Basic Information | |
---|---|
Family ID | F071247 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 43 residues |
Representative Sequence | MGSNNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 86.78 % |
% of genes near scaffold ends (potentially truncated) | 23.77 % |
% of genes from short scaffolds (< 2000 bps) | 54.10 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (85.246 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.672 % of family members) |
Environment Ontology (ENVO) | Unclassified (65.574 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.410 % of family members) |
⦗Top⦘ |
Full Alignment |
---|
Alignment of all the sequences in the family. |
IDLabel .2.4.6.8.10.12.14.16.18.20.22.24.26.28.30.32.34.36.38.40.42.44.46.48.50.52.54.56.58.60.62 |
Powered by MSAViewer |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.17% Coil/Unstructured: 71.83% |
Feature Viewer | |||||
Position : 0 Zoom : x 1 Enter the variants Position Original Variant |
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
⦗Top⦘ |
Visualization |
---|
All Organisms Unclassified |
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Visualization |
---|
Freshwater Freshwater Freshwater Lake Freshwater Lentic Freshwater Freshwater, Plankton Anoxic Zone Freshwater Freshwater Lake Freshwater Freshwater Freshwater Freshwater Pond Fresh Water Freshwater To Marine Saline Gradient Estuarine Estuarine Estuarine Water |
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Geographical Distribution | |
---|---|
|
|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
2199954116 | 2199352004 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYKVKKDK |
B570J14230_100067335 | 3300001282 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYKVKKDK* |
B570J29592_1008204 | 3300002277 | Freshwater | MGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKSNKKRIKNV* |
B570J29032_1099435124 | 3300002408 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKTKRDK* |
B570J40625_1000419634 | 3300002835 | Freshwater | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK* |
B570J40625_1001028337 | 3300002835 | Freshwater | MGSSNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK* |
B570J40625_1010505082 | 3300002835 | Freshwater | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK* |
JGI25908J49247_100153722 | 3300003277 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ* |
JGI25908J49247_100453303 | 3300003277 | Freshwater Lake | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ* |
JGI25908J49247_101014733 | 3300003277 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK* |
JGI25910J50241_1000129514 | 3300003388 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQGSQA* |
JGI25910J50241_101305811 | 3300003388 | Freshwater Lake | NKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK* |
JGI25909J50240_10038216 | 3300003393 | Freshwater Lake | MGSNNKIPFNQTVIKNGRXVRVRKDGSVKADLGPYKTEQTKAKQ* |
JGI25911J50253_100094638 | 3300003411 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQ |
JGI25921J50272_100090444 | 3300003430 | Freshwater Lake | MGSNNKIPFNKTIIRDGRIVRIRKDGAIKADLGPYKAKPAKAK* |
Ga0068876_100290641 | 3300005527 | Freshwater Lake | NKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK* |
Ga0068876_100450647 | 3300005527 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKPNHKKVK* |
Ga0068876_100654686 | 3300005527 | Freshwater Lake | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKA |
Ga0068876_103193902 | 3300005527 | Freshwater Lake | MGSNNKIPFNETVIKNGRIVRLRKDGTVKADLGPYKTKQTKAK* |
Ga0068872_100300497 | 3300005528 | Freshwater Lake | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKAK* |
Ga0049083_100592502 | 3300005580 | Freshwater Lentic | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK** |
Ga0049083_101700852 | 3300005580 | Freshwater Lentic | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK* |
Ga0049080_100547891 | 3300005582 | Freshwater Lentic | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK* |
Ga0049082_1000034715 | 3300005584 | Freshwater Lentic | MGSNNKIPFNPTVIKDGRIVRIRKDGTVKADLGPYKLKSKKAN* |
Ga0049082_102998973 | 3300005584 | Freshwater Lentic | KIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK* |
Ga0078894_100276057 | 3300005662 | Freshwater Lake | MGSSNKIPFNETVIKNGRIVRLRKDGTVKADIGPYKTKQTKAK* |
Ga0078894_100585977 | 3300005662 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK* |
Ga0070744_100027027 | 3300006484 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTSND* |
Ga0102917_12273423 | 3300007590 | Estuarine | MGSSKHPMNKTVIKNGRIVRLRKDGGIKADLGPYLTVH |
Ga0114340_1000725111 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNKTIIKDGRIIRLRKDGTIKADLGPYKTNSKKVK* |
Ga0114340_10209994 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTQQTKAKK* |
Ga0114340_10226577 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYKPKNKVKK* |
Ga0114340_10578972 | 3300008107 | Freshwater, Plankton | MGSSNKIPFNKTVIKDGRIVRIRKDGTVKADLGPYKVKHKVVK* |
Ga0114340_10630954 | 3300008107 | Freshwater, Plankton | MGSNNKIPFNKTIIKNGRIVRVRKDGTVKADLGPYKVNHKKDK* |
Ga0114341_100637405 | 3300008108 | Freshwater, Plankton | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK* |
Ga0114341_101280974 | 3300008108 | Freshwater, Plankton | MGSSNKKPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK* |
Ga0114343_10231881 | 3300008110 | Freshwater, Plankton | MGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK* |
Ga0114344_10320413 | 3300008111 | Freshwater, Plankton | MGSNNKIPFNKTVIKDGRIVRIRKDGTVKADLGPYNTKQTKAK* |
Ga0114350_10266311 | 3300008116 | Freshwater, Plankton | KRNNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKQTKAKP* |
Ga0114350_10432662 | 3300008116 | Freshwater, Plankton | MGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYKTKKKDK* |
Ga0104242_10450334 | 3300008962 | Freshwater | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKKKVKK* |
Ga0102831_10047047 | 3300008996 | Estuarine | MGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK* |
Ga0102860_12432352 | 3300009056 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKKKTSND* |
Ga0114980_1000027828 | 3300009152 | Freshwater Lake | MGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYGKKEKPKK* |
Ga0114968_1000066929 | 3300009155 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGLYKPKKKTDK* |
Ga0114968_101830973 | 3300009155 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK* |
Ga0114978_101393315 | 3300009159 | Freshwater Lake | FGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK* |
Ga0114974_100053009 | 3300009183 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAK* |
Ga0114974_1000644010 | 3300009183 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKQKTQKAK* |
Ga0129336_101475553 | 3300010370 | Freshwater To Marine Saline Gradient | MRSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK* |
Ga0136551_10100881 | 3300010388 | Pond Fresh Water | MGNNNKIPFNPTIIKNGRIVRIRKDGSIKADLGPYQSKKKIKK* |
Ga0133913_106706177 | 3300010885 | Freshwater Lake | MGSNNKIPFNKTVIKNGRIVRIRKDGSIKADLGPYKGQKAAVKK* |
Ga0133913_130586053 | 3300010885 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKTQKAK* |
Ga0139557_10001987 | 3300011010 | Freshwater | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKKKVKK* |
Ga0151516_1066322 | 3300011116 | Freshwater | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTKQTKDK* |
Ga0119951_100013429 | 3300012000 | Freshwater | MGSNNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKANHKKVK* |
Ga0164295_106537202 | 3300013014 | Freshwater | MGNNNKIPFNETVIKNGRIIRLRKDGSIKADLGPYGKKEKPKK* |
Ga0170791_103629882 | 3300013295 | Freshwater | MGSNNKIPFNKTIIKNGRIIRIRKDGSIKADLGPYKVKKDK* |
Ga0181364_10082706 | 3300017701 | Freshwater Lake | SFGRIAMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ |
Ga0181359_10414124 | 3300019784 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKSKSKKAK |
Ga0181359_11294852 | 3300019784 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ |
Ga0211732_12842076 | 3300020141 | Freshwater | MGSNNKIPFNKTIIRDGRIVRIRKDGAIKADLGPYKAKPAKAK |
Ga0211736_101360192 | 3300020151 | Freshwater | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTKQTKGK |
Ga0211736_101365044 | 3300020151 | Freshwater | MGSNNKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKHKKVK |
Ga0211736_101545533 | 3300020151 | Freshwater | MGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGSYTPKKKIKRQA |
Ga0211736_1067257515 | 3300020151 | Freshwater | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKK |
Ga0211736_107716703 | 3300020151 | Freshwater | MGSNNKIPFNKTIIKNGRIVRIRKDGAIKADLGPYKAKPGKAK |
Ga0211736_109663846 | 3300020151 | Freshwater | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKSKKAK |
Ga0211726_101750913 | 3300020161 | Freshwater | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKK |
Ga0211726_105886113 | 3300020161 | Freshwater | NKIPFNKTIIKDGRIIRIRKDGTIKADLGPYTPKKKIKRQAXPQCQAIKIH |
Ga0211726_106136456 | 3300020161 | Freshwater | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKNKKAK |
Ga0211729_112618384 | 3300020172 | Freshwater | MGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYKSKKKVKK |
Ga0211731_108113269 | 3300020205 | Freshwater | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK |
Ga0208091_100011122 | 3300020506 | Freshwater | MGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKSNKKRIKNV |
Ga0208091_10050703 | 3300020506 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKTKRDK |
Ga0208223_10003667 | 3300020519 | Freshwater | MGSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKAKHKVVK |
Ga0194048_101310792 | 3300021519 | Anoxic Zone Freshwater | MGSNNKIPFNKTIIRDGRILRVRKDGSIKADLGPYKTKRGTKNA |
Ga0222714_100099175 | 3300021961 | Estuarine Water | MGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK |
Ga0222714_102595422 | 3300021961 | Estuarine Water | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKKKVKK |
Ga0222713_100110541 | 3300021962 | Estuarine Water | MGSSNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKV |
Ga0222713_100814865 | 3300021962 | Estuarine Water | MGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK |
Ga0222713_103856494 | 3300021962 | Estuarine Water | MGSNNKIPFNKTVIKNGRIVRLRKDGTVKADLGPYKVNHKKAK |
Ga0222713_107100972 | 3300021962 | Estuarine Water | MGSNNKIPFNKTIIKNGRIIRLRKDGTIKADLGPYSTKKKGLNIDKR |
Ga0222712_101136684 | 3300021963 | Estuarine Water | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAKQ |
Ga0214917_1000064943 | 3300022752 | Freshwater | MGSNNKIPFNKTIIKNGRIIRIRKDGSIKADLGPYKVKKDK |
Ga0244775_100590135 | 3300024346 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTSND |
Ga0244775_100696844 | 3300024346 | Estuarine | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK |
Ga0244776_104530521 | 3300024348 | Estuarine | MGSSNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK |
Ga0255066_10439431 | 3300027131 | Freshwater | TMGSNNKIPFNKTIIKDGRIVRIRKDGAIKADLGPYKAKPAKDKK |
Ga0208923_10576911 | 3300027320 | Estuarine | MGSSNKIPFNKTIIKDGRIIRLRKDGTVKADLGPYRVKKRKTS |
Ga0209552_11665572 | 3300027563 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAYGKKKKAQGSQA |
Ga0209552_11837462 | 3300027563 | Freshwater Lake | MGSSNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAKQ |
Ga0208966_100001664 | 3300027586 | Freshwater Lentic | MGSNNKIPFNPTVIKDGRIVRIRKDGTVKADLGPYKLKSKKAN |
Ga0208966_11286833 | 3300027586 | Freshwater Lentic | MGSSNKIPFNKTIIKNGRIIRIRKDGTVKADLGPYQVKKSKTNN |
Ga0208966_11842723 | 3300027586 | Freshwater Lentic | NKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKAK |
Ga0209357_11213562 | 3300027656 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRVRKDGTIKADLGAY |
Ga0209553_12258371 | 3300027688 | Freshwater Lake | VGSNNKIPFNPTVIKNGRIIRIRKDGTIKADLGPVKS |
(restricted) Ga0247833_12873262 | 3300027730 | Freshwater | MGSNNKIPFNETVIKNGRIVRLRKDGSVKADLGPYKTEQTKGK |
Ga0209442_11420962 | 3300027732 | Freshwater Lake | PFNPTVIKNGRIVRIRKDGSIKADLGPYKSKKKVKKX |
Ga0209087_10536454 | 3300027734 | Freshwater Lake | MGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYGKKEKPKK |
Ga0209296_100058613 | 3300027759 | Freshwater Lake | MGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK |
Ga0209296_10049564 | 3300027759 | Freshwater Lake | MGSNNKIPFNPTVIKDGRIVRIRKDGSIKADLGPYKRKTQKAK |
Ga0209296_10335514 | 3300027759 | Freshwater Lake | MGSSNKIPFNKTIIRDGRIVRIRKDGSIKADLGPYKTKQTKAK |
Ga0209086_100204247 | 3300027770 | Freshwater Lake | MGSNNKIPFNPTVIKNGRIVRIRKDGSIKADLGLYKPKKKTDK |
Ga0209768_102965804 | 3300027772 | Freshwater Lake | SFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYKTEQTKGKK |
Ga0209500_100960595 | 3300027782 | Freshwater Lake | SFGRTITMGSNNKIPFNQTVIKNGRIVRVRKDGSVKADLGPYNRKQTKAK |
(restricted) Ga0247831_12323031 | 3300028559 | Freshwater | MGSNNKIPFNETVIKNGRIVRLRKDGSVKADLGPYKT |
Ga0238435_1007734 | 3300029349 | Freshwater | MGNNNKIPFNETVIKNGRIIRLRKDGSVKADLGPYTKRDKSQK |
Ga0315907_100002827 | 3300031758 | Freshwater | MGSNNKIPFNKTIIKDGRIIRLRKDGTIKADLGPYKTNSKKVK |
Ga0315909_100324363 | 3300031857 | Freshwater | MGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYKTKKKDK |
Ga0315909_104641013 | 3300031857 | Freshwater | MGSNNKIPFNPTIIKNGRIVRIRKDGTVKADLGPYQKGKKNK |
Ga0315909_105169304 | 3300031857 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYKPKNKVKK |
Ga0315901_102576003 | 3300031963 | Freshwater | MGSNNKIPFNKTVIKNGRIIRLRKDGTVKADLGEYKPKNKVKK |
Ga0315901_105794935 | 3300031963 | Freshwater | GSNNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKANHKKAK |
Ga0315902_110049323 | 3300032093 | Freshwater | SSGRITMGSSNKIPFNKTIIRDGRIVRIRKDGTVKADLGPYKTKQTKAK |
Ga0335028_0266425_3_107 | 3300034071 | Freshwater | MGSSNKIPFNETVIKNGRIVRLRKDGTVKADLGPY |
Ga0335028_0501009_88_231 | 3300034071 | Freshwater | MIMGSSNKIPFNKTIIKDGRIIRIRKDGTIKADLGPYTLKKKAKGQA |
Ga0335012_0323874_2_121 | 3300034093 | Freshwater | MGSSNKIPFNKTIIKNGRIIRLRKDGTVKADLGEYNPKKK |
Ga0335027_0340781_424_567 | 3300034101 | Freshwater | MGSNNKIPFNKTIIKNGRIIRIRKDGTIKADLGPYSTKKKGLKIDKR |
Ga0335029_0607930_1_120 | 3300034102 | Freshwater | MGSNNKHPMNKTVIKNGRIVRIRKDGAIKADLGPYLTVHK |
Ga0335050_0265500_222_347 | 3300034108 | Freshwater | MGSNNKIPFNKTIIKNGRIIRLRKDGTVKADLGPYKVKKDK |
Ga0335063_0462826_503_625 | 3300034111 | Freshwater | NKIPFNDTQIKNGRIVRLRKDGTVKADLGPYKVKQTKAKP |
⦗Top⦘ |