NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070386

Metagenome Family F070386

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070386
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 49 residues
Representative Sequence MTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVE
Number of Associated Samples 109
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 42.28 %
% of genes near scaffold ends (potentially truncated) 94.31 %
% of genes from short scaffolds (< 2000 bps) 82.93 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (84.553 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere
(8.130 % of family members)
Environment Ontology (ENVO) Unclassified
(39.024 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(65.041 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 84.62%    β-sheet: 0.00%    Coil/Unstructured: 15.38%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF09361Phasin_2 11.38
PF00903Glyoxalase 4.07
PF04519Bactofilin 1.63
PF00873ACR_tran 0.81
PF00171Aldedh 0.81
PF05239PRC 0.81
PF05148Methyltransf_8 0.81
PF17201Cache_3-Cache_2 0.81
PF00589Phage_integrase 0.81
PF00355Rieske 0.81
PF02230Abhydrolase_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG1664Cytoskeletal protein CcmA, bactofilin familyCytoskeleton [Z] 1.63
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.81
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.81
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.81
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A84.55 %
All OrganismsrootAll Organisms15.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_8931053Not Available1678Open in IMG/M
3300000890|JGI11643J12802_10162845Not Available571Open in IMG/M
3300000890|JGI11643J12802_10346840Not Available812Open in IMG/M
3300000891|JGI10214J12806_11166181Not Available1337Open in IMG/M
3300001537|A2065W1_10555406Not Available768Open in IMG/M
3300002070|JGI24750J21931_1068008Not Available578Open in IMG/M
3300002076|JGI24749J21850_1065815Not Available555Open in IMG/M
3300002459|JGI24751J29686_10095728Not Available619Open in IMG/M
3300004114|Ga0062593_102276632All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria609Open in IMG/M
3300005329|Ga0070683_101083646Not Available769Open in IMG/M
3300005335|Ga0070666_10893277Not Available657Open in IMG/M
3300005336|Ga0070680_100253289Not Available1489Open in IMG/M
3300005337|Ga0070682_100890476Not Available730Open in IMG/M
3300005344|Ga0070661_100055213All Organisms → cellular organisms → Bacteria2909Open in IMG/M
3300005353|Ga0070669_100605071Not Available918Open in IMG/M
3300005353|Ga0070669_101380190Not Available611Open in IMG/M
3300005355|Ga0070671_100484037Not Available1063Open in IMG/M
3300005364|Ga0070673_100002454All Organisms → cellular organisms → Bacteria → Proteobacteria11300Open in IMG/M
3300005365|Ga0070688_100335515Not Available1102Open in IMG/M
3300005367|Ga0070667_101381112Not Available660Open in IMG/M
3300005435|Ga0070714_100712071Not Available969Open in IMG/M
3300005455|Ga0070663_101031130Not Available716Open in IMG/M
3300005547|Ga0070693_100094079Not Available1812Open in IMG/M
3300005564|Ga0070664_100123569All Organisms → cellular organisms → Bacteria → Proteobacteria2268Open in IMG/M
3300005564|Ga0070664_102214764Not Available521Open in IMG/M
3300005577|Ga0068857_100081884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2882Open in IMG/M
3300005614|Ga0068856_100022078All Organisms → cellular organisms → Bacteria → Proteobacteria6188Open in IMG/M
3300005618|Ga0068864_100329787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1435Open in IMG/M
3300005834|Ga0068851_10242890Not Available1019Open in IMG/M
3300005840|Ga0068870_10370818Not Available924Open in IMG/M
3300005841|Ga0068863_100067119Not Available3393Open in IMG/M
3300005843|Ga0068860_100035562All Organisms → cellular organisms → Bacteria → Proteobacteria4777Open in IMG/M
3300005983|Ga0081540_1239770Not Available636Open in IMG/M
3300006175|Ga0070712_100960101Not Available739Open in IMG/M
3300006845|Ga0075421_100119394Not Available3310Open in IMG/M
3300006853|Ga0075420_100543952Not Available1003Open in IMG/M
3300006914|Ga0075436_100576394Not Available828Open in IMG/M
3300006914|Ga0075436_101060082Not Available609Open in IMG/M
3300006954|Ga0079219_12463604Not Available506Open in IMG/M
3300009011|Ga0105251_10188825Not Available928Open in IMG/M
3300009036|Ga0105244_10588050Not Available511Open in IMG/M
3300009093|Ga0105240_12538853Not Available530Open in IMG/M
3300009094|Ga0111539_11110949Not Available919Open in IMG/M
3300009098|Ga0105245_10630942Not Available1100Open in IMG/M
3300009156|Ga0111538_14073687Not Available505Open in IMG/M
3300009162|Ga0075423_10528530Not Available1241Open in IMG/M
3300009174|Ga0105241_10411143Not Available1189Open in IMG/M
3300009488|Ga0114925_10849708Not Available658Open in IMG/M
3300010361|Ga0126378_10603227Not Available1212Open in IMG/M
3300010366|Ga0126379_10340671Not Available1525Open in IMG/M
3300010371|Ga0134125_11684211Not Available690Open in IMG/M
3300010376|Ga0126381_103546990Not Available612Open in IMG/M
3300010396|Ga0134126_10995284Not Available939Open in IMG/M
3300010396|Ga0134126_12149763Not Available609Open in IMG/M
3300010396|Ga0134126_12215493Not Available599Open in IMG/M
3300010398|Ga0126383_10691554Not Available1098Open in IMG/M
3300012899|Ga0157299_10146291Not Available663Open in IMG/M
3300012902|Ga0157291_10327284Not Available542Open in IMG/M
3300012913|Ga0157298_10165987Not Available676Open in IMG/M
3300012914|Ga0157297_10502583Not Available510Open in IMG/M
3300012986|Ga0164304_11707159Not Available526Open in IMG/M
3300013096|Ga0157307_1009852Not Available1463Open in IMG/M
3300013102|Ga0157371_10036048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3543Open in IMG/M
3300013297|Ga0157378_10209333All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1848Open in IMG/M
3300013306|Ga0163162_10046522All Organisms → cellular organisms → Bacteria4349Open in IMG/M
3300013306|Ga0163162_13412020Not Available507Open in IMG/M
3300013308|Ga0157375_13464965Not Available525Open in IMG/M
3300014056|Ga0120125_1013321All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae1709Open in IMG/M
3300014326|Ga0157380_10047798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3367Open in IMG/M
3300014968|Ga0157379_10499971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1127Open in IMG/M
3300016270|Ga0182036_10616474Not Available871Open in IMG/M
3300016371|Ga0182034_11844171Not Available533Open in IMG/M
3300016422|Ga0182039_11484356Not Available617Open in IMG/M
3300019361|Ga0173482_10017949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocella → Methylocella silvestris → Methylocella silvestris BL21962Open in IMG/M
3300019362|Ga0173479_10797581Not Available522Open in IMG/M
3300023263|Ga0247800_1118357Not Available550Open in IMG/M
3300025315|Ga0207697_10030154Not Available2220Open in IMG/M
3300025315|Ga0207697_10226754Not Available824Open in IMG/M
3300025321|Ga0207656_10587593Not Available568Open in IMG/M
3300025885|Ga0207653_10012203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2683Open in IMG/M
3300025901|Ga0207688_10024038Not Available3342Open in IMG/M
3300025901|Ga0207688_10204870Not Available1184Open in IMG/M
3300025904|Ga0207647_10111163Not Available1620Open in IMG/M
3300025906|Ga0207699_10314098Not Available1097Open in IMG/M
3300025906|Ga0207699_10687386Not Available749Open in IMG/M
3300025911|Ga0207654_10841878Not Available664Open in IMG/M
3300025912|Ga0207707_11236147Not Available603Open in IMG/M
3300025915|Ga0207693_10004349All Organisms → cellular organisms → Bacteria11985Open in IMG/M
3300025916|Ga0207663_10029616Not Available3218Open in IMG/M
3300025917|Ga0207660_10062074Not Available2691Open in IMG/M
3300025918|Ga0207662_10520359Not Available821Open in IMG/M
3300025920|Ga0207649_10120606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1767Open in IMG/M
3300025922|Ga0207646_11670838Not Available548Open in IMG/M
3300025923|Ga0207681_10085135Not Available2243Open in IMG/M
3300025924|Ga0207694_11352637Not Available602Open in IMG/M
3300025927|Ga0207687_11392193Not Available603Open in IMG/M
3300025928|Ga0207700_11394616Not Available623Open in IMG/M
3300025929|Ga0207664_11931816Not Available513Open in IMG/M
3300025930|Ga0207701_10404608Not Available1175Open in IMG/M
3300025935|Ga0207709_10952381Not Available700Open in IMG/M
3300025961|Ga0207712_11357163Not Available636Open in IMG/M
3300025972|Ga0207668_10338563Not Available1254Open in IMG/M
3300025972|Ga0207668_11724550Not Available565Open in IMG/M
3300025986|Ga0207658_10063471Not Available2768Open in IMG/M
3300026023|Ga0207677_10776243Not Available856Open in IMG/M
3300026095|Ga0207676_10074425All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2736Open in IMG/M
3300027907|Ga0207428_10243159Not Available1344Open in IMG/M
3300028381|Ga0268264_10077999Not Available2823Open in IMG/M
3300028381|Ga0268264_10273027Not Available1580Open in IMG/M
3300031547|Ga0310887_10048861Not Available1887Open in IMG/M
3300031562|Ga0310886_10625360Not Available663Open in IMG/M
3300031723|Ga0318493_10379160Not Available772Open in IMG/M
3300031781|Ga0318547_10926494Not Available544Open in IMG/M
3300031793|Ga0318548_10493297Not Available599Open in IMG/M
3300031854|Ga0310904_10623443Not Available738Open in IMG/M
3300031942|Ga0310916_10556769Not Available976Open in IMG/M
3300031942|Ga0310916_11175523Not Available635Open in IMG/M
3300031942|Ga0310916_11421571Not Available568Open in IMG/M
3300031947|Ga0310909_10602674Not Available918Open in IMG/M
3300032013|Ga0310906_10775566Not Available675Open in IMG/M
3300032060|Ga0318505_10468891Not Available595Open in IMG/M
3300032076|Ga0306924_11967349Not Available604Open in IMG/M
3300032122|Ga0310895_10167170Not Available964Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere8.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.50%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.50%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere5.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.06%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.06%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.06%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.25%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.25%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001537Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300002076Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3Host-AssociatedOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300013096Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2EnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_032068002088090015SoilMTEKKDHDKLFADLDALTEQQIEVGLAAGVWSEQVRPLVQHCISMTSSST
JGI11643J12802_1016284513300000890SoilMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVE
JGI11643J12802_1034684033300000890SoilMTEKKDHDKLFADLDALTEQQIEVGLAAGVWSEQVRPLVQHCISMTSSSTGRSRR*
JGI10214J12806_1116618133300000891SoilMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYL
A2065W1_1055540613300001537PermafrostMTENQDKLFADLDALSEEQIQVGLAAGVWNEQVRPLVQHYLYDLKLKRVETAA
JGI24750J21931_106800823300002070Corn, Switchgrass And Miscanthus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRAL
JGI24749J21850_106581523300002076Corn, Switchgrass And Miscanthus RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLY
JGI24751J29686_1009572823300002459Corn, Switchgrass And Miscanthus RhizosphereMAETKDRDKLFADLEALTEEQIEVGLAAGVWSEQVRPLVQY
Ga0062593_10227663223300004114SoilMTENKDNDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLYDL
Ga0070683_10108364613300005329Corn RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDL
Ga0070666_1089327723300005335Switchgrass RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADRLNE
Ga0070680_10025328913300005336Corn RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADR
Ga0070682_10089047623300005337Corn RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQH
Ga0070661_10005521363300005344Corn RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADRLN
Ga0070669_10060507113300005353Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHTEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAADRLTE
Ga0070669_10138019013300005353Switchgrass RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKLTRVCG*
Ga0070671_10048403733300005355Switchgrass RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDL
Ga0070673_100002454213300005364Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLY
Ga0070688_10033551523300005365Switchgrass RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADRLLK
Ga0070667_10138111223300005367Switchgrass RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELGD
Ga0070714_10071207133300005435Agricultural SoilMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQ
Ga0070663_10103113013300005455Corn RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKL
Ga0070693_10009407953300005547Corn, Switchgrass And Miscanthus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAADRL
Ga0070664_10012356943300005564Corn RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLV
Ga0070664_10221476423300005564Corn RhizosphereMNKEHDLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKLTRVCG*
Ga0068857_10008188473300005577Corn RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQH
Ga0068856_100022078153300005614Corn RhizosphereMTENKEHDKLFADLDALNEQHTEVGLAAGVWKVQVRALVQHYLYDLKLKRV
Ga0068864_10032978713300005618Switchgrass RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHY
Ga0068851_1024289033300005834Corn RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYD
Ga0068870_1037081833300005840Miscanthus RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAA
Ga0068863_10006711913300005841Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQ
Ga0068860_100035562133300005843Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHTEVGLAAGVWKVQVRALVQHYLYDLKLKRVE
Ga0081540_123977013300005983Tabebuia Heterophylla RhizosphereMTENKDPDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAERL
Ga0070712_10096010123300006175Corn, Switchgrass And Miscanthus RhizosphereMMENKEHDKLFAELEALNEQQIEVGLAAGVWNEQVQPLVQHYLYDLKLK
Ga0075421_10011939493300006845Populus RhizosphereMTENKDHDKLFADLDALTEQQIEVGLAAGVWNEQVRTLVQHYLYDLKLKRVEAAADR
Ga0075420_10054395223300006853Populus RhizosphereMAETKDRDKLFADLEALTEEQIEVGLAAGVWSEQVRPLVQYYLYDLKLKRVETAAEY
Ga0075436_10057639433300006914Populus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAADR
Ga0075436_10106008213300006914Populus RhizosphereMTENKEDDKLFADLDALTEQQIEVGLAAGVWNEQV
Ga0079219_1246360413300006954Agricultural SoilMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEA
Ga0105251_1018882523300009011Switchgrass RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVCPLVQHYLYD
Ga0105244_1058805013300009036Miscanthus RhizosphereMTENKEHDKLFADLDALTEQQIEVGLAADVWNERVRPLVQHY
Ga0105240_1253885323300009093Corn RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADRL
Ga0111539_1111094913300009094Populus RhizosphereMTLSKEHDKLFDDLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKL
Ga0105245_1063094223300009098Miscanthus RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKLTRVEAAADQLDEMQKATQ
Ga0111538_1407368713300009156Populus RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELG
Ga0075423_1052853013300009162Populus RhizosphereTMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEGSSASL*
Ga0105241_1041114313300009174Corn RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKLTRVEAAA
Ga0114925_1084970823300009488Deep SubsurfaceMTLENPNAMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAVAGEL
Ga0126378_1060322713300010361Tropical Forest SoilMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAGELDGMRKG
Ga0126379_1034067113300010366Tropical Forest SoilMTDNKELFAKDDKLFADLEALNEQQIKVGLAAGVWNEQVRPLVQHYLHDLKL
Ga0134125_1168421113300010371Terrestrial SoilMTENKDHDKLFADLDALTEQQIEVGLAADVWNERVRPLVQHYLY
Ga0126381_10354699013300010376Tropical Forest SoilMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRIEAAAGELDE
Ga0134126_1099528423300010396Terrestrial SoilMTENKEHDKLFADLDALNEQHTEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAAD
Ga0134126_1214976323300010396Terrestrial SoilMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLY
Ga0134126_1221549313300010396Terrestrial SoilMTENKDHDKLFADLDALSEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELG
Ga0126383_1069155433300010398Tropical Forest SoilMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVE
Ga0157299_1014629113300012899SoilMTENKDHDKLFADLDAVSEQQIEVGLTAGVWNEQVRPLVQHYLYDLKIKRVEAAADRLTEMEKA
Ga0157291_1032728423300012902SoilMTENKEHDKLFADLDALTEQQIEVGLAADVWNERVRPLVQHYLYDLKLKRVEAAAD
Ga0157298_1016598723300012913SoilMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQ
Ga0157297_1050258313300012914SoilMTENKDHDKLFPDLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADR
Ga0164304_1170715913300012986SoilMTENREHDKLFADLDALSEEQIQVGLAAGVWSEPVRPLVQHYLYDLKLMRVE
Ga0157307_100985223300013096SoilMTENKEHDKLFADLDALTEQQIEVGLAADVWNERVRPLVQHYLYDLKLKRVEAAAYHSEDKSE*
Ga0157371_1003604883300013102Corn RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKRV
Ga0157378_1020933343300013297Miscanthus RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAA
Ga0163162_1004652213300013306Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHTEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAADRLT
Ga0163162_1341202013300013306Switchgrass RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQV
Ga0157375_1346496513300013308Miscanthus RhizosphereMNKEHDLFADLDALTEEQIEVALAAGVWNEQVRPLVQHYL
Ga0120125_101332133300014056PermafrostMTENQDKLFADLDALSEEQIQVGLAAGVWNEQVRPLVQHYLYDLK
Ga0157380_1004779873300014326Switchgrass RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKL
Ga0157379_1049997113300014968Switchgrass RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQH
Ga0182036_1061647423300016270SoilMALENPNAMTETKDYDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAGEL
Ga0182034_1184417123300016371SoilMALENPNAMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLK
Ga0182039_1148435623300016422SoilMTLSKEHDKLFADLAALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELDE
Ga0173482_1001794923300019361SoilMAETKDRDKLFADLEALTEEQIEVGLAAGVWSEQVRPLVQYYLYDLKLKRV
Ga0173479_1079758123300019362SoilMTENKDHDKLFADLDALSEQQIEVGLAAGVWNEQVRPLVQHYLYDLKIKRVEAAADR
Ga0247800_111835713300023263SoilMTENKDHDKLFADLDALSEQQIEVGLAAGVWNEQV
Ga0207697_1003015413300025315Corn, Switchgrass And Miscanthus RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHCLYDLKLKRV
Ga0207697_1022675423300025315Corn, Switchgrass And Miscanthus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHFLY
Ga0207656_1058759323300025321Corn RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLV
Ga0207653_1001220353300025885Corn, Switchgrass And Miscanthus RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLK
Ga0207688_1002403883300025901Corn, Switchgrass And Miscanthus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQV
Ga0207688_1020487033300025901Corn, Switchgrass And Miscanthus RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKR
Ga0207647_1011116313300025904Corn RhizosphereMTENKEHDKLFADLDALNEQHTEVGLAAGVWKVQVRALVQHCLYDLKLKRVEAAADRLT
Ga0207699_1031409823300025906Corn, Switchgrass And Miscanthus RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKVTRVEAAADQLDEMQ
Ga0207699_1068738613300025906Corn, Switchgrass And Miscanthus RhizosphereMTETKDHHKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAG
Ga0207654_1084187813300025911Corn RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLMLKRVEA
Ga0207707_1123614713300025912Corn RhizosphereMTENKEHDKLFADLDALTEQQIEVGLAADVWNERVRPL
Ga0207693_1000434913300025915Corn, Switchgrass And Miscanthus RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYL
Ga0207663_1002961613300025916Corn, Switchgrass And Miscanthus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLM
Ga0207660_1006207453300025917Corn RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHFLYDLM
Ga0207662_1052035923300025918Switchgrass RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKLTRVCG
Ga0207649_1012060613300025920Corn RhizosphereMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELGDTRKAAR
Ga0207646_1167083813300025922Corn, Switchgrass And Miscanthus RhizosphereLNLSAMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQ
Ga0207681_1008513533300025923Switchgrass RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGFWNEQVRPLVQHYLCDLKLTRVCG
Ga0207694_1135263713300025924Corn RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAA
Ga0207687_1139219313300025927Miscanthus RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHFLYD
Ga0207700_1139461623300025928Corn, Switchgrass And Miscanthus RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAADRLLKWRR
Ga0207664_1193181623300025929Agricultural SoilMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQV
Ga0207701_1040460833300025930Corn, Switchgrass And Miscanthus RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQH
Ga0207709_1095238123300025935Miscanthus RhizosphereMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRP
Ga0207712_1135716313300025961Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLMLKR
Ga0207668_1033856323300025972Switchgrass RhizosphereMTENKEHDKLFADLNALTEQQIEVGLAAGVWNERVRPLVQHYLYDLK
Ga0207668_1172455013300025972Switchgrass RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNERVR
Ga0207658_1006347113300025986Switchgrass RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDL
Ga0207677_1077624313300026023Miscanthus RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHCL
Ga0207676_1007442513300026095Switchgrass RhizosphereVEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHYLYDLKLKRVEAAADRLTEM
Ga0207428_1024315913300027907Populus RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAADRPNE
Ga0268264_1007799913300028381Switchgrass RhizosphereMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHFLYDLMLKR
Ga0268264_1027302713300028381Switchgrass RhizosphereMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYD
Ga0310887_1004886113300031547SoilMTENKEHDKLFADLDALNEQHIEVGLAAGVWKVQVRALVQHFLYDLMLKRV
Ga0310886_1062536013300031562SoilMNKEHDKLFADLDALTEEQIEVGLAAGVWNEQVRPLVQHYLCDLKLT
Ga0318493_1037916013300031723SoilMALENPNAMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQH
Ga0318547_1092649423300031781SoilMQSVDRRNASVMMENKEHDKLFAELEALNEQQIEVGLAAGVWNEQVQPLVQHYLYDLK
Ga0318548_1049329733300031793SoilMTLSKEHDKLFADLAALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELDETRK
Ga0310904_1062344333300031854SoilMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAA
Ga0310916_1055676933300031942SoilMALENPNAMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVE
Ga0310916_1117552313300031942SoilMENKEHDKLSAELGALNEQQIEVGLAAGVWNEQVQPLVQHYL
Ga0310916_1142157133300031942SoilMTLSKEHDKLFADLAALNEQQIEVGLAAGVWNEQVR
Ga0310909_1060267423300031947SoilMALENPNAMTETKDHDKLFADLEALNEQQIEVGLAAGVWNEQVRPLVQHYLYD
Ga0310906_1077556613300032013SoilMTENKDQDKLFADLDALTEQQIEVGLAAGVWNEQVR
Ga0318505_1046889113300032060SoilMTLSKEHDKLFVDLKAPNEQQIEVGLAAGVWNEQVRPLVQH
Ga0306924_1196734913300032076SoilMTDNKELFAKEHDKLFADLEALNEQQIEVGLAAGVWNEEVRPLVQHYLYDLKLKRVEAAAEELGDTR
Ga0310895_1016717013300032122SoilMTLSKEHDKLFADLKALNEQQIEVGLAAGVWNEQVRPLVQHYLYDLKLKRVEAAAEELGDTRK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.