NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070323

Metagenome Family F070323

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070323
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 131 residues
Representative Sequence MPVRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQATAQAIDAHLAHCADLDDLDLLLVYWSGHLFTVNPLVDALARDGGARLRVLIVDTCHADDRMR
Number of Associated Samples 113
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 29.27 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.12 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.821 % of family members)
Environment Ontology (ENVO) Unclassified
(32.520 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.398 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.61%    β-sheet: 22.45%    Coil/Unstructured: 46.94%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF00557Peptidase_M24 13.01
PF13517FG-GAP_3 12.20
PF01135PCMT 4.88
PF05195AMP_N 4.88
PF00069Pkinase 2.44
PF01839FG-GAP 2.44
PF12833HTH_18 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 9.76
COG0006Xaa-Pro aminopeptidaseAmino acid transport and metabolism [E] 4.88
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 4.88
COG2518Protein-L-isoaspartate O-methyltransferasePosttranslational modification, protein turnover, chaperones [O] 4.88
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 4.88
COG4122tRNA 5-hydroxyU34 O-methylase TrmR/YrrMTranslation, ribosomal structure and biogenesis [J] 4.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_110125737All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1370Open in IMG/M
3300004114|Ga0062593_103291225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300004153|Ga0063455_100388169All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300004156|Ga0062589_101793341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300004157|Ga0062590_102226623All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300004463|Ga0063356_104000053All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300004480|Ga0062592_100505002All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1000Open in IMG/M
3300004643|Ga0062591_101085611All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium769Open in IMG/M
3300005093|Ga0062594_100496439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1030Open in IMG/M
3300005093|Ga0062594_102655078All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300005176|Ga0066679_10936260All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300005289|Ga0065704_10362230All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20796Open in IMG/M
3300005290|Ga0065712_10448360All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium688Open in IMG/M
3300005294|Ga0065705_11036439All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300005328|Ga0070676_10256327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1169Open in IMG/M
3300005337|Ga0070682_100668152All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300005344|Ga0070661_101204422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300005364|Ga0070673_100940730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium803Open in IMG/M
3300005366|Ga0070659_100040350All Organisms → cellular organisms → Bacteria3647Open in IMG/M
3300005440|Ga0070705_100491511All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium930Open in IMG/M
3300005455|Ga0070663_100696268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium863Open in IMG/M
3300005459|Ga0068867_101249193All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300005526|Ga0073909_10661704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300005530|Ga0070679_101244422All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium690Open in IMG/M
3300005533|Ga0070734_10373091All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300005545|Ga0070695_100052023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2630Open in IMG/M
3300005564|Ga0070664_102226959All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300005576|Ga0066708_10674948All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300005578|Ga0068854_101497196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300005764|Ga0066903_105909739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300005841|Ga0068863_100836722All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300006177|Ga0075362_10245700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales879Open in IMG/M
3300006195|Ga0075366_10829831All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300006353|Ga0075370_10201517All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1174Open in IMG/M
3300007004|Ga0079218_12510743All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300009147|Ga0114129_13329602All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300009148|Ga0105243_10679210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1001Open in IMG/M
3300009174|Ga0105241_11087814All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium752Open in IMG/M
3300009176|Ga0105242_10736717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300009551|Ga0105238_10835930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.937Open in IMG/M
3300009553|Ga0105249_10078071All Organisms → cellular organisms → Bacteria3072Open in IMG/M
3300009610|Ga0105340_1189462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium862Open in IMG/M
3300009789|Ga0126307_10821131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300010301|Ga0134070_10479739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300010362|Ga0126377_12444532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300010366|Ga0126379_10434724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1369Open in IMG/M
3300010397|Ga0134124_12775839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium533Open in IMG/M
3300010401|Ga0134121_10098601All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2448Open in IMG/M
3300010403|Ga0134123_12838711All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300010937|Ga0137776_1612393All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300012204|Ga0137374_10902984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300012212|Ga0150985_103320071All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300012212|Ga0150985_105477652All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1419Open in IMG/M
3300012897|Ga0157285_10237934All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300012906|Ga0157295_10314479All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium552Open in IMG/M
3300012910|Ga0157308_10169067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium713Open in IMG/M
3300012958|Ga0164299_10277380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300012984|Ga0164309_11541683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300012985|Ga0164308_11754693All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300013104|Ga0157370_10189903All Organisms → cellular organisms → Bacteria → Acidobacteria1907Open in IMG/M
3300013105|Ga0157369_11655136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300014325|Ga0163163_13101202All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300015077|Ga0173483_10870886All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300015201|Ga0173478_10364041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_60_20679Open in IMG/M
3300015371|Ga0132258_13878421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300015373|Ga0132257_102570151All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300015374|Ga0132255_101058016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1219Open in IMG/M
3300016294|Ga0182041_11145951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300016319|Ga0182033_11267936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium661Open in IMG/M
3300016319|Ga0182033_12014243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300016404|Ga0182037_11680107All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300018083|Ga0184628_10298701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300018083|Ga0184628_10524768All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300018476|Ga0190274_10013357All Organisms → cellular organisms → Bacteria → Acidobacteria5176Open in IMG/M
3300018481|Ga0190271_12371544All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300019362|Ga0173479_10623993All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300021082|Ga0210380_10500296All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300022898|Ga0247745_1036673All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium746Open in IMG/M
3300023066|Ga0247793_1075620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300025913|Ga0207695_11206658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300025932|Ga0207690_10466534All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300025935|Ga0207709_11471691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025938|Ga0207704_10416764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1064Open in IMG/M
3300025940|Ga0207691_11202751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium628Open in IMG/M
3300025941|Ga0207711_11134961All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300025945|Ga0207679_10855055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium831Open in IMG/M
3300026041|Ga0207639_11391950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300026118|Ga0207675_101853655All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium622Open in IMG/M
3300026285|Ga0209438_1023227All Organisms → cellular organisms → Bacteria → Acidobacteria2070Open in IMG/M
3300026306|Ga0209468_1029839All Organisms → cellular organisms → Bacteria1910Open in IMG/M
3300028802|Ga0307503_10027142All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1969Open in IMG/M
3300028802|Ga0307503_10446720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300028819|Ga0307296_10484186All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium677Open in IMG/M
3300028876|Ga0307286_10095196All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1042Open in IMG/M
3300031170|Ga0307498_10488691All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300031226|Ga0307497_10335380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium704Open in IMG/M
3300031548|Ga0307408_102248741All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium528Open in IMG/M
3300031731|Ga0307405_12082622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300031769|Ga0318526_10314689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300031781|Ga0318547_10707634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300031795|Ga0318557_10519981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300031847|Ga0310907_10484975All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300031854|Ga0310904_11019753All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300031858|Ga0310892_10067919All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1839Open in IMG/M
3300031901|Ga0307406_11904897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300031908|Ga0310900_10254026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1267Open in IMG/M
3300031908|Ga0310900_10683832All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium820Open in IMG/M
3300031908|Ga0310900_11698592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300031945|Ga0310913_10988335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300031947|Ga0310909_11512901All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium534Open in IMG/M
3300031995|Ga0307409_100512173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1171Open in IMG/M
3300031995|Ga0307409_101099354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium816Open in IMG/M
3300032002|Ga0307416_100201676All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1888Open in IMG/M
3300032003|Ga0310897_10247979All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium796Open in IMG/M
3300032005|Ga0307411_11951431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium547Open in IMG/M
3300032008|Ga0318562_10273966All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium981Open in IMG/M
3300032009|Ga0318563_10630730All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300032013|Ga0310906_11048816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300032075|Ga0310890_10296863All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1160Open in IMG/M
3300032075|Ga0310890_10969403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium682Open in IMG/M
3300032261|Ga0306920_100653321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1553Open in IMG/M
3300032261|Ga0306920_101302454All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1045Open in IMG/M
3300033289|Ga0310914_10366012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1304Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil8.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.25%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.44%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.44%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.44%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.63%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006353Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010937Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11012573733300000956SoilMGREFRYHLLSIGVNRESNGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPAAIDAHLAHCTSIADLDLLMIYWSGHVFAIDPVVETLAEQANARLRVLIVDTCHADDRIRKLEA
Ga0062593_10329122513300004114SoilMPLRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATASAIDAHLAHCAAIEDLDLLLLFWSGHLYAIDPIVEALARGDDTRLRVLVVDTCHADD
Ga0063455_10038816913300004153SoilMPVRDFRYHLLSIGVNREANGHSVRAAERDAFGISWTFAQLGYWRAERNRCLTGAQASAPAIDAHLAHCAALEELDLLMIYWSGHLFTVQPIVEALAREERARLRILIVDTCHADERIR
Ga0062589_10179334113300004156SoilMPGRDFRYHLLSIGVNHDANGASVRAAERDAFGVSWTFAQLGYWRAERNRCLTGSQATPAAVGAHLSSCARLDDLDLLLLFWSGHLFADADIVDALAAVPSARLRVLIVDTCHAEDRVERLDHAVAGVADDRRPVVLASCAADTRTRENSV
Ga0062590_10222662323300004157SoilMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGPQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETVASSADARLRVLIIDTCHADDRMRRLETAI
Ga0063356_10400005323300004463Arabidopsis Thaliana RhizosphereMPGRDFSYHLLSIGVNRDANGGSVRSAERDAFGVSWTFAQLGYWRAERNRCLTGTQATPSAIDAHLASCAQLDDLDLLLLFWSGHLFADTAIVEALTSVPSARLRVLIVDTCHCEERVERLARALDDGVEDERRPIVLASC
Ga0062592_10050500233300004480SoilMPVKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPSAIEAHLAYCGGLQNLDLLLLFWSGHVFSIDPLVDALTRADDTRLRVLVVDTCHAAERMRRLEETLSAITDDRRPVVLASCAADA
Ga0062591_10108561113300004643SoilMSLRDFRYHLLSIGVNREANGSSIRSAERDAFGISWTFAQLGYWRAERNRCLTGSQASRASIDAHLAYCGQIDQLDLLLLFWSGHLFSIDPILEMIARTPDVRLRVLIVDTCQAGDR
Ga0062594_10049643913300005093SoilMPVKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAIEAHLAYCGGLQNLDLLLLFWSGHVFSIDPLVDALTRADDTRLRVLVVDTCHAA
Ga0062594_10265507813300005093SoilMPLRDFRYHLLSVGVNREANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQAIPSAIDAHLAYSAGLEDLDLLFFFWSGHLFSIDPIVEALAGAKGARLRVLLVDTCHADDRMRHLEEALAGVPDDRRPVALASCAP
Ga0066679_1093626013300005176SoilMSAKDFKYHLLSIGVNREANGTSVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATPAAIDAHLAHCAALEELDLLLLFWSGHLHSTAALVDALAGASRARLR
Ga0065704_1036223023300005289Switchgrass RhizosphereMPARDFRYHLLSIGVNREANGATVRAAERDAFGLSWTFAQLGYWRADRNRCLTGSQAAQAAVEAHLASCARLGDLDLLLVFWSGYLFTIDSLVQTLAGSTDARLRVLIIDTCHADERMRRLQAAIAELPDDRRPVVLA
Ga0065712_1044836013300005290Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWKADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSTDARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASCAADGR
Ga0065705_1103643913300005294Switchgrass RhizosphereMPARDFRYHLLSIGVNREANGATVRAAERDAFGLSWTFAQLGYCRADRNRCLTGSQAAQAAVEAHLASCARLGDLDLLLVFWSGYLFTIDSLVQTLAGSTDARLRVLIIDTCHADDRMRRLQAAIADLPDDRRPVVLASCAADG
Ga0070676_1025632713300005328Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADL
Ga0070682_10066815213300005337Corn RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASC
Ga0070661_10120442213300005344Corn RhizosphereMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATAPAVDAHLAHCATLDALDLLLVYWSGHLFTIDPVVDALTHDAVRLRVLIVDTCHADERVSRLQSALEDVPEDRRPIVLVSCAAD
Ga0070673_10094073023300005364Switchgrass RhizosphereMPVKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPSAIEAHLAYCGGLQNLDLLLLFWSGHVFSIDPLVDALTRADDTRLRVLVVDTCHAAERMRRLEETLS
Ga0070659_10004035013300005366Corn RhizosphereMLSRDFRYHLLSIGVNREANGASIRSAERDAFGISWTFAQLGYWRAERNRCLTGTQASPASIDAHLAYCGQIDDLDLLLLFWSGHLFSIDPILEMIARTPDVRLRVLIVDTCQAGDRLQRLDEALGEIPGAQRPVALASCA
Ga0070705_10049151113300005440Corn, Switchgrass And Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSTDARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASCAADGRARENSVNGHFTAALLRQLRRP
Ga0070663_10069626823300005455Corn RhizosphereMLSRDFRYHLLSIGVNREANGASIRSAERDAFGISWTFAQLGYWRAERNRCLTGTQASPASIDAHLAYCGQIDDLDLLLLFWSGHLFSIDPILEMIARTPDVRLRVLIVDTCQAGDRLQRLDEALGEIPGAQRPVALASCAP
Ga0068867_10124919313300005459Miscanthus RhizosphereMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAVDAHLSSCAGLQDLDLLMLFWSGHFFSDAPVVEALAAVPSAKLRVLIVDTCHAEDRIRRLEQALSGLPEERRPIVLASCAADSRTRENSVH
Ga0073909_1066170413300005526Surface SoilMPARDFRYHLLSIGVNREANGATVRAAERDAFGLSWTFAQLGYWRADRNRCLTGSQAAQAAVEAHLASCARLGDLDLLLVFWSGYLFTIDSLVQALAGSTDARLRVLIIDTCHADDRMRRLQAAIAELPDDRRPVVLAS
Ga0070679_10124442213300005530Corn RhizosphereMLSRDFRYHLLSIGVNREANGASIRSAERDAFGISWTFAQLGYWRAERNRCRTGTQASPASIDAHLAYCGQIDDLDLLLLFWSGHLFSIDPILEMIARTPDVRLRVLIVDTCQAGDRLQRLDEALGEIPGAQRPVALASCAPDGRARENSV
Ga0070734_1037309123300005533Surface SoilVPRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPDAIDAHLEHSAGITDLDLLLLFCSGHLHATKSLIEAVDSGAHARLRIVIVDTCHADDAIASIECAA
Ga0070695_10005202313300005545Corn, Switchgrass And Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSTDARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASCAADGRARENSVNGHFTAALLRQLRRP
Ga0070664_10222695913300005564Corn RhizosphereMPLRDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATASAIDAHLAHCAAIEDLDLLLLFWSGHLFDDARILDTLAAVPSARLRVLIVDTCHAEDRIERLERAID
Ga0066708_1067494813300005576SoilMRDFRYHLLSIGVNREANGATVRSAERDAFGMSWTFAQLGYWRAERNRCLTGPQATPAAIDAHLSHCASIDDLDLLMIYWSGHVFAIDPILEALAQQMNARLRVLIVDTCHAG
Ga0068854_10149719623300005578Corn RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADLPEERRPIVL
Ga0066903_10590973913300005764Tropical Forest SoilMPPRDFRYHLLSIGVNREANGASVRAAERDAFGVSWTFAQLGYWRADRNRCLTGAQAAASAVEAHLAHCASLDDLDLLLVYWSGHLLAVDPLVDALARDGGARLRVLIVDTCHAEDRMQQLEAAIADVPAPRRPMVLASCAADSRARENS
Ga0068863_10083672223300005841Switchgrass RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTC
Ga0075362_1024570013300006177Populus EndosphereMPLRDFRYHLLSIGVNRDANGASVRSAERDAFGMSWTFAQLGYWRADRNRCLTGLQAAPSAVDAHLAHCTGLDELDLLLVYWAGHLFSVDPLVDALARDGGARLRVLIVDTCHADDRMRRLETALDAVPAPRRPIVLASCAPDSRARE
Ga0075366_1082983113300006195Populus EndosphereMPQRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAEHNRCLTGAQAAQPAVERHLSHCAGLDDLDLLFVYWSGHLFTVQPLVETLARDGGARLRVLIVDTCHA
Ga0075370_1020151723300006353Populus EndosphereMPLRDFRYHLLSIGVNRDANGASVRSAERDAFGMSWTFAQLGYWRADRNRCLTGLQAAPSAVDAHLAHCTGLDELDLLLVYWAGHLFSVDPLVDALARDGGARLRVLIVDTCHADDRMRRLE
Ga0079218_1251074323300007004Agricultural SoilVYNSRDFRYHLLSIGVNREANGASVRSAERDAFAISWTFAQLGYWRAERNRCLTGAQSTPQAIDAHLSSCASLHDLDLVMVFWSGHLFHDTEVVETLAAVPDARLRVLIVDTCHADDRLKRIEAALEAVTE
Ga0114129_1332960213300009147Populus RhizosphereMASRDFRYHLLSIGVNRDANGATIRSAERDAFGISWTFAQLGYWRVERNRCLTGTQATPSAIEAHLAHCAQLNDLDSLLVYWSGHLFADTAIVEALTSVPSARLRVLIVDTCHCEDRVERLARALDDGV
Ga0105243_1067921013300009148Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSTDARLRVLIIDTCHADDRMRRLETAIADLPDERRPI
Ga0105241_1108781413300009174Corn RhizosphereLTALAPKHQSIPFMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADLPEERRPIVLAACAAD
Ga0105242_1073671713300009176Miscanthus RhizosphereMPVRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQATAQAIDAHLAHCADLDDLDLLLVYWSGHLFTVNPLVDALARDGGARLRVPIVDTCHADDR
Ga0105238_1083593013300009551Corn RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADLPEERRPIVLASCAADGRARENSVNGYFTAAL
Ga0105249_1007807133300009553Switchgrass RhizosphereMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAIDRHLASCASLHDLDLLLLFWSGHFFSEAPVVEALAGAPSARLRVLIVDTCHAEERIRRLEQALAALPDDRRPIALASCAA
Ga0105340_118946213300009610SoilMPAKDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRADRNRCLTGAQASASAIEGHLAHCAGLEDLDLLLLFWSGHLFSVDPIVEALANAGGARLRVLLVDTCHADDRMQR
Ga0126307_1082113113300009789Serpentine SoilMPLRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATAPAIEAHLAHCAAIEDLDLLLLFWSGHLYTIDPIVEALARGGETRLRVLVVDTCHADDRIRRLEDALDGVPADRRPIVMASCAP
Ga0134070_1047973913300010301Grasslands SoilVIKVDEKSNRHTSWRFMPVRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRADHNRCLTGAQAAPPAVDAHLAHCAGLDDLDLLFVYWSGHLFGVPALVDAIAREGIARLRILIVDTCHAD
Ga0126377_1244453223300010362Tropical Forest SoilMPARDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERHRCLTGTQAVPPAVEAHLAHCAGLDELDLLLVYWSGHLFTIDPIVEALVRDGCARLRVLIVDTCHADDRMRRLE
Ga0126379_1043472423300010366Tropical Forest SoilMPPRDFRYHLLSIGVNREANGASVRAAERDAFGVSWTFAQLGYWRADRNRCLTGAQAAASAVEAHLAHCASLDDLDLLLVYWSGHLLAVDPLVDALARDGGARLRVLIVDTCHAEDRMQQLE
Ga0134124_1277583913300010397Terrestrial SoilMPGRDFRYHLLSIGVNRDANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQATPAAIEAHLSNWSALEDLDLLLLFWSGHFFRDAPVVEALAAAPSARLRVLIVDTCGAQEAMRRLGDALEALPGDRRPIVLASCAADG
Ga0134121_1009860113300010401Terrestrial SoilMPARDFTYHLLSIGVNREANGATVRSAERDAFALSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASCAADGRARENSVNGHF
Ga0134123_1283871123300010403Terrestrial SoilMPGRDFSYHLLSIGVNRDANGASVRSAERDAFGMSWTFAQLGYWRAERNRCLTGTQATPSAVDAHLASCARLDDLDLLLLFWSGHLFADADIVNALASVPSARLRVLIVDTCHCEDRVEGLERALSGVDDERRPVVLASCAADTRTRE
Ga0137776_161239323300010937SedimentVPRDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPAAIDAHLEHGAGITDLDLLLLFWSGHLHAAESLIGAVESGAQARLRIVIVDTCHADDAIAAIERAAAALPADR
Ga0137374_1090298413300012204Vadose Zone SoilMPLRDFRYHLLSIGVNREANGATVRSAERDAFGMSWTFAQLGYWRAERNRCLTGAQATPSAIEAHLAYCAGLEDLDLLLLFWSGHLFAIDPLVEALARAGDTRLRVLLVDTCHADDRMRRLEAALAALPDDRRPIVLASC
Ga0150985_10332007123300012212Avena Fatua RhizosphereMPGRDFRYHLLSIGVNRDANGASVRAAERDAFGISWTFAQLGYWRAERNRCLTGAQATPTAIQAHLSSCAALDDLDLLFVFWSGHLFTDAAIVQTLAAVPSARLRVLIVDTCRAEDRIEN
Ga0150985_10547765213300012212Avena Fatua RhizosphereMPAQDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRPDRNRCLTGAQAAAPAIDAHLAHCAGLDDLDLLFVYWSGHLFTVNPLVDALARDGGARLRVLIVDTCHADDRMQHLEDALSGVPA
Ga0157285_1023793423300012897SoilMPVKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATLPAIDRHLAYSAGLQDLDLLLVFYSGHVFSIDPIVEALARADDTRLRVLVVDTCHADDGMRRLQQALAALP
Ga0157295_1031447913300012906SoilMPAKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQASASAIEGHLAHCAGLENLDLLLLFWSGHLFSVDPIVGALASAGAARLRVLLVDTCHADDRMQRLGAAL
Ga0157308_1016906723300012910SoilMPAKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQASASAIEGHLAHCAGLENLDLLLLFWSGHLFSVDPIVGALASAGAARLRVLLVDTCHADDRMQRLGA
Ga0164299_1027738023300012958SoilMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSTDARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASCAADGRARENSVNG
Ga0164309_1154168313300012984SoilMLLRDFRYHLLSIGVNREANGSSIRSAERDAFGISWTFAQLGYWRAERNRCLTGTQSSPASIDAHLAYCGQIDNLDLLLLFWSGHLFSIDPILEMIARTPDVRLRVLIVDTCQAGDRLQRLDEALGEIPDSQRPVALASCAPDG
Ga0164308_1175469313300012985SoilMPLRDFRYHLLSIGVNREANGATVRAAERDAFGISWTFAQLGYWRAERNRCLTGPQATAPAVEAHLAHCAAIDELDLLLIYWSGHLFGMDRALEALSRYATRLRVVIVDTCH
Ga0157370_1018990313300013104Corn RhizosphereMPGRDFRYHLLSIGVNREANGHSVRSAERDAFGISWTFAQLGYWRAERNRCLMSAQATPPAVDAHLAHVGDLTDLDLLLVYWSGHLFTVDPIVDALARDGSARLRVLIVDTCHADDRIRRLEAGVAGIAAERR
Ga0157369_1165513613300013105Corn RhizosphereMPGRDFRYHLLSIGVNREANGHSVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQAAPPAVDAHLAHCAALDELDLLLVYWSGHLFAVAPIVEALARESGARLRVLIVDT
Ga0163163_1310120213300014325Switchgrass RhizosphereMPVRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQATAQAIDAHLAHCADLDDLDLLLVYWSGHLFTVNPLVDALARDGGARLRVLI
Ga0173483_1087088623300015077SoilMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAIDRHLASCASLHDLDLLLLFWSGHFFSEAPVVEALAGVPSARLRVLIVDTCHAEERIRRLE
Ga0173478_1036404113300015201SoilLTALAPKHQSIPFMPARDFRYHLLSIGVNREANGATVRAAERDAFGLSWTFAQLGYWRADRNRCLTGSQAAQAAVEAHLASCARLGDLDLLLVFWSGYLFTIDSLVQTLAGSTDARLRVLIIDTCHADERM
Ga0132258_1387842123300015371Arabidopsis RhizosphereMPGRDFRYHLLSIGVNRESNGHSVRSAERDAFGMSWTFAQLGYWRAERNRCLTGAQAAPPAVDAHLAHCAALDDLDLLLVYWSGHLFAVDPLVAALAGQSARLRVLIVDTCHADDRMRRLADAIAELPDDRRPI
Ga0132257_10257015123300015373Arabidopsis RhizosphereMPPRDFRYHLLSIGVNREANGHSVRAAERDAFGISWTFAQLGYWRADRNRCLTGLQATSSAVDAHLAHCASLDDLDLLLVYWSGHLFTVNPVIDALARDGRARLRVLIVDTCHADDRMR
Ga0132255_10105801623300015374Arabidopsis RhizosphereVIKVAPFSGRNIVRRFMPVRDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQAAAPAIAAHLSHCAVIEDLDLLLVYWSGHLFAIDPLVDALARDNGTRLRVLIVDTCHADDRMRGLEQALAAVPDGRRPIVLASCADQG
Ga0182041_1114595113300016294SoilVARDFRYHLLSIGVNHEANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPSAIDAHLEYGSSLDNLDLLLLFWSGRLHSTDSLIGTLDAEPRARLRVIIV
Ga0182033_1126793613300016319SoilVARDFRYHLLSIGVNRETNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGTQATPSAIDAHLEYGSTLDDLDLLLVFWSGHLHSTDSLLAALGAEARARLRIIIVDTCHAGDAVTSVQKALEAMPDVGRPVLLASRSTRTSTGRSPRTGFCSRASSGTSARP
Ga0182033_1201424313300016319SoilVARDFRYHLLSIGVNREANGASVRSAERDAFGMSWTFAQLGYWRADRNRCLTGAQATPSAIDAHLEHGSGLDDLDLLLVFWSGHLHSTDGLIAALDAEARTRLRIVIVDTCHADEAVKQVESAV
Ga0182037_1168010713300016404SoilVARDFRYHLLSIGVNREANGASVRSAERDAFGMSWTFAQLGYWRADRNRCLTGAQATPSAIDAHLEHGSGLDDLDLLLVFWSGHLHSTGSLIAALDASEAARLRVAIVDTCQADESMAKIDRAVTAMPAERRPIVLVSSAADSRAR
Ga0184628_1029870113300018083Groundwater SedimentMALRDFRYHLLSVGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATAPAIEAHLAHCAAIDDLDLLLLFWSGHLYAVDPIVAALARAGDTRLRVLVVDTCHADDRMRDLEQALGALPDERRPIVLASCAADARSRENSVHG
Ga0184628_1052476813300018083Groundwater SedimentMPVRDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQASASAIEGHLAHCAGLEDLDLLLLFWSGHLFSVDPIVEALTNAGGARLRVLLVDTCHADDRMQRLGEALETLPDDRRPIVLASCAADS
Ga0190274_1001335753300018476SoilMPAKDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATASAIEGHLAHCAGLEDLDLLLLFWSGHLFSVDPIVEALANAGAARLRVLLVDTCHAADRMQR
Ga0190271_1237154413300018481SoilMPSRDFRYHLLSIGVNREANGATVRSAERDAFAISWTFAQLGYWRAERNRCLTGGQATAPAIDAHLASCAALEELDLVLLYWSGHLFHDAAVVETLAGVATARLRVLIVDTCHADDRMKRLEAALETVPEDRRPVVLAS
Ga0173479_1062399323300019362SoilMPVKDFRYHLLSIGVNRESNGTTVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQATPAAVDAHLSSCSTLDDLDLLMLFWSGHLGDAPVVETLAAVPSARLRVLIVDTCHAEDRMRRM
Ga0210380_1050029613300021082Groundwater SedimentMPLRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATPSAIDAHLAHSAGLEDLDLLLVFYSGHIFTIDPIVDALARADGTRLRVLVVDTCHAGDRMR
Ga0247745_103667323300022898SoilMPARDFRYHLLSIGVNREANGATVRAAERDAFGLSWTFAQLGYWRADRNRCLTGSQAAQAAVEAHLASCARLGDLDLLLVFWSGYLFTIDSLVQTLAGSTDARLRVLIIDTCHADERMRRLQAAIAELPDDR
Ga0247793_107562013300023066SoilMPARDFRYHLLSIGVNREANGATVRAAERDAFGLSWTFAQLGYWRADRNRCLTGSQAAQAAVEAHLASCARLGDLDLLLVFWSGYLFTIDSLVQTLAGSTDARLRVLIIDTCHADERMRRLQAAIAELPDDRRPVVL
Ga0207695_1120665823300025913Corn RhizosphereMPGRDFRYHLLSIGVNREANGHSVRSAERDAFGISWTFAQLGYWRAERNRCLMSAQATPPAVDAHLAHVGDLTDLDLLLVYWSGHLFTVDPIVDALARDGSARLRVLIVDTCHAD
Ga0207690_1046653423300025932Corn RhizosphereMPGRDFRYHLLSIGVNREANGHSVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAVDAHLAHCAELDELDLLLVYWSGHLFAVAPIVEALARESGARLRVLIVDTCQAEDRMRRLEA
Ga0207709_1147169113300025935Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSTDARLRVLIIDTCHADDRMRRLETAIADLP
Ga0207704_1041676413300025938Miscanthus RhizosphereMPARDFTYHLLSIGVNREANGATVRSAERDAFGLSWTFAQLGYWRADRNRCLTGAQAAQPAVEGHLASCTRLDDLDLLLVFWSGHLFAVDLLVETLASSADARLRVLIIDTCHADDRMRRLETAIADLPDERRPIVLASCAA
Ga0207691_1120275123300025940Miscanthus RhizosphereMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAIDRHLASCASLHDLDLLLLFWSGHFFSEAPVVEALAAVPSAKLRVLIVDTCHAEERIRRLEQALAGLPDDRRPIVLASCAADSRTRENSV
Ga0207711_1113496123300025941Switchgrass RhizosphereMPVRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGTQATAQAIDAHLAHCADLDDLDLLLVYWSGHLFTVNPLVDALARDGGARLRVLIVDTCHADDRMR
Ga0207679_1085505523300025945Corn RhizosphereMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPTAIDAHLSSCAALDDLDLLFLFWSGHLFTDAAIVQTLAAVPSARLRVLIVDTCHAEDRIEKLERSL
Ga0207639_1139195013300026041Corn RhizosphereMLSRDFRYHLLSIGVNREANGASIRSAERDAFGISWTFAQLGYWRAERNRCLTGTQASPASIDAHLAYCGQIDDLDLLLLFWSGHLFSIDPILEMIARTPDVRLRVLIVDTCQAGDRLQRLDEALSNIPDAQRPVALASCAPDGRARE
Ga0207675_10185365513300026118Switchgrass RhizosphereFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPSAIDAHLAHSAGLEDLDLLLVFYSGHIFTIDPIVDALARADGTRLRVLVVDTCHAGDRMRRLEEALAALPDDRRPVVLASCTADARKR
Ga0209438_102322713300026285Grasslands SoilMPVTDFRYHLLSIGVNRDANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATPAAIDAHLAHCAGLDDLDLLLLFWSGHLFGIDPLVDALARAADTRLRVLIVD
Ga0209468_102983913300026306SoilMPLRDFRYHLLSVGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATAPAIEAHLAHCAAIDDLDLLLLFWSGHLYAVAPIVEALARAGDTRLRVLVVDTCHA
Ga0307503_1002714223300028802SoilMPLRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATPSAIDAHLAHSAGLEDLDLLLVFYSGHIFSIDPIVDALARADGTRLRVLVVDTCHAGDRMR
Ga0307503_1044672013300028802SoilMPLKDFRYHLLSIGVNREANGASVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATPPAIDAHLAYCGGLKDLDLLLLFWSGHVFSIDPIVDALARAEETRLRVLVLDTCHADDRMRRLEAALAALPDDRRPVVLASCAANAR
Ga0307296_1048418623300028819SoilMPLRDFRYHLLSVGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATAPAIAAHLAHCAAIDDLDLLLLFWSGHLYAVDPIVEALARAGDTRLRVLVADTCH
Ga0307286_1009519623300028876SoilMPLRDFRYHLLSVGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATAPAIAAHLAHCAAIDDLDLLLLFWSGHLYAVDPIVEALARAGDTRLRVLVVDTCHADDRMRDLEQALAALPDERRPIV
Ga0307498_1048869113300031170SoilMPARDFRYHLLSIGVNREANGHSVGSAERDAFGISWTFAQLGYWRAERNRCLTGVQATPPAVEAHLAHGAAIPELDLLLVYWSGHLFTVTPVVEALAREGGARLRVLIVDTCHADDRMRRLADAIAEVPEERRPIVLASCAADAHAR
Ga0307497_1033538013300031226SoilMPLKDFRYHLLSIGVNREANGASVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQATPPAIDAHLAYCGGLKDLDLLLLFWSGHVFSIDPIVDALARAEETRLRVLVLDTCHADDRMRRLEAALAALPDDRRPVVLASCAANARTRENSVHGFFT
Ga0307408_10224874113300031548RhizosphereMQSRDFRYHLLSIGVNREANGASVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQSTPQAIEAHLSSCATLEELDLVMVFWSGHLFHDTAVVETLAAIPDARVRVLIVDTCHADERLHRIEAALAAAPDD
Ga0307405_1208262213300031731RhizosphereMQSRDFRYHLLSIGVNREANGASVRSAERDAFGVSWTFAQLGYWRAERNRCLTGAQSTPQAIEAHLSSCATLEELDLVMVFWSGHLFHDTAVVETLAAIPDARVRVLIVDTCHADERLHRIEAALAAAPDDRRP
Ga0318526_1031468923300031769SoilVARDFRYHLLSIGVNRETNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGTQATPSAIDAHLEYGSTLDDLDLLLVFWSGHLHSTDSLLAALGAEARARLRIIIVD
Ga0318547_1070763413300031781SoilVARDFRYHLLSIGVNREANGASVRSAERDAFGMSWTFAQLGYWRADRNRCLTGAQATPSAIDAHLEHGSGLDDLDLLLVFWSGHLHSTDGLIAALDAEARTRLRIVIVDTCHADEAVKQVESAVEAVPDDRRPVLL
Ga0318557_1051998123300031795SoilMARDFRYHLLSIGVNREGNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPSAVDAHLEHVATLDDLDLLLLFWSGHLHSTGSLIAALEASAAARLRIAIVDTCKAD
Ga0310907_1048497523300031847SoilVQSRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQSTPQAIDAHLSSCAGLEDLDLLMVFWSGHLFHDAEVIDTLAAVPDTRLRVLIVDTCHAEDRLKKIEAALDRVP
Ga0310904_1101975313300031854SoilMPQRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAEHNRCLTGAQAAQPAVERHLSHCAGLDDLDLLFVYWSGHLFTVQPLVETLARDGGARLRVLIVDTCHAD
Ga0310892_1006791923300031858SoilVQSRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQSTPQAIDAHLSSCAGLEDLDLLMVFWSGHLFHDAEVIDTLAAVPDTRLRVLIVDTCHAEDRLKKIEAALDRVPGDR
Ga0307406_1190489723300031901RhizosphereVYNSRDFRYHLLSIGVNREANGASVRSAERDAFAISWTFAQLGYWRAERNRCLTGAQSTPQAIDAHLSSCASLHDLDLVMVFWSGHLFHDTEVVETLAAVPDARLR
Ga0310900_1025402613300031908SoilVQSRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQSTPQAIDAHLSSCAGLEDLDLLMVFWSGHLFHDAEVIDTLAAVPDTRLRVLIVDTCHAEDRLKKIEAALDRVPG
Ga0310900_1068383223300031908SoilMPLKDFRYDLLSVGVNREANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGGQATPSAIDAHLAYCGGLRDLDLLLLFWSGHVFSIDPILAALARADEARLRVLVVDTCHADDRMRRLEAALAVLPDDRRPV
Ga0310900_1169859213300031908SoilMHSRDFRYHLLSIGVNREANGATVRSAERDAFAISWTFAQLGYWRAERNRCLTGGQATAPAIDAHLASCAAIDEVDLVLLFWSGYLFHDAAVIETLAGIANARLRVLIVDTCHADDRMKRLESAIDA
Ga0310913_1098833513300031945SoilVARDFRYHLLSIGVNRETNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGTQATPSAIDAHLEYGSTLDDLDLLLVFWSGHLHSTDSLLAALGAEARARLRIIIVDT
Ga0310909_1151290113300031947SoilVARDFRYHLLSIGVNRETNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGTQATPSAIDAHLEYGSTLDDLDLLLVFWSGHLHSTDSLLAALGAEARARLRIIIVDTCHAGDAVTSVQKALE
Ga0307409_10051217313300031995RhizosphereVSRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQSTAAAIEAHLSSCATLDDLDLVMVFWSGHLFHDVAIVETLASVADARLRVLIVDTCHAEDRMRRLQQALDKLPDD
Ga0307409_10109935413300031995RhizosphereMPGRDFRYHLLSIGVNRDANGASVRAAERDAFGVSWTFAQLGYWRAERNRCLTGTQATPTAVEAHLSSCARLEDLDLLLLFWSGHLFADTDIVEALAAVPSARLRVLIVDTCHAEDRVERLDRAVAGAPDDRRPVVLVSCAAD
Ga0307416_10020167623300032002RhizosphereMHSRDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPQAIDAHLASCAALEDLDLLLLFWSGHLFHDSGVIETLASVADARLRVLIVDTCHADERIKRLEAALDAAPED
Ga0310897_1024797913300032003SoilMPGRDFRYHLLSIGVNREANGASVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPPAIDRHLASCASLHDLDLLLLFWSGHFFSEAPVVEALAGVPSARLRVL
Ga0307411_1195143113300032005RhizosphereMHSRDFRYHLLSIGVNREANGATVRSAERDAFGISWTFAQLGYWRAERNRCLTGAQATPQAIDAHLASCAALEDLDLLLLFWSGHLFHDSGVIETLASVADARLRVLIVDTCHADERIKRLEAALDAAPEDRRPV
Ga0318562_1027396613300032008SoilMARDFRYHLLSIGVNREGNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPSAVDAHLEHVATLDDLDLLLLFWSGHLHSTGSLIAALEASAAARLRIAIVDTCQADESMAKIDGAVTVMPAERRPIVLVS
Ga0318563_1063073013300032009SoilVARDFRYHLLSIGVNRETNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGTQATPSAIDAHLEYGSTLDDLDLLLVFWSGHLHSTDSLLAALGAEARARLR
Ga0310906_1104881623300032013SoilMPAKDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAERNRCLTGGQATPSAIDAHLAYCGGLRDLDLLLLFWSGHVFSIDPILAALARADEARLRVLVVDTCHADDR
Ga0310890_1029686323300032075SoilMPQRDFRYHLLSIGVNREANGATVRSAERDAFGVSWTFAQLGYWRAEHNRCLTGAQAAQPAVERHLSHCAGLDDLDLLFVYWSGHLFTVQPLVETLARDGGARLRVLIVDTCHADDRLSRLEDALAGVPEARRPIVLASCASDARARENSVN
Ga0310890_1096940313300032075SoilMSAKDFRYYLLSIGVNHDANGASVRSAERDAFGVSWTFGQLGYWRADRNRCLTGAQATPTSIHAHLAHCAGLEDLDLLLLFWSGHLFSVDPIVEALANAGTARLRVLLVDTCHADDRMQR
Ga0306920_10065332123300032261SoilMARDFRYHLLSIGVNREGNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPSAVDAHLEHVATLDDLDLLLLFWSGHLHSTGSLIAALEASAAARLRIAIVDTC
Ga0306920_10130245413300032261SoilVARDFRYHLLSIGVNRETNGASVRSAERDAFGISWTFAQLGYWRADRNRCLTGTQATPSAIDAHLEYGSTLDDLDLLLVFWSGHLHSTDSLLAALGAEARARLRIIIVDTCHAGDAVTSVQKALEAMPDVGRPVLL
Ga0310914_1036601223300033289SoilVARDFRYHLLSIGVNHEANGATVRSAERDAFGISWTFAQLGYWRADRNRCLTGAQATPSAIDAHLEYGSSLDNLDLLLLFWSGRLHSTDSLIGTLDAEPRARLRVIIVDTCHAQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.