Metagenome / Metatranscriptome Family F070535

Overview

Basic Information

• Family ID: F070535
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 123
• Average Sequence Length: 39 residues
• Representative Sequence: MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSP
• Number of Associated Samples: 94
• Number of Associated Scaffolds: 123

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 82.11 %
• % of genes near scaffold ends (potentially truncated): 23.58 %
• % of genes from short scaffolds (< 2000 bps): 71.54 %
• Associated GOLD sequencing projects: 84
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (70.732 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (19.512 % of family members)
• Environment Ontology (ENVO): Unclassified (39.024 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (70.732 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 21.54%
  β-sheet: 0.00%
  Coil/Unstructured: 78.46%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 123 Family Scaffolds
PF00733	Asn_synthase	25.20
PF13537	GATase_7	4.88
PF00005	ABC_tran	4.07
PF01061	ABC2_membrane	3.25
PF08241	Methyltransf_11	1.63
PF01381	HTH_3	1.63
PF01510	Amidase_2	1.63
PF07638	Sigma70_ECF	0.81
PF13472	Lipase_GDSL_2	0.81
PF01370	Epimerase	0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 123 Family Scaffolds
COG1446	Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily	Amino acid transport and metabolism [E]	0.81
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.81

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.73 %
Unclassified	root	N/A	29.27 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.73 %
Unclassified	root	N/A	29.27 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.73 %
Unclassified	root	N/A	29.27 %

Level 4

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	37.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %

Level 5

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	37.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %

Level 6

Name	Rank	Taxonomy	Distribution
Gemmatimonadetes	class	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes	5.69 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	9.76 %

Level 7

Name	Rank	Taxonomy	Distribution
Gemmatimonadales	order	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales	5.69 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	8.94 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %

Level 8

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	4.88 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	8.94 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %
unclassified Gemmatimonadales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales	0.81 %

Level 9

Name	Rank	Taxonomy	Distribution
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples	1.63 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.81 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	8.94 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.81 %
Gemmatirosa	genus	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa	0.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %
unclassified Gemmatimonadaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae	0.81 %

Level 10

Name	Rank	Taxonomy	Distribution
Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium	0.81 %
Gemmatimonadales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium	0.81 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	8.94 %
Gemmatimonadetes bacterium SCN 70-22	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium SCN 70-22	0.81 %
Gemmatirosa kalamazoonesis	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis	0.81 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.44 %
Unclassified	root	N/A	29.27 %
uncultured Gemmatimonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → environmental samples → uncultured Gemmatimonadaceae bacterium	1.63 %

Associated Scaffolds

Scaffold	Taxonomy	Length
(restricted) 3300031825|Ga0255338_1000132	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae	327979
3300000033|ICChiseqgaiiDRAFT_c0823807	Not Available	602
3300000033|ICChiseqgaiiDRAFT_c0825360	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	3420
3300000550|F24TB_12271435	Not Available	549
3300000550|F24TB_12271436	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	615
3300000956|JGI10216J12902_103146041	Not Available	611
3300003267|soilL1_10156401	All Organisms → cellular organisms → Bacteria → Proteobacteria	1469
3300003324|soilH2_10145962	All Organisms → cellular organisms → Bacteria	4164
3300004463|Ga0063356_104825311	Not Available	579
3300005329|Ga0070683_100634306	Not Available	1023

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	36.59%
Host-Associated	Host-Associated	63.41%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	4.06%
Plants	Host-Associated → Plants	63.41%
Terrestrial	Environmental → Terrestrial	32.52%

Category

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	1.63%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	44.72%
Roots	Host-Associated → Plants → Roots	0.81%
Sediment	Environmental → Aquatic → Sediment	2.44%
Soil	Environmental → Terrestrial → Soil	32.52%

Type

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.94%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	1.63%
Loam	Environmental → Terrestrial → Soil → Loam	10.57%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.81%
Sand	Environmental → Terrestrial → Soil → Sand	0.81%
Soil	Host-Associated → Plants → Rhizosphere → Soil	18.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	26.02%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	20.33%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	8.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	2.44%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.81%

Subtype

Habitat	Taxonomy	Distribution
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.63%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.25%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.81%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.81%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.25%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.63%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	26.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	18.70%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	11.38%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	8.94%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.94%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	2.44%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.63%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.81%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.81%

Habitat

Habitat	Taxonomy	Distribution
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.63%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.06%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.81%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.81%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	4.88%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.44%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	5.69%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.25%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.06%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.63%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	4.06%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.81%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	19.51%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.44%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.81%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	0.81%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.44%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.81%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.81%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	1.63%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.50%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.81%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.81%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.81%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.63%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.81%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300003267	Sugarcane bulk soil Sample L1	Environmental
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiDRAFT_08238072	3300000033	Soil	MYQAPKLERLGTFREVTLAGGDFNPGDGXNPYXRYA
ICChiseqgaiiDRAFT_08253604	3300000033	Soil	MYQAPKLERLGTFREVTLAGGMVSQADATNPYHRYS*
F24TB_122714352	3300000550	Soil	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYA
F24TB_122714361	3300000550	Soil	LSREGWMYQAPKLERLGTFREVTLSGGMVSQADATNPYHRYS*
JGI10216J12902_1031460412	3300000956	Soil	MYQAPKLERLGTFREVTLAGGQVSQADATNPYHRYS*
soilL1_101564012	3300003267	Sugarcane Root And Bulk Soil	MYSAPKLERLGTFREVTLSGGAFLQADASNPYHRYDQLVS*
soilH2_101459622	3300003324	Sugarcane Root And Bulk Soil	MYEAPKLERLGTFRDVTQAGGAFEPGDGSNAFHRYAPIIA*
Ga0063356_1048253111	3300004463	Arabidopsis Thaliana Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSPLPS*
Ga0070683_1006343062	3300005329	Corn Rhizosphere	MYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG*
Ga0070689_1001213283	3300005340	Switchgrass Rhizosphere	EGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA*
Ga0070659_1007624012	3300005366	Corn Rhizosphere	LTQEGSMYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA*
Ga0070667_1005040892	3300005367	Switchgrass Rhizosphere	MYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG*
Ga0070663_1011551182	3300005455	Corn Rhizosphere	EGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0070698_10000000439	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MYEAPKLERLGTFREITLAGGDFNPGDGGNPYHRYAPLPS*
Ga0073909_106636011	3300005526	Surface Soil	MYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE*
Ga0070672_1015684102	3300005543	Miscanthus Rhizosphere	MYQAPKLERLGSFREITQAGGDFSPGDGANAFHRYAP
Ga0070665_1000201053	3300005548	Switchgrass Rhizosphere	MYQSPKLERLGTFREVTLNGGDVLASDAGNPYHRYS*
Ga0070665_1001902292	3300005548	Switchgrass Rhizosphere	MYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA*
Ga0070704_1011175441	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPLPS*
Ga0070664_1000117664	3300005564	Corn Rhizosphere	MYQAPKLERLGSFREVTLAGGDFNPGDGGNPFHRYAPLPS*
Ga0070664_1001391314	3300005564	Corn Rhizosphere	MYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA*
Ga0068857_1000489103	3300005577	Corn Rhizosphere	MYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR*
Ga0068854_1004150841	3300005578	Corn Rhizosphere	MYQAPKLERLGSFREVTLAGGDFNPGDGGNPYHRYAPL*
Ga0068866_103322652	3300005718	Miscanthus Rhizosphere	MYERPTLERLGTLRELTRAGGANTPGDGANPYHRYGP*
Ga0068866_113045901	3300005718	Miscanthus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIG*
Ga0066903_1025158802	3300005764	Tropical Forest Soil	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPFHRYAPA*
Ga0068851_100164552	3300005834	Corn Rhizosphere	MYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0068870_106719942	3300005840	Miscanthus Rhizosphere	MYQTPKLERLGTFREVTLAGGAVLNSDASNPYHRYR*
Ga0075432_101092392	3300006058	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPIG*
Ga0082029_17671911	3300006169	Termite Nest	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPA*
Ga0070716_1009894161	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	HLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0097621_1024349981	3300006237	Miscanthus Rhizosphere	QEGSMYEAPKLERLGTLRELTLGGGDFTPGDGANAFHRYSP*
Ga0075428_1000247294	3300006844	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGEFNPGDGGNPYHRYAPIG*
Ga0075428_1000543414	3300006844	Populus Rhizosphere	MYETPKLERLGTMRDLTLAGGDFATGDGGNPYHRYTP*
Ga0075428_1002096892	3300006844	Populus Rhizosphere	VYVKPKLERLGTLRELTLAGGDFAPGDGANPYHRYSP*
Ga0075421_1000011444	3300006845	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYTALS*
Ga0075421_1000666015	3300006845	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYAPL*
Ga0075421_1009470522	3300006845	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPS*
Ga0075430_1003134382	3300006846	Populus Rhizosphere	MYQSPKLERLGTFREVTLNGGDVLAADASNPYHRYS*
Ga0075430_1006471591	3300006846	Populus Rhizosphere	EGWMYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYSP*
Ga0075433_100602342	3300006852	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYSQIG*
Ga0075433_101481641	3300006852	Populus Rhizosphere	MYETPKLERLGTLRELTQAGGDFAPGDGANPYHRYAP*
Ga0075433_107179251	3300006852	Populus Rhizosphere	QAPKLERLGTFREVTLAGGDFNPGDGANPYHRYAPIG*
Ga0075420_1006290092	3300006853	Populus Rhizosphere	QAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSPLPS*
Ga0075425_1003883322	3300006854	Populus Rhizosphere	MYETPKLERLGTVRELTLAGGANTPGDGANPYHRYGP*
Ga0075434_1025231072	3300006871	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLIG*
Ga0075424_1000254661	3300006904	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRY
Ga0079218_108593832	3300007004	Agricultural Soil	MYQAPKLERLGSFREVTLAGGDFNPGDGANPYHRYSPLPS*
Ga0111539_111257501	3300009094	Populus Rhizosphere	MYQAPKLERLGSFREITLGGGDFNPGDGTNAFHRYSPNG*
Ga0114129_103055183	3300009147	Populus Rhizosphere	MYETPKLERLGTVRELTRAGGANTPGDGANPYHRYGP*
Ga0114129_107256852	3300009147	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYGPIG*
Ga0111538_141339472	3300009156	Populus Rhizosphere	YEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA*
Ga0105241_112105002	3300009174	Corn Rhizosphere	MYQAPKLERLVTFLEVTLAGGMISAGDGVNPYHRYSQ*
Ga0126315_101049722	3300010038	Serpentine Soil	MYQSPKLERLGTFREVTLNGGDVLAADAGNPYHRYS*
Ga0126306_112887282	3300010166	Serpentine Soil	MYQSPKLERLGTFREVTLAGGEVLAADASNPYHRYS*
Ga0126383_114987072	3300010398	Tropical Forest Soil	MYQAPKLERLGTFREVILAGGMVEAGDGANPYHRYA*
Ga0134122_114659592	3300010400	Terrestrial Soil	MYQAPKLERLGTFREVTLAGGMIEAGDGANPYHRYSA*
Ga0150985_1058049251	3300012212	Avena Fatua Rhizosphere	PETVVTGGWMYEKPKLERLGSLRELTLAGGEFAPGDGANPYHRYAP*
Ga0150985_1081028133	3300012212	Avena Fatua Rhizosphere	MYQAPKLERLGSFREVTLGGGEFNPGDGTNAFHRYAPTG*
Ga0150985_1083256812	3300012212	Avena Fatua Rhizosphere	MKDVYTKPKLERLGTFREVTQSGGEFVCADAAGPYARYPMA*
Ga0150985_1091172781	3300012212	Avena Fatua Rhizosphere	MYETPKFERLGTLRELTRAGGDFSPGDATNAFHRYAP*
Ga0150985_1156555182	3300012212	Avena Fatua Rhizosphere	MYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSAGG*
Ga0150985_1205907762	3300012212	Avena Fatua Rhizosphere	MYQAPKLERLGSFREITLGGGDFNPGDGTNAFHRYAPLPS*
Ga0150984_1027129142	3300012469	Avena Fatua Rhizosphere	MYQAPKLERLGSFREVTLGGGDFNPGDGTNAFHRYAPIG*
Ga0150984_1065724141	3300012469	Avena Fatua Rhizosphere	MYQAPKLERLGSFREITQAGGDFSPGDGTNAFHRYTP*
Ga0150984_1115762952	3300012469	Avena Fatua Rhizosphere	MYESPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSAGG*
Ga0126369_119606011	3300012971	Tropical Forest Soil	REGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA*
Ga0157372_103881902	3300013307	Corn Rhizosphere	MYEAPKLERLGTLREITLAGGEFLAADGANPFHRYSAP*
Ga0157375_107196141	3300013308	Miscanthus Rhizosphere	MYEAPKLERLGTLRELTLAGGDFTPGDGANPFHRYSP*
Ga0132258_106942944	3300015371	Arabidopsis Rhizosphere	MYEAPKLERLGTLRELTLGGGDFTPGDGANPFHRYSP*
Ga0132258_110185372	3300015371	Arabidopsis Rhizosphere	MKDAYTKPKLERLGTFREVTQGGGEFICADGANPYARYPMA*
Ga0132256_1001721942	3300015372	Arabidopsis Rhizosphere	MYQTPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPL*
Ga0132257_1005410181	3300015373	Arabidopsis Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPL*
Ga0132255_1005384201	3300015374	Arabidopsis Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLTG*
Ga0132255_1022144021	3300015374	Arabidopsis Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIS*
Ga0184611_13037611	3300018067	Groundwater Sediment	MYQSPKLERLGTFREVTLAGGDVLSADASNPYHRYS
Ga0184628_106118642	3300018083	Groundwater Sediment	MYQSPKLERLGTFREVTLNGGDVLAADASNPYHRYS
Ga0190270_102039362	3300018469	Soil	MYQSPKLERLGTFREVTLNGGDILAADASNPYHRYS
Ga0182009_101820161	3300021445	Soil	YEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSQAG
Ga0222622_109367411	3300022756	Groundwater Sediment	MYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG
Ga0207697_102648922	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MYQAPKLERLGTFREVTLAGGMVSQADATNPYHRYS
Ga0207682_100568132	3300025893	Miscanthus Rhizosphere	MYQTPKLERLGTFREVTLAGGAVLNSDASNPYHRYR
Ga0207682_101806972	3300025893	Miscanthus Rhizosphere	MYETPKIERLGTLRDLTRAGGDFSPGDGANPFHRYAP
Ga0207642_108754091	3300025899	Miscanthus Rhizosphere	MYERPTLERLGTLRELTRAGGANTPGDGANPYHRYGP
Ga0207643_103939802	3300025908	Miscanthus Rhizosphere	MYQAPKLERLGTFREVTLAGGMVEAGDGANPYLRYA
Ga0207649_102407893	3300025920	Corn Rhizosphere	MYEAPKLERLGTLRELTLGGGDFNPGDGANAFHRYSA
Ga0207652_109530711	3300025921	Corn Rhizosphere	NHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA
Ga0207650_100718992	3300025925	Switchgrass Rhizosphere	MYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYSA
Ga0207650_108796251	3300025925	Switchgrass Rhizosphere	MYQAPKLERLGSFREVTLAGGDFNPGDGGNPFHRYAPLPS
Ga0207700_115983382	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	NHLSWEGWMYQAPKLERLGTFREVTLAGGMVEAGDGANPYHRYA
Ga0207701_100040125	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	MYQSPKLERLGTFREVTLAGGAVLNSDASNPYHRYR
Ga0207644_103951272	3300025931	Switchgrass Rhizosphere	HLSWEGWMYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE
Ga0207706_101097032	3300025933	Corn Rhizosphere	MYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR
Ga0207686_101785522	3300025934	Miscanthus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPIG
Ga0207686_103464481	3300025934	Miscanthus Rhizosphere	MYQAPKLERLGTFREVTLAGGAFEAGDGVNPYHRYSE
Ga0207661_103600011	3300025944	Corn Rhizosphere	KKPLLGGFMYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSPNG
Ga0207661_117617552	3300025944	Corn Rhizosphere	WMYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG
Ga0207679_115337292	3300025945	Corn Rhizosphere	MYQAPKLERLGTFREVTLAGGMVSAADGSNPYHRYA
Ga0207651_108691092	3300025960	Switchgrass Rhizosphere	HGGLMYQSPKLERLGTFREVTLAGGAVLAADASNPYHRYR
Ga0207640_106169261	3300025981	Corn Rhizosphere	MYQAPKLERLGSFREVTLAGGDFNPGDGGNPYHRYAPL
Ga0207708_100434604	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MYQTPKLERLGTFREVTLAGGAVLAADASNPYHRYR
Ga0209486_110021632	3300027886	Agricultural Soil	MYQAPKLERLGSFREVTLAGGDFNPGDGANPYHRYSPLPS
Ga0209382_100211384	3300027909	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYTALS
Ga0209382_100504743	3300027909	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYSQIG
Ga0209382_101303422	3300027909	Populus Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGVNPYHRYAPL
Ga0209382_102657951	3300027909	Populus Rhizosphere	VYVKPKLERLGTLRELTLAGGDFAPGDGANPYHRYSP
Ga0268266_100613541	3300028379	Switchgrass Rhizosphere	MYQSPKLERLGTFREVTLNGGDVLASDAGNPYHRYS
Ga0307286_104231011	3300028876	Soil	MYQAPKLERLGSFREITLGGGEFNPGDGTNAFHRYSQNG
Ga0308190_11321281	3300030993	Soil	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLP
Ga0314827_1125382	3300031476	Soil	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPS
Ga0314816_10402911	3300031481	Soil	MYQAPKLERLGTFREVTLAGGEYNPGDGGNPFHRYSPLVVS
Ga0307408_1000027498	3300031548	Rhizosphere	MYQAPKLERLGTFREVTLSGGMVSQADATNPYHRYS
Ga0310813_101014042	3300031716	Soil	MYEAPKLERLGTLREITLAGGDFNPGDGGNPFHRYSPIIG
Ga0307405_101893341	3300031731	Rhizosphere	MYQAPKLERLGTFREVTLAGGDFNPGDGANPYHRYSP
(restricted) Ga0255338_1000132141	3300031825	Sandy Soil	MYQAPKLERLGTFREVTLAGGDFNPGDGGNPYHRYAPLPA
Ga0318512_106499522	3300031846	Soil	WEGWMYQAPKLERLGTFREVTLSGGMVEAGDGANPYHRYA
Ga0310900_100013809	3300031908	Soil	MYQSPKLERLGTFREVTLAGGVVLAADASNPYHRYR
Ga0308174_105311602	3300031939	Soil	MYQAPKLERLGSFREVTLGGGEFNPGDGTNAFHRYAPTG
Ga0307409_1025443922	3300031995	Rhizosphere	MYQAPKLERLGSFREVTLGGGDFNPGDGVNAFHRYAPLPS
Ga0310810_1000028323	3300033412	Soil	MYEAPKLERLGTLRELTLAGGDFTPGDGANAFHRYAPLPG
Ga0310811_108411102	3300033475	Soil	PEVWMYEAPKLERLGTFRDVTLAGGAFLNGDGANPYHRYSQAG
Ga0316628_1012379731	3300033513	Soil	MYQAPKLERLGTFREVTLAGGGFTPGDGANPYHRYAPL
Ga0373948_0158096_20_133	3300034817	Rhizosphere Soil	MYQAPKLERLGTFREVTLAGGMIEAGDGATPYHRYSA