NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071261

Metagenome / Metatranscriptome Family F071261

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071261
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 44 residues
Representative Sequence DGQRRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Number of Associated Samples 117
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 22.69 %
% of genes near scaffold ends (potentially truncated) 78.69 %
% of genes from short scaffolds (< 2000 bps) 93.44 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.344 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(14.754 % of family members)
Environment Ontology (ENVO) Unclassified
(29.508 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(37.705 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00550PP-binding 63.11
PF00109ketoacyl-synt 18.85
PF13561adh_short_C2 13.11
PF00106adh_short 2.46
PF02801Ketoacyl-synt_C 1.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.34 %
UnclassifiedrootN/A10.66 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918007|ConsensusfromContig175594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium609Open in IMG/M
2166559005|cont_contig23118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1181Open in IMG/M
2170459009|GA8DASG01CE774All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
2170459009|GA8DASG01EM0SQAll Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300000545|CNXas_1019304All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300001081|JGI12662J13196_1019203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21565Open in IMG/M
3300001976|JGI24752J21851_1066322All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300001991|JGI24743J22301_10130439All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300002075|JGI24738J21930_10089275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii651Open in IMG/M
3300002128|JGI24036J26619_10117195All Organisms → cellular organisms → Bacteria → Proteobacteria550Open in IMG/M
3300002155|JGI24033J26618_1078079All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300003541|JGI20214J51650_10632784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria750Open in IMG/M
3300003570|Ga0007418J51697_1019450All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300003572|Ga0007424J51698_1030036All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae765Open in IMG/M
3300005172|Ga0066683_10523763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21724Open in IMG/M
3300005356|Ga0070674_100049033All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA00022901Open in IMG/M
3300005366|Ga0070659_100668490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium896Open in IMG/M
3300005367|Ga0070667_102104922All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300005450|Ga0066682_10938065All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300005456|Ga0070678_100074209All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2556Open in IMG/M
3300005548|Ga0070665_100278501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1674Open in IMG/M
3300005548|Ga0070665_102460277Not Available522Open in IMG/M
3300005598|Ga0066706_10693992All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii808Open in IMG/M
3300005718|Ga0068866_10463125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium831Open in IMG/M
3300005718|Ga0068866_11293653Not Available530Open in IMG/M
3300005840|Ga0068870_10506601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium805Open in IMG/M
3300005841|Ga0068863_101775918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.626Open in IMG/M
3300005952|Ga0080026_10198647All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium593Open in IMG/M
3300005994|Ga0066789_10105332All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1210Open in IMG/M
3300006046|Ga0066652_100604410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii1035Open in IMG/M
3300006052|Ga0075029_100407694Not Available884Open in IMG/M
3300006426|Ga0075037_1105804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria551Open in IMG/M
3300006852|Ga0075433_11547059All Organisms → cellular organisms → Bacteria → Proteobacteria572Open in IMG/M
3300006881|Ga0068865_102108678All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300006918|Ga0079216_11825461All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300009101|Ga0105247_11718920All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300009143|Ga0099792_10841740Not Available604Open in IMG/M
3300009552|Ga0116138_1141863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae664Open in IMG/M
3300010079|Ga0127436_153412All Organisms → cellular organisms → Bacteria → Proteobacteria603Open in IMG/M
3300010101|Ga0127481_1050845All Organisms → cellular organisms → Bacteria → Proteobacteria593Open in IMG/M
3300010117|Ga0127449_1103013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium901Open in IMG/M
3300010134|Ga0127484_1138268All Organisms → cellular organisms → Bacteria → Proteobacteria555Open in IMG/M
3300010142|Ga0127483_1129980All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21518Open in IMG/M
3300010333|Ga0134080_10198584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii868Open in IMG/M
3300010854|Ga0126360_1134630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter indolifex → Sulfitobacter indolifex HEL-45605Open in IMG/M
3300010856|Ga0126358_1049076All Organisms → cellular organisms → Bacteria → Proteobacteria702Open in IMG/M
3300010858|Ga0126345_1054269All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300010861|Ga0126349_1041912Not Available796Open in IMG/M
3300010865|Ga0126346_1014345All Organisms → cellular organisms → Bacteria → Proteobacteria720Open in IMG/M
3300010869|Ga0126359_1444469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium716Open in IMG/M
3300011422|Ga0137425_1133157All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300012208|Ga0137376_10668090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium897Open in IMG/M
3300012389|Ga0134040_1192353All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300012392|Ga0134043_1233832All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium851Open in IMG/M
3300012398|Ga0134051_1206916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae621Open in IMG/M
3300012683|Ga0137398_10663347All Organisms → cellular organisms → Bacteria → Proteobacteria724Open in IMG/M
3300012924|Ga0137413_10478294Not Available912Open in IMG/M
3300012927|Ga0137416_11414722Not Available630Open in IMG/M
3300014169|Ga0181531_10467483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae778Open in IMG/M
3300015052|Ga0137411_1117350All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae813Open in IMG/M
3300015077|Ga0173483_10575796All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300015200|Ga0173480_10872747All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae581Open in IMG/M
3300015201|Ga0173478_10186640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium858Open in IMG/M
3300015242|Ga0137412_11017905Not Available592Open in IMG/M
3300018025|Ga0187885_10165727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1038Open in IMG/M
3300018030|Ga0187869_10407434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21648Open in IMG/M
3300018038|Ga0187855_10461488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae740Open in IMG/M
3300018042|Ga0187871_10595693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21613Open in IMG/M
3300019260|Ga0181506_1212238All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21540Open in IMG/M
3300019263|Ga0184647_1034862All Organisms → cellular organisms → Bacteria → Proteobacteria510Open in IMG/M
3300019789|Ga0137408_1351414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium737Open in IMG/M
3300019889|Ga0193743_1013727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4447Open in IMG/M
3300020008|Ga0193757_1031427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21522Open in IMG/M
3300020170|Ga0179594_10225304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium705Open in IMG/M
3300021307|Ga0179585_1079095All Organisms → cellular organisms → Bacteria → Proteobacteria516Open in IMG/M
3300021315|Ga0179958_1004014All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae815Open in IMG/M
3300021478|Ga0210402_11200156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae686Open in IMG/M
3300022506|Ga0242648_1059235All Organisms → cellular organisms → Bacteria → Proteobacteria599Open in IMG/M
3300022523|Ga0242663_1141655All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300022712|Ga0242653_1097333All Organisms → cellular organisms → Bacteria → Proteobacteria535Open in IMG/M
3300022717|Ga0242661_1085358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae642Open in IMG/M
3300022724|Ga0242665_10094204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae878Open in IMG/M
3300023078|Ga0247756_1118813All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300025315|Ga0207697_10528852All Organisms → cellular organisms → Bacteria → Proteobacteria519Open in IMG/M
3300025898|Ga0207692_10972174All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → unclassified Brevundimonas → Brevundimonas sp.560Open in IMG/M
3300025903|Ga0207680_11312939All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300025907|Ga0207645_10076135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2148Open in IMG/M
3300025909|Ga0207705_10608893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium849Open in IMG/M
3300025930|Ga0207701_11583229All Organisms → cellular organisms → Bacteria → Proteobacteria528Open in IMG/M
3300025945|Ga0207679_10341419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1302Open in IMG/M
3300026023|Ga0207677_11918044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Brevundimonas → unclassified Brevundimonas → Brevundimonas sp.550Open in IMG/M
3300027257|Ga0208996_1056251All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21580Open in IMG/M
3300027401|Ga0208637_1042309All Organisms → cellular organisms → Bacteria → Proteobacteria534Open in IMG/M
3300027524|Ga0208998_1047588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae697Open in IMG/M
3300027660|Ga0209736_1111261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium741Open in IMG/M
3300027678|Ga0209011_1099868Not Available845Open in IMG/M
3300027880|Ga0209481_10664773All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300027894|Ga0209068_10944776All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21511Open in IMG/M
3300027898|Ga0209067_10616244All Organisms → cellular organisms → Bacteria → Proteobacteria624Open in IMG/M
3300029923|Ga0311347_10370314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium873Open in IMG/M
3300030056|Ga0302181_10421044All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300030841|Ga0075384_11272334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21562Open in IMG/M
3300030872|Ga0265723_1031810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21513Open in IMG/M
3300030905|Ga0308200_1109536All Organisms → cellular organisms → Bacteria → Proteobacteria598Open in IMG/M
3300030963|Ga0265768_108398All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae641Open in IMG/M
3300030988|Ga0308183_1072471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae737Open in IMG/M
3300030988|Ga0308183_1149690All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300031094|Ga0308199_1157309All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. GJ21546Open in IMG/M
3300031098|Ga0308191_1023392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae628Open in IMG/M
3300031099|Ga0308181_1134695All Organisms → cellular organisms → Bacteria → Proteobacteria566Open in IMG/M
3300031100|Ga0308180_1012320All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium762Open in IMG/M
3300031421|Ga0308194_10295880All Organisms → cellular organisms → Bacteria → Proteobacteria559Open in IMG/M
3300031422|Ga0308186_1041105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Sulfitobacter → Sulfitobacter indolifex → Sulfitobacter indolifex HEL-45503Open in IMG/M
3300031423|Ga0308177_1025938All Organisms → cellular organisms → Bacteria → Proteobacteria543Open in IMG/M
3300031715|Ga0307476_10379785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1042Open in IMG/M
3300031903|Ga0307407_11709801Not Available501Open in IMG/M
3300033434|Ga0316613_10659128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae716Open in IMG/M
3300034384|Ga0372946_0032215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2331Open in IMG/M
3300034644|Ga0370548_006222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1489Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil14.75%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil7.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.56%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil4.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.10%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.10%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.10%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.10%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.28%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.28%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.46%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil2.46%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil2.46%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.64%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.82%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.82%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.82%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.82%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.82%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.82%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.82%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.82%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
2170459009Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300000545Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300001081Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3EnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300001991Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2Host-AssociatedOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300002155Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7Host-AssociatedOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003570Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_34 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300003572Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_40 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005644Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_053 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006426Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_054 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009552Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150EnvironmentalOpen in IMG/M
3300010079Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010101Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010117Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010142Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010854Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010856Boreal forest soil eukaryotic communities from Alaska, USA - W4-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010869Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300020008Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021307Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021315Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_2_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022506Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022724Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023078Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L066-202C-4EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027257Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027660Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030963Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031094Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031100Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031422Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031423Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_148 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A_all_C_019503802140918007SoilMITEPSTERQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV
cont_0118.000020402166559005SimulatedGSMITEPPTDGQRRPLQDIETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
F47_114187102170459009Grass SoilMGKQGHCEDIETLYIGVATPAVRRAFVGYHRAESRLCAITKEV
F47_013097202170459009Grass SoilRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV
F47_025519802170459009Grass SoilAEACSQDLGSMITEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV
CNXas_101930423300000545Quercus RhizosphereITERPTDGQRRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV*
JGI12662J13196_101920313300001081Forest SoilYSQGLGSMITEPPTDGQRTPLQDFETLYIGEAEPAVVRRAFVGYDGAKSRLCAIAKEV*
JGI24752J21851_106632223300001976Corn, Switchgrass And Miscanthus RhizosphereMVTEPPTDGQRRPLQDIETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
JGI24743J22301_1013043923300001991Corn, Switchgrass And Miscanthus RhizospherePTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
JGI24738J21930_1008927513300002075Corn RhizosphereLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
JGI24036J26619_1011719523300002128Corn, Switchgrass And Miscanthus RhizosphereGSMITEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV*
JGI24033J26618_107807913300002155Corn, Switchgrass And Miscanthus RhizospherePLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
JGI20214J51650_1063278413300003541WetlandMITEPSADGQRTPLQDIETLYIGGAEPAVVRRVRVGHDGAKSRLCAIAKKINDH
Ga0007418J51697_101945013300003570Avena Fatua RhizosphereQTRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV*
Ga0007424J51698_103003613300003572Avena Fatua RhizosphereQRRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0066683_1052376323300005172SoilMITEPPTDGAKNALRDFETLYIGGAELAVVRRALVGYDGAKSRLCAIARKI*
Ga0070674_10004903343300005356Miscanthus RhizosphereDGWANKAMQDFETLYIGVATPVVRRAFVGYHRAESRLCAIAKEV*
Ga0070659_10066849033300005366Corn RhizosphereTEPPTDGQTRPLQDFETLYIGVATPAVRRAFIGYHRAESRLCAIAKEV*
Ga0070667_10210492213300005367Switchgrass RhizosphereTEPPTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0066682_1093806523300005450SoilTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0070678_10007420943300005456Miscanthus RhizosphereMITEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAK
Ga0070665_10027850133300005548Switchgrass RhizosphereRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV*
Ga0070665_10246027713300005548Switchgrass RhizosphereMITGRPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0066695_1072445913300005553SoilAYSQGLGSMITEPPTDGQRTPLQDFETVYIGEVEPAVVRRAFVGCHGAKSRLCAIAKEV*
Ga0066706_1069399223300005598SoilMVTEPPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV*
Ga0075036_103013013300005644Permafrost SoilFETLYIGGAEPAVVRRALSAVSWQNHDFAKSRLC*
Ga0068866_1046312513300005718Miscanthus RhizosphereEPPTDGQTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0068866_1129365323300005718Miscanthus RhizosphereMITEPRTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKE
Ga0068870_1050660133300005840Miscanthus RhizosphereFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0068863_10177591833300005841Switchgrass RhizosphereRTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV*
Ga0080026_1019864733300005952Permafrost SoilETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKKV*
Ga0066789_1010533223300005994SoilLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV*
Ga0066652_10060441033300006046SoilRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV*
Ga0075029_10040769413300006052WatershedsMITEPSADGQRTPLQDIETLYIGGAEPAVVRWVHVGHDGANSRRCAIAKEI*
Ga0075037_110580413300006426Permafrost SoilQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV*
Ga0075433_1154705923300006852Populus RhizosphereRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0068865_10210867813300006881Miscanthus RhizosphereTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV*
Ga0079216_1182546113300006918Agricultural SoilMITEPPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV*
Ga0105247_1171892023300009101Switchgrass RhizosphereRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCATAKEV*
Ga0099792_1084174023300009143Vadose Zone SoilMITEPSTERQRTPLQDFETLYIGGGEPARVRRAFVGYDGAKSRLRAIAKEV*
Ga0116138_114186323300009552PeatlandMITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV*
Ga0127436_15341213300010079Grasslands SoilQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0127481_105084523300010101Grasslands SoilQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV*
Ga0127449_110301333300010117Grasslands SoilPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0127484_113826813300010134Grasslands SoilTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0127483_112998013300010142Grasslands SoilRDFETLYIGGAAPAVVRRALVGYDGAKSRLCAIARKV*
Ga0134080_1019858433300010333Grasslands SoilEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0126360_113463013300010854Boreal Forest SoilYSQGLGSMITEPSTERQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV*
Ga0126358_104907613300010856Boreal Forest SoilRTPLQDFETLYIGGAEPARVRWAFVGYDGAKSRLCAIAKEV*
Ga0126345_105426923300010858Boreal Forest SoilQRTPLQEIETLYIGGAEPAVVRRARLGYGGAKSRLSAIAKEV*
Ga0126349_104191213300010861Boreal Forest SoilQRNALQDVETLYIGVATPAVRRGLIGTDRAESRLCAIELN*
Ga0126346_101434513300010865Boreal Forest SoilQRRPLQDFETLYIGVASPAVRRGFVGYHRAESRLCAIAKEV*
Ga0126359_144446913300010869Boreal Forest SoilERQRTPLQDFETLYIGGAEPARVRRAFVGYDGAKSRLCAIAKEV*
Ga0137425_113315713300011422SoilTDGQRRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0137376_1066809013300012208Vadose Zone SoilRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV*
Ga0134040_119235323300012389Grasslands SoilDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0134043_123383213300012392Grasslands SoilTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0134051_120691613300012398Grasslands SoilKNALRDFETLYIGGAELAVVRRALVGYDGAKSRLCAIARKV*
Ga0137398_1066334723300012683Vadose Zone SoilMITEPPTDGQRRPLQDFETLYIGVATPAVRRAFIGYHRAESSLCAIAKEV*
Ga0137413_1047829413300012924Vadose Zone SoilMGKRRPLQDFETLYIGVATPAVRRAFIGYHRAESSLCAIAKEV*
Ga0137416_1141472223300012927Vadose Zone SoilMITEPPTDGQRTPLQDFETLYIGEAEPAVVRRAFVGYDGAKSRLCAIAKEV*
Ga0181531_1046748313300014169BogEPSADGQRTPLQDIETLYIGDAEPAVVRRVRVGHHVAKSRLCAIAKEV*
Ga0137411_111735013300015052Vadose Zone SoilLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV*
Ga0173483_1057579613300015077SoilPPTDGQTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV*
Ga0173480_1087274723300015200SoilMITEPATDGQRTPLQDFETLYIGETEPAVVRRAFVGYDGAKSRLCAIAKEV*
Ga0173478_1018664023300015201SoilMVTEPATDGQRTPLQDFETLYIGETEPAVVRRAFVGYDGAKSRLCAIAKEV*
Ga0137412_1101790513300015242Vadose Zone SoilMITEPPTDGQRTPLQDIETLYIGGAEPAVVRRVRVGHDGAKSRLCAIAKEIH
Ga0187885_1016572733300018025PeatlandMITEPPADGQRTPLQDIETLYIGDAEPAVVRQVRVGHDVAKSRLCAIAKEV
Ga0187869_1040743413300018030PeatlandMITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVSHDVAKSRLCAIAKEV
Ga0187855_1046148823300018038PeatlandMITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV
Ga0187871_1059569323300018042PeatlandQGLGSMITEPPADGQRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV
Ga0181506_121223823300019260PeatlandTPLQDFETLYIGGAEPAVVRQVRVGHDGAKSRLCAIAKEV
Ga0184647_103486223300019263Groundwater SedimentGQTRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV
Ga0137408_135141433300019789Vadose Zone SoilTEPPTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV
Ga0193743_101372753300019889SoilMDGQRTPLQDFETLYIGEVEPAVVRRAFVGHVLVGYVLQNQDLAKSRLCAIAKEV
Ga0193757_103142723300020008SoilLGSMITEPLTDKQRTPLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV
Ga0179594_1022530433300020170Vadose Zone SoilPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0179585_107909513300021307Vadose Zone SoilQRTPLQDFETLYIGEVEPAVVRRASVGCHGAKSRLCAIAKEV
Ga0179958_100401413300021315Vadose Zone SoilITEPPRDGQRTPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0210402_1120015613300021478SoilGQRNALQDVETLYIGVATPAVRRGLIGTDRAESRLCAIELN
Ga0242648_105923523300022506SoilTPLQDIETLYIGDAEHAVVRRVRVGRDGTKSRLCAIAKEV
Ga0242663_114165523300022523SoilQRTPLQDIETLYIGDAEHAVVRRVRVGRDGTKSRLCAIAKEV
Ga0242653_109733323300022712SoilLQDIETLYIGDAEPTVVRRVRLGHDGAKSRLCAIAKEV
Ga0242661_108535813300022717SoilALQDFETLYIGVAEPAVVRWALVGDDGAKSRLCAIAKEV
Ga0242665_1009420433300022724SoilTPLQDVETLYIGGAEPAVVRWVRVGHDGAKSRLCAIAKEI
Ga0247756_111881323300023078Plant LitterEPSTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV
Ga0207697_1052885223300025315Corn, Switchgrass And Miscanthus RhizosphereGLGSMITEPATDGQRTPLQDFETLYIGETEPAVVRRAFVGYDGAKSRLCAIAKEV
Ga0207692_1097217423300025898Corn, Switchgrass And Miscanthus RhizosphereMGQRTPLQDIETLYIGGAEPAVVRRVRVGHDGAKSRLCAIAKE
Ga0207680_1131293913300025903Switchgrass RhizosphereEPPTDGQTRPLQEFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0207645_1007613513300025907Miscanthus RhizosphereQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0207705_1060889313300025909Corn RhizosphereTDGQRRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0207701_1158322913300025930Corn, Switchgrass And Miscanthus RhizosphereTDGQRRPLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKEV
Ga0207679_1034141913300025945Corn RhizosphereDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0207677_1191804413300026023Miscanthus RhizosphereLQDFETLYIGVVTPAVRRAFVGYHRAESRLCAIAKE
Ga0208996_105625123300027257Forest SoilPATDGQRTPLQDFETLYIGGAEPAVVRWAFVGYDGAKSRLCAIAKEV
Ga0208637_104230913300027401SoilPTDGQTRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0208998_104758813300027524Forest SoilYSQGMGSMITEPATDGQRTPLQDFETLYIGGAEPAVVRRAFVGYDGAKSRLCAIAKEV
Ga0209736_111126133300027660Forest SoilDFESLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0209011_109986813300027678Forest SoilMITEPPTDGQRTPLQDFETLYIGEAEPAVVRRAFVGYDGAKSRLCAI
Ga0209481_1066477313300027880Populus RhizosphereRPLQDFETLYIGVATPAVRRGFVGYHRAESRLCAIAKEV
Ga0209068_1094477623300027894WatershedsFETLYIGGAEPARRSPGPFVGYDGAKSRLCAIAKRV
Ga0209067_1061624413300027898WatershedsMITEPSADGQRTPLQDIETLYIGGAEPAVVRWVHVGHDGANSRRCAIAKEI
Ga0311347_1037031413300029923FenEFETLYIGVAASAVRRGFVGYHWAESRLCAIAKEV
Ga0302181_1042104423300030056PalsaDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV
Ga0075384_1127233413300030841SoilQRRPLQDFETLYIGVATPAVRRAFIGYLRAESSLCAIAKEV
Ga0265723_103181013300030872SoilLQEFETLYIGVATSAVRRAFVGYHRAESRLCAIAKEV
Ga0308200_110953613300030905SoilQTRPLQDFETLYIGVAAPAVRRAFVGYHRAESRLCAIAKEV
Ga0265768_10839813300030963SoilRTPLQDIETLYIGDAEPAVVRRVRVGHDVAKSRLCAIAKEV
Ga0308183_107247133300030988SoilRQRTPLQDFETLYIGGAEPAVVRWAFAGNGEAKSRQCATANRD
Ga0308183_114969023300030988SoilMVTEPATDGQRTPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0308199_115730913300031094SoilRTPLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV
Ga0308191_102339213300031098SoilQRTPLQEFETLYIGGAEPARRSLGPFVGYDGAKSRLCAIAKRV
Ga0308181_113469513300031099SoilTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0308180_101232033300031100SoilRPLQDFESLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0308194_1029588023300031421SoilDGQRRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0308186_104110513300031422SoilRTPLQDFETLYIGHAEPARVRRAFVGYDGAKSRLCAIAKRV
Ga0308177_102593823300031423SoilQTRPLQDFETLYIGVATPAVRRGFVGYQRAESRLCAIAKEV
Ga0307476_1037978533300031715Hardwood Forest SoilLQDIETLYIGDAEPAVVRRVHVGRDGAKSRLCAIAKEV
Ga0307407_1170980123300031903RhizosphereMITERPTDGQTRPLQDFETLYIGVATPAVRRAFVGYHRAESRLCAIAKEV
Ga0316613_1065912833300033434SoilFETLYIGGAEPAVVRRAFVGDDGAKSRLCVIAKEV
Ga0372946_0032215_1725_18803300034384SoilMITEPATDGQRTPLQDFETLYIGGAEPAVVRRASIGYDGAKSRLCATAKEV
Ga0370548_006222_684_8423300034644SoilMITEPLTDKQRTPLQEFETLYIGGAEPARRSPWPFVGYDGAKSRLCAIAKRV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.