Basic Information | |
---|---|
Family ID | F071077 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 40 residues |
Representative Sequence | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Number of Associated Samples | 76 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 65.57 % |
% of genes near scaffold ends (potentially truncated) | 40.16 % |
% of genes from short scaffolds (< 2000 bps) | 71.31 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (50.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (41.803 % of family members) |
Environment Ontology (ENVO) | Unclassified (83.607 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (84.426 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 58.97% Coil/Unstructured: 41.03% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF01058 | Oxidored_q6 | 4.92 |
PF03029 | ATP_bind_1 | 4.92 |
PF08264 | Anticodon_1 | 3.28 |
PF02481 | DNA_processg_A | 3.28 |
PF08818 | DUF1801 | 1.64 |
PF01494 | FAD_binding_3 | 1.64 |
PF01420 | Methylase_S | 0.82 |
PF09346 | SMI1_KNR4 | 0.82 |
PF10137 | TIR-like | 0.82 |
PF04014 | MazE_antitoxin | 0.82 |
PF03551 | PadR | 0.82 |
PF00091 | Tubulin | 0.82 |
PF01370 | Epimerase | 0.82 |
PF03259 | Robl_LC7 | 0.82 |
PF06271 | RDD | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 6.56 |
COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 4.92 |
COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 4.92 |
COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 4.92 |
COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 4.92 |
COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 4.92 |
COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 4.92 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 3.28 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.64 |
COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 1.64 |
COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 1.64 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.64 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.64 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.82 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.82 |
COG2018 | Predicted regulator of Ras-like GTPase activity, Roadblock/LC7/MglB family | Signal transduction mechanisms [T] | 0.82 |
COG1714 | Uncharacterized membrane protein YckC, RDD family | Function unknown [S] | 0.82 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.82 |
COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 50.00 % |
Unclassified | root | N/A | 50.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002557|JGI25381J37097_1011251 | Not Available | 1580 | Open in IMG/M |
3300002558|JGI25385J37094_10002654 | Not Available | 6017 | Open in IMG/M |
3300002558|JGI25385J37094_10114831 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 777 | Open in IMG/M |
3300002560|JGI25383J37093_10004396 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 4377 | Open in IMG/M |
3300002560|JGI25383J37093_10091813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 902 | Open in IMG/M |
3300002562|JGI25382J37095_10037214 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1905 | Open in IMG/M |
3300002562|JGI25382J37095_10053497 | Not Available | 1547 | Open in IMG/M |
3300002908|JGI25382J43887_10041039 | Not Available | 2516 | Open in IMG/M |
3300002908|JGI25382J43887_10171097 | Not Available | 1079 | Open in IMG/M |
3300002908|JGI25382J43887_10313043 | Not Available | 680 | Open in IMG/M |
3300005167|Ga0066672_10290962 | Not Available | 1059 | Open in IMG/M |
3300005174|Ga0066680_10219788 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1203 | Open in IMG/M |
3300005174|Ga0066680_10461252 | Not Available | 801 | Open in IMG/M |
3300005174|Ga0066680_10501783 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 763 | Open in IMG/M |
3300005174|Ga0066680_10939055 | Not Available | 510 | Open in IMG/M |
3300005175|Ga0066673_10563035 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 666 | Open in IMG/M |
3300005179|Ga0066684_10438819 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 878 | Open in IMG/M |
3300005180|Ga0066685_10924020 | Not Available | 581 | Open in IMG/M |
3300005181|Ga0066678_10084384 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1890 | Open in IMG/M |
3300005186|Ga0066676_10048490 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2403 | Open in IMG/M |
3300005187|Ga0066675_10009446 | All Organisms → cellular organisms → Archaea | 5056 | Open in IMG/M |
3300005446|Ga0066686_10619668 | Not Available | 735 | Open in IMG/M |
3300005446|Ga0066686_10946973 | Not Available | 562 | Open in IMG/M |
3300005450|Ga0066682_10742300 | Not Available | 598 | Open in IMG/M |
3300005451|Ga0066681_10524376 | Not Available | 731 | Open in IMG/M |
3300005555|Ga0066692_10317335 | All Organisms → cellular organisms → Archaea | 988 | Open in IMG/M |
3300005556|Ga0066707_10696246 | Not Available | 637 | Open in IMG/M |
3300005556|Ga0066707_10767342 | Not Available | 598 | Open in IMG/M |
3300005557|Ga0066704_10647499 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 672 | Open in IMG/M |
3300005558|Ga0066698_10562208 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 773 | Open in IMG/M |
3300005558|Ga0066698_10589994 | Not Available | 750 | Open in IMG/M |
3300005558|Ga0066698_10636439 | Not Available | 713 | Open in IMG/M |
3300005558|Ga0066698_11085231 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 506 | Open in IMG/M |
3300005559|Ga0066700_10382127 | Not Available | 994 | Open in IMG/M |
3300005586|Ga0066691_10300202 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 947 | Open in IMG/M |
3300006031|Ga0066651_10280952 | Not Available | 885 | Open in IMG/M |
3300006034|Ga0066656_10060460 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2211 | Open in IMG/M |
3300006034|Ga0066656_10072249 | Not Available | 2041 | Open in IMG/M |
3300006034|Ga0066656_10216181 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1224 | Open in IMG/M |
3300006034|Ga0066656_10248099 | Not Available | 1143 | Open in IMG/M |
3300006034|Ga0066656_10982491 | Not Available | 541 | Open in IMG/M |
3300006794|Ga0066658_10199729 | Not Available | 1056 | Open in IMG/M |
3300006796|Ga0066665_11028814 | Not Available | 630 | Open in IMG/M |
3300009012|Ga0066710_100542732 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1758 | Open in IMG/M |
3300009012|Ga0066710_100605035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1663 | Open in IMG/M |
3300009012|Ga0066710_101145570 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1204 | Open in IMG/M |
3300009012|Ga0066710_101800810 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 924 | Open in IMG/M |
3300009012|Ga0066710_102226386 | Not Available | 799 | Open in IMG/M |
3300009012|Ga0066710_102471633 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 752 | Open in IMG/M |
3300009012|Ga0066710_104810633 | Not Available | 505 | Open in IMG/M |
3300009090|Ga0099827_10009401 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 6205 | Open in IMG/M |
3300009137|Ga0066709_101061613 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1189 | Open in IMG/M |
3300009137|Ga0066709_102575546 | Not Available | 683 | Open in IMG/M |
3300010304|Ga0134088_10013536 | Not Available | 3522 | Open in IMG/M |
3300010304|Ga0134088_10668218 | Not Available | 520 | Open in IMG/M |
3300010322|Ga0134084_10204771 | Not Available | 692 | Open in IMG/M |
3300010323|Ga0134086_10031567 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanocellales → Methanocellaceae → Methanocella → Methanocella paludicola | 1747 | Open in IMG/M |
3300010326|Ga0134065_10088634 | Not Available | 1011 | Open in IMG/M |
3300010329|Ga0134111_10157827 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 901 | Open in IMG/M |
3300010335|Ga0134063_10502232 | Not Available | 607 | Open in IMG/M |
3300012198|Ga0137364_10054083 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2684 | Open in IMG/M |
3300012198|Ga0137364_10352248 | Not Available | 1098 | Open in IMG/M |
3300012198|Ga0137364_10561535 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 859 | Open in IMG/M |
3300012198|Ga0137364_10921748 | Not Available | 661 | Open in IMG/M |
3300012206|Ga0137380_11213524 | Not Available | 639 | Open in IMG/M |
3300012206|Ga0137380_11270706 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 621 | Open in IMG/M |
3300012207|Ga0137381_10000853 | All Organisms → cellular organisms → Archaea | 19833 | Open in IMG/M |
3300012207|Ga0137381_10316694 | Not Available | 1359 | Open in IMG/M |
3300012208|Ga0137376_11473592 | Not Available | 571 | Open in IMG/M |
3300012285|Ga0137370_10084297 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1767 | Open in IMG/M |
3300012349|Ga0137387_10079283 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2254 | Open in IMG/M |
3300012351|Ga0137386_10082724 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2252 | Open in IMG/M |
3300012361|Ga0137360_11197819 | Not Available | 657 | Open in IMG/M |
3300012362|Ga0137361_11174740 | Not Available | 690 | Open in IMG/M |
3300012918|Ga0137396_10031546 | Not Available | 3514 | Open in IMG/M |
3300012927|Ga0137416_10059996 | Not Available | 2712 | Open in IMG/M |
3300012975|Ga0134110_10004980 | All Organisms → cellular organisms → Archaea | 4917 | Open in IMG/M |
3300012975|Ga0134110_10021108 | Not Available | 2517 | Open in IMG/M |
3300012976|Ga0134076_10001749 | All Organisms → cellular organisms → Archaea | 6580 | Open in IMG/M |
3300014150|Ga0134081_10385566 | Not Available | 522 | Open in IMG/M |
3300014150|Ga0134081_10398043 | Not Available | 516 | Open in IMG/M |
3300017656|Ga0134112_10410065 | Not Available | 561 | Open in IMG/M |
3300017657|Ga0134074_1102626 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 983 | Open in IMG/M |
3300017659|Ga0134083_10254727 | Not Available | 735 | Open in IMG/M |
3300018431|Ga0066655_10125871 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1481 | Open in IMG/M |
3300018431|Ga0066655_10637367 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 720 | Open in IMG/M |
3300018433|Ga0066667_10055088 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
3300018433|Ga0066667_11774641 | Not Available | 557 | Open in IMG/M |
3300018468|Ga0066662_10845014 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 893 | Open in IMG/M |
3300018468|Ga0066662_12463272 | Not Available | 548 | Open in IMG/M |
3300026277|Ga0209350_1003624 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 5628 | Open in IMG/M |
3300026296|Ga0209235_1008206 | All Organisms → cellular organisms → Archaea | 5829 | Open in IMG/M |
3300026296|Ga0209235_1013408 | Not Available | 4507 | Open in IMG/M |
3300026296|Ga0209235_1020980 | Not Available | 3489 | Open in IMG/M |
3300026296|Ga0209235_1034169 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2594 | Open in IMG/M |
3300026297|Ga0209237_1027214 | All Organisms → cellular organisms → Archaea | 3169 | Open in IMG/M |
3300026298|Ga0209236_1005128 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 7978 | Open in IMG/M |
3300026301|Ga0209238_1155651 | Not Available | 690 | Open in IMG/M |
3300026310|Ga0209239_1022397 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3108 | Open in IMG/M |
3300026310|Ga0209239_1339532 | Not Available | 524 | Open in IMG/M |
3300026313|Ga0209761_1045731 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2490 | Open in IMG/M |
3300026325|Ga0209152_10049454 | Not Available | 1474 | Open in IMG/M |
3300026327|Ga0209266_1017998 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3956 | Open in IMG/M |
3300026328|Ga0209802_1001039 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 21121 | Open in IMG/M |
3300026329|Ga0209375_1029207 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3005 | Open in IMG/M |
3300026329|Ga0209375_1142893 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1021 | Open in IMG/M |
3300026329|Ga0209375_1284170 | Not Available | 542 | Open in IMG/M |
3300026332|Ga0209803_1159619 | Not Available | 865 | Open in IMG/M |
3300026527|Ga0209059_1181515 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 728 | Open in IMG/M |
3300026529|Ga0209806_1072813 | Not Available | 1540 | Open in IMG/M |
3300026529|Ga0209806_1088426 | Not Available | 1351 | Open in IMG/M |
3300026536|Ga0209058_1061634 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2064 | Open in IMG/M |
3300026536|Ga0209058_1181584 | Not Available | 918 | Open in IMG/M |
3300026538|Ga0209056_10126350 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2017 | Open in IMG/M |
3300026538|Ga0209056_10536164 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 599 | Open in IMG/M |
3300026540|Ga0209376_1105021 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1436 | Open in IMG/M |
3300026540|Ga0209376_1222077 | Not Available | 836 | Open in IMG/M |
3300026540|Ga0209376_1240904 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 782 | Open in IMG/M |
3300026547|Ga0209156_10073903 | All Organisms → cellular organisms → Archaea | 1741 | Open in IMG/M |
3300026548|Ga0209161_10171176 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1236 | Open in IMG/M |
3300027643|Ga0209076_1012962 | Not Available | 2167 | Open in IMG/M |
3300027882|Ga0209590_10045776 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2410 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 41.80% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 29.51% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.57% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.30% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25381J37097_10112512 | 3300002557 | Grasslands Soil | MGEYYRACVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
JGI25385J37094_100026545 | 3300002558 | Grasslands Soil | MGEYYRGFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRIN* |
JGI25385J37094_101148312 | 3300002558 | Grasslands Soil | MGGYYRALVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
JGI25383J37093_100043963 | 3300002560 | Grasslands Soil | MGGYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
JGI25383J37093_100918132 | 3300002560 | Grasslands Soil | MGGYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
JGI25382J37095_100372141 | 3300002562 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
JGI25382J37095_100534972 | 3300002562 | Grasslands Soil | MGEYYRAFVVTXEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
JGI25382J43887_100410391 | 3300002908 | Grasslands Soil | MGEYYRAXVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
JGI25382J43887_101710972 | 3300002908 | Grasslands Soil | MGEYYRAFAVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
JGI25382J43887_103130432 | 3300002908 | Grasslands Soil | MGEYYRAFVVTEDRVTKWPAPRDDVEYDVLRVSVNVHTLTLDAPTW |
Ga0066672_102909622 | 3300005167 | Soil | MGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNMRTN* |
Ga0066680_102197882 | 3300005174 | Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDALRVSVNVHTN* |
Ga0066680_104612521 | 3300005174 | Soil | MGEYYRAFVVTEDRVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0066680_105017832 | 3300005174 | Soil | MGEYYRGFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
Ga0066680_109390552 | 3300005174 | Soil | MGEYYRASVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0066673_105630352 | 3300005175 | Soil | LGEYYRAFMVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0066684_104388191 | 3300005179 | Soil | GCLRPLGEYYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN* |
Ga0066685_109240202 | 3300005180 | Soil | MGEYYRAIMVMEERVTKWPAPRDDVEYDVLRVSVNGHTN* |
Ga0066678_100843843 | 3300005181 | Soil | MGEYYRAFVVTERPVTKWPAKRDEVEYDVLRVSVNVRTN* |
Ga0066676_100484903 | 3300005186 | Soil | LGEYYRAFVVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN* |
Ga0066675_100094462 | 3300005187 | Soil | MLGAMGEYYRAFVTMEERVTKWPAPRDEVEYDVLRVSVNVHTS* |
Ga0066686_106196682 | 3300005446 | Soil | MGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
Ga0066686_109469731 | 3300005446 | Soil | MGGYYRAFVVTKERVTKWPAPRDEVEYDVLRVSVNMHTN* |
Ga0066682_107423002 | 3300005450 | Soil | LGEYYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN* |
Ga0066681_105243762 | 3300005451 | Soil | LGEYYRAFVVMEDRVTKWPAPREEVEYDVLRVNVNVHTN* |
Ga0066692_103173354 | 3300005555 | Soil | YYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNMRTN* |
Ga0066707_106962461 | 3300005556 | Soil | ATGEYYRAFVVTEERVTKWPAPRDEVEYDVLRVSVNVHIN* |
Ga0066707_107673422 | 3300005556 | Soil | PQRTKLGAMGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNMRTN* |
Ga0066704_106474992 | 3300005557 | Soil | MGEYYRAFVVTEERVTKWPAKRDEVEYDVLRVSVNVRIN* |
Ga0066698_105622082 | 3300005558 | Soil | KSHNEGCLRPLGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0066698_105899941 | 3300005558 | Soil | MGGYYRAFVVREERVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0066698_106364392 | 3300005558 | Soil | GEYYRAFVAMEERVTKWPGPRDEVEYDVLRVSVKMHIN* |
Ga0066698_110852311 | 3300005558 | Soil | MGGYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRT |
Ga0066700_103821272 | 3300005559 | Soil | MGGYYRAFVVTEGRVTKWPAPRDEVEYDVLRVSVNVHTN* |
Ga0066691_103002022 | 3300005586 | Soil | MGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRT |
Ga0066651_102809521 | 3300006031 | Soil | KSHNEGCLRPLGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVNVNMHTN* |
Ga0066656_100604603 | 3300006034 | Soil | VVTEERVTKWPAPRDDVEYDAPRDEVEYDVLRVNVNVRTN* |
Ga0066656_100722494 | 3300006034 | Soil | MGEYYRAFVVTEEPVTKWSAKRDEVEYDVLRVSVNVRTN* |
Ga0066656_102161811 | 3300006034 | Soil | KSHNEGCLRPLGEYYRAFVVMEDRVTKWPAPREEVEYDVLRVNVNVHTN* |
Ga0066656_102480993 | 3300006034 | Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHT |
Ga0066656_109824912 | 3300006034 | Soil | GEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNMRTN* |
Ga0066658_101997292 | 3300006794 | Soil | GEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
Ga0066665_110288142 | 3300006796 | Soil | QAREKSHNEGCLRPLGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0066710_1005427322 | 3300009012 | Grasslands Soil | MGGYYRAFVVMEERVTKWPAKRDEVEYDVLRVSVNVHTN |
Ga0066710_1006050353 | 3300009012 | Grasslands Soil | MGGYYRAFVVTEERVTKWPAPKDDVEYDVLRVSVNVHTN |
Ga0066710_1011455704 | 3300009012 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVRTN |
Ga0066710_1018008101 | 3300009012 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPREDVEYDVLRVSVNVHTN |
Ga0066710_1022263861 | 3300009012 | Grasslands Soil | MGEYYRAFVVKEEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0066710_1024716331 | 3300009012 | Grasslands Soil | MGEYYRALVVTEERVTKWPAPRDEVEYDVLRVSVNVHTN |
Ga0066710_1048106332 | 3300009012 | Grasslands Soil | MGEYYRTFVVREERVTKWPAPRDDVEYDVLRVSVNG |
Ga0099827_100094016 | 3300009090 | Vadose Zone Soil | MGEYYRAFVVREERVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0066709_1010616131 | 3300009137 | Grasslands Soil | LGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0066709_1025755462 | 3300009137 | Grasslands Soil | YYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0134088_100135364 | 3300010304 | Grasslands Soil | MGEYYRALVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0134088_106682182 | 3300010304 | Grasslands Soil | LGAMGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNGHTN* |
Ga0134084_102047711 | 3300010322 | Grasslands Soil | LGEYYRAFMVMEDRVTKWPAPRDEVESDVLRVNVNVHTN* |
Ga0134086_100315671 | 3300010323 | Grasslands Soil | MGGYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNV |
Ga0134065_100886341 | 3300010326 | Grasslands Soil | SHNEGCLRPLGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0134111_101578271 | 3300010329 | Grasslands Soil | SHHRRSLRPLGEYYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN* |
Ga0134063_105022321 | 3300010335 | Grasslands Soil | RAFVVMEDRVTKWPAPRDEVESDVLRVNVNVHTN* |
Ga0137364_100540832 | 3300012198 | Vadose Zone Soil | MGEYYRAFVVMEEPVTKWPARRDEVEYDVLRVSVNMRTN* |
Ga0137364_103522481 | 3300012198 | Vadose Zone Soil | MGEYYRAFVVTEEPVTKWPARRDEVEYDVLRVSVNMRTS* |
Ga0137364_105615351 | 3300012198 | Vadose Zone Soil | HNEGCLRPLGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0137364_109217481 | 3300012198 | Vadose Zone Soil | PRAKLAKKSHNEGCLRPLGEYYRAFVVMEDRVTKWPAPREEVEYDVLRVNVNVHTN* |
Ga0137380_112135241 | 3300012206 | Vadose Zone Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNGHTN* |
Ga0137380_112707061 | 3300012206 | Vadose Zone Soil | MGEYYRALVVTEEWVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0137381_100008531 | 3300012207 | Vadose Zone Soil | MGEYYRALVVTEERVTKWPAPRDDVEHDVLRVSVNVHTN* |
Ga0137381_103166941 | 3300012207 | Vadose Zone Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVN |
Ga0137376_114735922 | 3300012208 | Vadose Zone Soil | MGEYYRAFVVTEEPVTKWPARRDEVEYDVLRVSVNMRT |
Ga0137370_100842971 | 3300012285 | Vadose Zone Soil | PTGRQKSHHRRSLRPLGEYYRAFMVMEDRVTKWPAPREEVEYDVLRVNVNVHTN* |
Ga0137387_100792834 | 3300012349 | Vadose Zone Soil | AMGEYYRALVVTEERVTKWPAPRDDVEHDVLRVSVNVHTN* |
Ga0137386_100827244 | 3300012351 | Vadose Zone Soil | GAMGEYYRALVVTEERVTKWPAPRDDVEHDVLRVSVNVHTN* |
Ga0137360_111978191 | 3300012361 | Vadose Zone Soil | MGEYYRGLAVTEERVTKWPAPRDDVEYDVLRVSVNMHTN* |
Ga0137361_111747401 | 3300012362 | Vadose Zone Soil | MGEYYRALAVTEERVTKWPAPRDDVEYDVLRVSVNVHTN* |
Ga0137396_100315461 | 3300012918 | Vadose Zone Soil | VMGEYYRAFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
Ga0137416_100599962 | 3300012927 | Vadose Zone Soil | MGEYYRAFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRTN* |
Ga0134110_100049801 | 3300012975 | Grasslands Soil | MSEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNMRTN* |
Ga0134110_100211083 | 3300012975 | Grasslands Soil | RAFMVMEDRVTKWPAPRDEVEYDVLRVSVNVHIN* |
Ga0134076_100017495 | 3300012976 | Grasslands Soil | MGEYYRALVVTEERVTKWPAPRDDVEYDVQRVSVNVHTN* |
Ga0134081_103855661 | 3300014150 | Grasslands Soil | RAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN* |
Ga0134081_103980431 | 3300014150 | Grasslands Soil | GQAREKNHNEGCLRPLGEYYRAFMVMEDRVTKWPAPRDEVESDVLRVNVNVHTN* |
Ga0134112_104100651 | 3300017656 | Grasslands Soil | YYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNGHTN |
Ga0134074_11026262 | 3300017657 | Grasslands Soil | YYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN |
Ga0134083_102547272 | 3300017659 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDAPRDEVEYDVLRVNVNVRTN |
Ga0066655_101258712 | 3300018431 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Ga0066655_106373672 | 3300018431 | Grasslands Soil | LRPLGEYYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN |
Ga0066667_100550884 | 3300018433 | Grasslands Soil | MGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0066667_117746412 | 3300018433 | Grasslands Soil | MGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNMRTN |
Ga0066662_108450141 | 3300018468 | Grasslands Soil | MGGYYRAFVVTEERVTKWPAPRDDFEYDVLRVSVNVHTN |
Ga0066662_124632722 | 3300018468 | Grasslands Soil | MGEYYRGFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRIN |
Ga0209350_10036246 | 3300026277 | Grasslands Soil | MGGYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0209235_10082067 | 3300026296 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNGHTN |
Ga0209235_10134085 | 3300026296 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAKRDEVEYDVLRVSVNVRIN |
Ga0209235_10209803 | 3300026296 | Grasslands Soil | MGEYYRASVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Ga0209235_10341691 | 3300026296 | Grasslands Soil | MGGYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Ga0209237_10272144 | 3300026297 | Grasslands Soil | MGGYYRALVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Ga0209236_10051286 | 3300026298 | Grasslands Soil | MGEYYRAFVVTEERVTKWPAPRGDVEYDVLRVSVNVHTN |
Ga0209238_11556511 | 3300026301 | Grasslands Soil | MGEFYRAFVVTEERVAKWPAPRDDVEYDVLRVSVNVHTN |
Ga0209239_10223971 | 3300026310 | Grasslands Soil | MGEYYRAFVVTERPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0209239_13395321 | 3300026310 | Grasslands Soil | MGGYYRAFVVTKERVTKWPAPRDEVEYDVLRVSVNMHTN |
Ga0209761_10457315 | 3300026313 | Grasslands Soil | MGEYYRALVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Ga0209152_100494541 | 3300026325 | Soil | AMGEYYRAFVVTEERVTKWPAPRDDVEYDALRVSVNVHTN |
Ga0209266_10179986 | 3300026327 | Soil | LGEYYRAFVVMEDRVTKWPAPREEVEYDVLRVNVNVHTN |
Ga0209802_100103920 | 3300026328 | Soil | MGEYYRGFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0209375_10292076 | 3300026329 | Soil | RKNHNEGCLRPLGEYYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN |
Ga0209375_11428932 | 3300026329 | Soil | HDDLVLTLESTPAGQAREKSHNEGCLRPLGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN |
Ga0209375_12841702 | 3300026329 | Soil | PPRTKLGAMGGYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0209803_11596191 | 3300026332 | Soil | AMGEYYRAFVVTEERVTKWPAKRDEVEYDVLRVSVNVRIN |
Ga0209059_11815152 | 3300026527 | Soil | YRAFVAMEERVTKWPGPRDEVEYDVLRVSVKMHIN |
Ga0209806_10728132 | 3300026529 | Soil | EYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0209806_10884261 | 3300026529 | Soil | MGEYYRAFVVTEEPVTKWPAKRDEVEYDVLRVSVN |
Ga0209058_10616343 | 3300026536 | Soil | GEYYRAFVVTEERVTKWPAPRDDVEYDVLRVSVNVHTN |
Ga0209058_11815841 | 3300026536 | Soil | VVTEERVTKWPAPRDDVEYDAPRDEVEYDVLRVNVNVRTN |
Ga0209056_101263501 | 3300026538 | Soil | MGVYYRAFVVMEERVTKWPAKRDEVEYDVLRVSVNVHTN |
Ga0209056_105361641 | 3300026538 | Soil | LGATGEYYRAFVVTEERVTKWPAPRDEVEYDVLRVSVNVHTN |
Ga0209376_11050213 | 3300026540 | Soil | RPLGEYYRAFMVMEDRVTKWPAPRDEVEYDVLRVNVNVHTN |
Ga0209376_12220771 | 3300026540 | Soil | LGEYYRAFVVMEDRVTKWPAPRDEVESDVLRVSVNMHTN |
Ga0209376_12409041 | 3300026540 | Soil | MAEYYRAFVVMEEPVTKWPAKRDEVEYGVLRVSVNMRTN |
Ga0209156_100739032 | 3300026547 | Soil | MLGAMGEYYRAFVTMEERVTKWPAPRDEVEYDVLRVSVNVHTS |
Ga0209161_101711761 | 3300026548 | Soil | MGEYYRAFVVTEERVTKWPAPRDDIEYDVLRVSVNVHTN |
Ga0209076_10129622 | 3300027643 | Vadose Zone Soil | MGEYYRAFVVTDEPVTKWPAKRDEVEYDVLRVSVNVRTN |
Ga0209590_100457764 | 3300027882 | Vadose Zone Soil | MGEYYRAFVVREERVTKWPAPRDDVEYDVLRVSVNVHTN |
⦗Top⦘ |