFFLLARNIKPLAKFICRENEGLLEFKLNKTAVLHVIIIAICLSSFLQTIPEIIQYIASKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL*
Ga0173483_1074889323300015077SoilPLAKFICRENEELLEFKLNKTSVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDDPSYEIGGEKIESNL*
Ga0173480_1123005513300015200SoilTGIGGNIMMAILPTILFFAFYTITFFLLARNIKLLAKFICRENEELLEFKLNKTAVLHVIIIGICLSYLLQTIPDIIQYIAGKFITITQYGEEFEPTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0173478_1023829523300015201SoilEELLEFKLNKAAVLHVIIIAICFSSFLQTIPEIIQYVTSKFITTTQYGEDYEPAEWRTSKIRFWNSMIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0173478_1083030813300015201SoilLPTILFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIGICLSYLLQTIPDIIQYIAGKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL*
Ga0132256_10165774923300015372Arabidopsis RhizosphereMMAILPTALLFAFYTITFFLLARNIKPLARFICRDNEEFLEFKLNKVAMLHVIIIAICLSSFLQTIPDVIQYIASKFIGINQYGEDIEPAEWRAGKIRFWNSLIGFIMSLALLITSKSIASFFGNEEPSYEIGGEKIESNL*
Ga0132257_10246081323300015373Arabidopsis RhizosphereFLTARNIKPLARFICRDNEEFLEFKLNKVAVLHVIIIAICLSAFLQTIPDTIQYIASKFIDTNQYGGDFEPSELRASKIKFWNSLIGLIISVVLLVTSKNIASFFGKEEPSYEIGGEKIESNL*
Ga0163161_1196532423300017792Switchgrass RhizosphereFLLARNIKPLAKFICRENEELLEFKLTKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGEDYEPAELRTGKIRFWNSLIGFIISTLLLITSKNIASFFGKEEPSYEIGGEKIERNL
Ga0184611_127031123300018067Groundwater SedimentVAGNLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLTKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL
Ga0184635_1004664613300018072Groundwater SedimentTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0184624_1020193913300018073Groundwater SedimentTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0184625_1005660713300018081Groundwater SedimentVLFFAFYTITFFLLARNIKPLAIFICRENEELLEFKLNKATVLHVIIIAICLSSFLQTIPEIIQYLASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL
Ga0184625_1047966013300018081Groundwater SedimentAAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPGELRTIKIRFWNSLIGFMISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0184628_1035222813300018083Groundwater SedimentILFFAFYTITFFLLARNIKPLAKFICRENEDLLEFKLNKAAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEDFEPGELRTIKIRFWNSLIGFMISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0190274_1013360743300018476SoilCRENEELLEFKLNKTAILHVIIIAICLSSFLQTLPEIIQYIASKFININQYGEDFEPAEWRTVKIKFWNSLIGFIISIVLLITSKNIASFFGKEEPSYEIGGEKIESNI
Ga0190271_1082492133300018481SoilGISGNLMMAILPTVLFFAFYTITFFLLARNIKPLARFICREKEELLEFKLNKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFISINQYDEDFEPAEWRTNKIRFFNSLIGFIISVALLITSKNIAAFFGKDEPSYEIGSEKIESNL
Ga0173479_1007586033300019362SoilMAILPTVLFFAFYTIAFFLLAKNIKPLARFICRENEELLEFKLTKVAVLHVIIIAICLSAFLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL
Ga0173479_1018950113300019362SoilNEELLEFKLNKTAVLHVIIIAICLSSFLQTIPEIIQYIASKFISTNQPDENFEPSEWRTSKIRFWNSMIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0173479_1023286613300019362SoilNLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYITGKFINITPYGEDFEPTELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0173479_1042645023300019362SoilFFLLARNIKPLARFICRGSEESLEFKLNKVAVLHVIIIAICFTSFLQTIPDIIQYMASKFISVDPYGADPEPAEWRAAKIKFWNSLTGFIISVILLIISKNIASFFGKEEPSFEIGGEKIESNL
Ga0193702_101335933300019871SoilMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIAFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0193703_106811523300019876SoilTITFFLLARNIKSLARFICRENEELLELKLSKAAVLHVIIIAICLSAFLQTIPEIIQYIASKFMNINQYSEDYEPAELRTGKIRFWNSLIGFIISTLLLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0193697_101071613300020005SoilAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISIALLITSKNISSFFGKEEPSYEIGGEKIESNL
Ga0222621_106147123300021510Groundwater SedimentEELLELKLSKAAVLHVIIIAICLSAFLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL
Ga0247745_108077913300022898SoilAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISIALLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0247788_105111013300022901SoilAFYTITFFLLARNIRPLATFICRDNEEFFELKLNKVAVLHVIIIAICFTSFLQTIPDIIQYITSKFVNIDQNGEDFEPTEWRGSKIKFWNSLIGLIISVALLIMSKNIASFFGKEEPSYEIGGEKIESNL
Ga0247790_1004070313300022915SoilPTILFFSFYTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEEFESTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDDPSYEIGGEKIESNL
Ga0247801_103654213300023064SoilAGNLMMAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLSKTAVLHVIIIAICLSSFLQTIPEIIQYLASKFININQPDENFEPTEWRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL
Ga0247802_100504013300023077SoilYTITFFLLARNIKPLAKFICRENEELLEFKLTKAAVLHVIIIAICLSAFLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISIALLITSKNISSFFGKEEPSYEIGGEKIESNL
Ga0247756_104431523300023078Plant LitterAILPTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPGELRTIKIRFWNSLIGFMISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0247798_102998113300023260SoilIGGNLMMAILPTILFFSFYTITFFLLARNIKPLAKFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0247796_111821913300023261SoilFFLLARNIKPLARFICRENEELLEFKLNKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0247780_106931933300023265Plant LitterFLQTIPEIIQYIASKFISTNQPDENFEPSERRTSKIRFWNSMIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0247789_110843113300023266SoilLMMAILPTILFFSFYTITFFLLARNIKPLAKFICRENEGLLEFKLNKTAVLHVIIIAICLSSFLQTIPEIIQYIASKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0207685_1054667713300025905Corn, Switchgrass And Miscanthus RhizosphereIKPLARFICRENDELLEFKLTKVAVLQVIIIAICLSSFLQTIPEIIQYIASKFINITQYGEDYEPAELRTGKIRFWNALIGFIISTLLLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0207644_1066941913300025931Switchgrass RhizosphereILPTALFFAFYTITFFLLARNIRPLARFICRDDEEFFELKLNKVAVLHVIIIAICLSSLLQTIPEIIQYIAGKFINITQYGEDFEPAELRTSKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0207658_1140619523300025986Switchgrass RhizosphereFFAFYTITFFLLARNIKPLARFICRENDELLEFKLNKTAVLHVIIIAICLSSFLQTIPEIIQYIASKFINIHQYGEDYEPAELRTGKIRFWNSLIGFIISIALLITSKSIATFFGKEEPSYEIGGEKIESNL
Ga0207678_1167634723300026067Corn RhizosphereTVLFFAFYTITFFLLARNIKPLAKFICRENEELLEFKLTKTAVLHVIIIAICLSSLLQTIPEIIQYIASKFININQYGDDFEPSELRTGKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSFEIGGEKIESNL
Ga0207698_1051044433300026142Corn RhizosphereIMAILPTVLFFAFYTITFFLLARNIKPLARFICRENEESLELKLNKTAVLHVIIIAICLSSFLQTIPDIIQYTANKFINPNQFGEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0209155_112476033300026316SoilFYTITFFLLARNIKLLARFICRENEELLEFKLNKTAVLHVIIIAICLSAFLQTIPDIIQYMASKFISINQYNEDLEPSEIRTSKIKFWNSLIGFVISILLLIASKNIASFFGKEEPTYEIGGEKIESNL
Ga0310888_1010927413300031538SoilTGIGRNVMMAILPTALFFAFYAITFFLLARNIKPLARFICRDNEESLEFKLNKVAVLHVIIIAVCLSSFLQTIPDIIQYIASKLINTDVYGEDFERAEWRTGKIKFWNSLIGFIMSVVLLITSRNIASFFGKEEPSYEIGGEKIESNL
Ga0310887_1046643413300031547SoilIIIAICLSSFLQTIPEIIQYIASKFININQYGDDLEPSELRTGKIRFWNSLIGFIISGALLITSKNIASFFGKDEPSYEIGGEKIESNL
Ga0310887_1049855613300031547SoilHVIIIAVCLSSFLQTIPDIIQYIASKFINTDQYGGDFEPAEWRTGKIKFWNSLIGFIMSVVLLITSGNIASFFGKEEPSYEIGGEKIESNL
Ga0310904_1116859413300031854SoilNIKPLAKFICRENEELLEFKLNKTAVLHVIIIGICLSYLLQTIPDIIQYIAGKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0310904_1130294923300031854SoilVLHVIIIAICLSSFLQTVPDIIQYIASRFFKVDQYGEDFEPAEWRTGKIKFLNSLIGFIITVVLLITSRNMASFFGKEEPSYEIGGEKIESNL
Ga0310893_1045304823300031892SoilRENEELMDFKLTKAAVLHVIIIAICLSSFLQTIPEIIQYIASKFININQYGDDLEPSELRTGKIRFWNSLIGFIISGVLLITSKNIASFFGKDEPSYEIGGEKIESNL
Ga0310900_1187997123300031908SoilYLLQTIPDIIQYIAGKFINITQYGEEFEPTELRTGKIRFWNSLIGFIISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0310884_1043971033300031944SoilQTIPEIIQYIAGKFINITQYGEDFEPGELRTIKIRFWNSLIGFMISILLLITSKSIASFFGKDEPSYEIGGEKIESNL
Ga0310902_1011741613300032012SoilRGNEESLEFKLNKVAVLHVIIIAVCLSSFLQTIPDIIQYTASKFINFDQYGENFEPAEWRAGKIKFWNSLIGFIISIVLLITSKNIASFFGKEEPSYEIGGEKIESNL
Ga0310906_1058254723300032013SoilLHVIIIAICLSSFLQTIPEIMQYIAGKFVSINKYGEDFEPAEWRTNKIRFWNSLIGFIISVSLLITAKNIASFFGKDEPSYEIGGEKIESNL
Ga0310890_1015784133300032075SoilGNEESLEFKLNKVAVLHVIIIAVCLSSFLQTIPDIIQYIASKLINTDVYGEDFERAEWRTGKIKFWNSLIGFIMSVVLLITSRNIASFFGKEEPSYEIGGEKIESNL
Ga0310810_1007070113300033412SoilRNIKPLARFICRENEESLELKLNKTAVLHVIIIAICLSSFLQTIPDIIQYVANKFINPNQFGEDLEPAEWRTNKIRFWNSLIGFIISVALLITSKNIASFFGKEEPSYEIGGEKIESNL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.